F452378

General Info

Members Datasets Scaffolds Average Seq Length
481 263 479 272

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100029725|Ga0068863_1000297256
Length 298
Sequence MAVSPAGPPQGTESVPSGGRERGGTLRTRVITALVLIPAVLAALFLLPPKAWGFVMLAIILVAANEWGRLVALPRWLGNAFMLVILIVGAQLLLSPAAGFERGWPDRIVYVVCGVASLFWIVVAPPWVVSRWPTQAKVPMTIVGVVVLVGAWMALVQMQAQSPWLVLAAMAIVWIADTAAYFTGRKLGRHKLAPVVSPGKSWEGVYGAWVAVAIYAAVLVIFAGHAGYRGNVTPLAIALWIAFVVALASVSVVGDLFESLLKRHAGVKDSGSLDRTDALLAAMPIAALAAQLVLDRNT

Samples

Sample ID Description Type Environment
1 2547132512 Azospira oryzae 6a3 Isolate Unclassified
2 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
158 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
159 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
160 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
172 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
173 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
179 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
180 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
192 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
193 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
212 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
257 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
258 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
259 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
260 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.25
Nodule 0
Rhizoplane 4.16
Rhizosphere 93.76
Stem 0
Stem Tuber 0
Unclassified 0.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10002393 3300005327 Bacteria 15721
2 Ga0070658_10201020 3300005327 Bacteria 1681
3 Ga0070676_10108824 3300005328 Bacteria 1723
4 Ga0070683_100125684 3300005329 Bacteria 2424
5 Ga0070690_100002011 3300005330 Bacteria 10839
6 Ga0070690_100109143 3300005330 Bacteria 1844
7 Ga0070670_100006956 3300005331 Bacteria 9588
8 Ga0070670_100011317 3300005331 Bacteria 7625
9 Ga0070670_100012383 3300005331 Bacteria 7300
10 Ga0070670_100160578 3300005331 Bacteria 1948
11 Ga0070670_100213789 3300005331 Bacteria 1677
12 Ga0068869_100046517 3300005334 Bacteria 3129
13 Ga0068869_100070193 3300005334 Bacteria 2592
14 Ga0068869_100348243 3300005334 Unclassified 1207
15 Ga0070666_10003998 3300005335 Bacteria 8947
16 Ga0070666_10018960 3300005335 Bacteria 4434
17 Ga0070666_10225744 3300005335 Bacteria 1322
18 Ga0068868_100004147 3300005338 Bacteria 10130
19 Ga0068868_100124434 3300005338 Bacteria 2105
20 Ga0068868_100301845 3300005338 Bacteria 1360
21 Ga0068868_100352947 3300005338 Bacteria 1260
22 Ga0070660_100018593 3300005339 Bacteria 5080
23 Ga0070660_100024064 3300005339 Bacteria 4518
24 Ga0070689_100002136 3300005340 Bacteria 12821
25 Ga0070687_100042509 3300005343 Bacteria 2303
26 Ga0070687_100210445 3300005343 Bacteria 1184
27 Ga0070661_100239774 3300005344 Bacteria 1396
28 Ga0070668_100007765 3300005347 Bacteria 7966
29 Ga0070668_100013830 3300005347 Bacteria 6030
30 Ga0070669_100299144 3300005353 Bacteria 1294
31 Ga0070675_100101557 3300005354 Bacteria 2423
32 Ga0070675_100177355 3300005354 Bacteria 1841
33 Ga0070671_100014809 3300005355 Bacteria 6301
34 Ga0070671_100027234 3300005355 Bacteria 4703
35 Ga0070674_100117189 3300005356 Bacteria 1966
36 Ga0070674_100174342 3300005356 Bacteria 1642
37 Ga0070673_100000088 3300005364 Bacteria 39833
38 Ga0070673_100044091 3300005364 Bacteria 3452
39 Ga0070673_100463954 3300005364 Bacteria 1141
40 Ga0070688_100008679 3300005365 Bacteria 5530
41 Ga0070659_100074168 3300005366 Bacteria 2710
42 Ga0070659_100255384 3300005366 Bacteria 1453
43 Ga0070667_100003652 3300005367 Bacteria 13089
44 Ga0070667_100012878 3300005367 Bacteria 6910
45 Ga0070667_100436132 3300005367 Bacteria 1196
46 Ga0070709_10038399 3300005434 Bacteria 2931
47 Ga0070709_10157780 3300005434 Bacteria 1574
48 Ga0070714_100002535 3300005435 Bacteria 13462
49 Ga0070714_100584717 3300005435 Bacteria 1071
50 Ga0070713_100000376 3300005436 Bacteria 28622
51 Ga0070713_100093871 3300005436 Bacteria 2586
52 Ga0070710_10006476 3300005437 Bacteria 5627
53 Ga0070710_10129276 3300005437 Bacteria 1538
54 Ga0070711_100016030 3300005439 Bacteria 4750
55 Ga0070705_100109337 3300005440 Bacteria 1763
56 Ga0070700_100216255 3300005441 Bacteria 1355
57 Ga0070708_100000482 3300005445 Bacteria 30278
58 Ga0070708_100028043 3300005445 Bacteria 4841
59 Ga0070708_100555152 3300005445 Bacteria 1083
60 Ga0070678_100000393 3300005456 Bacteria 20549
61 Ga0070678_100001701 3300005456 Bacteria 11816
62 Ga0070678_100229786 3300005456 Bacteria 1546
63 Ga0070662_100031472 3300005457 Bacteria 3724
64 Ga0070662_100384957 3300005457 Bacteria 1155
65 Ga0070681_10021800 3300005458 Bacteria 6424
66 Ga0068867_100000771 3300005459 Bacteria 21595
67 Ga0068867_100061854 3300005459 Bacteria 2780
68 Ga0068867_100109870 3300005459 Bacteria 2117
69 Ga0068867_100195834 3300005459 Bacteria 1615
70 Ga0070706_100039973 3300005467 Bacteria 4329
71 Ga0070706_100078436 3300005467 Bacteria 3058
72 Ga0070706_100079227 3300005467 Bacteria 3040
73 Ga0070706_100487778 3300005467 Bacteria 1146
74 Ga0070707_100027448 3300005468 Bacteria 5416
75 Ga0070707_100066533 3300005468 Bacteria 3463
76 Ga0070707_100073611 3300005468 Bacteria 3294
77 Ga0070698_100076838 3300005471 Bacteria 3340
78 Ga0070698_100085695 3300005471 Bacteria 3137
79 Ga0070698_100142986 3300005471 Bacteria 2343
80 Ga0070679_100062011 3300005530 Bacteria 3726
81 Ga0070679_100109983 3300005530 Bacteria 2742
82 Ga0070679_100168082 3300005530 Bacteria 2166
83 Ga0070697_100004907 3300005536 Bacteria 10265
84 Ga0070697_100301509 3300005536 Bacteria 1377
85 Ga0070672_100002371 3300005543 Bacteria 11930
86 Ga0070672_100057271 3300005543 Bacteria 3059
87 Ga0070672_100157813 3300005543 Bacteria 1880
88 Ga0070672_100169914 3300005543 Bacteria 1813
89 Ga0070695_100018224 3300005545 Bacteria 4263
90 Ga0070695_100041257 3300005545 Bacteria 2924
91 Ga0070695_100110791 3300005545 Bacteria 1862
92 Ga0070696_100041408 3300005546 Bacteria 3182
93 Ga0070693_100007503 3300005547 Bacteria 5333
94 Ga0070693_100150313 3300005547 Bacteria 1474
95 Ga0070665_100005083 3300005548 Bacteria 13643
96 Ga0070665_100020278 3300005548 Bacteria 6675
97 Ga0070665_100026083 3300005548 Bacteria 5884
98 Ga0070704_100028458 3300005549 Bacteria 3718
99 Ga0070704_100403817 3300005549 Unclassified 1166
100 Ga0070664_100015472 3300005564 Bacteria 6240
101 Ga0070664_100557199 3300005564 Bacteria 1060
102 Ga0068857_100002661 3300005577 Bacteria 14667
103 Ga0068857_100120815 3300005577 Bacteria 2359
104 Ga0068854_100044733 3300005578 Bacteria 3144
105 Ga0068854_100059262 3300005578 Bacteria 2766
106 Ga0068856_100078837 3300005614 Bacteria 3266
107 Ga0070702_100055257 3300005615 Bacteria 2288
108 Ga0070702_100157490 3300005615 Bacteria 1464
109 Ga0068852_100040276 3300005616 Bacteria 3941
110 Ga0068852_100095763 3300005616 Bacteria 2666
111 Ga0068852_100624307 3300005616 Bacteria 1083
112 Ga0068859_100001228 3300005617 Bacteria 26165
113 Ga0068859_100018817 3300005617 Bacteria 6939
114 Ga0068864_100000494 3300005618 Bacteria 34063
115 Ga0068864_100001261 3300005618 Bacteria 21054
116 Ga0068864_100052916 3300005618 Bacteria 3500
117 Ga0068864_100288575 3300005618 Bacteria 1533
118 Ga0068866_10041312 3300005718 Bacteria 2287
119 Ga0068866_10064800 3300005718 Bacteria 1909
120 Ga0068866_10104201 3300005718 Bacteria 1571
121 Ga0068861_100003374 3300005719 Bacteria 10584
122 Ga0068851_10008673 3300005834 Bacteria 4708
123 Ga0068851_10052843 3300005834 Bacteria 2067
124 Ga0068870_10121228 3300005840 Bacteria 1507
125 Ga0068863_100001485 3300005841 Bacteria 23250
126 Ga0068863_100029725 3300005841 Bacteria 5217
127 Ga0068863_100031264 3300005841 Bacteria 5082
128 Ga0068863_100125686 3300005841 Bacteria 2446
129 Ga0068858_100000936 3300005842 Bacteria 30216
130 Ga0068858_100001037 3300005842 Bacteria 28700
131 Ga0068858_100270922 3300005842 Bacteria 1616
132 Ga0068860_100012199 3300005843 Bacteria 8466
133 Ga0068860_100028998 3300005843 Bacteria 5324
134 Ga0068862_100020430 3300005844 Bacteria 5533
135 Ga0068862_100152444 3300005844 Bacteria 2058
136 Ga0068862_100225608 3300005844 Bacteria 1698
137 Ga0075364_10008343 3300006051 Bacteria 6187
138 Ga0070716_100005445 3300006173 Bacteria 6169
139 Ga0070712_100001436 3300006175 Bacteria 14527
140 Ga0097621_100003683 3300006237 Bacteria 10596
141 Ga0097621_100016961 3300006237 Bacteria 5520
142 Ga0097621_100018429 3300006237 Bacteria 5332
143 Ga0068871_100042920 3300006358 Bacteria 3633
144 Ga0068871_100140351 3300006358 Bacteria 2054
145 Ga0075428_100058671 3300006844 Bacteria 4213
146 Ga0075433_10456409 3300006852 Bacteria 1126
147 Ga0075434_100010815 3300006871 Bacteria 8573
148 Ga0075434_100089061 3300006871 Bacteria 3088
149 Ga0075434_100141176 3300006871 Bacteria 2429
150 Ga0075434_100667644 3300006871 Unclassified 1057
151 Ga0068865_100061082 3300006881 Bacteria 2640
152 Ga0068865_100174195 3300006881 Bacteria 1652
153 Ga0097620_100001228 3300006931 Bacteria 26165
154 Ga0097620_100018817 3300006931 Bacteria 6939
155 Ga0075435_100206801 3300007076 Bacteria 1664
156 Ga0111539_10676894 3300009094 Bacteria 1201
157 Ga0105245_10013253 3300009098 Bacteria 7184
158 Ga0105245_10017158 3300009098 Bacteria 6316
159 Ga0105245_10116907 3300009098 Bacteria 2487
160 Ga0105245_10161080 3300009098 Bacteria 2129
161 Ga0105245_10241710 3300009098 Bacteria 1750
162 Ga0105247_10343411 3300009101 Bacteria 1048
163 Ga0105243_10272546 3300009148 Bacteria 1520
164 Ga0105241_10127366 3300009174 Bacteria 2057
165 Ga0105241_10147795 3300009174 Bacteria 1919
166 Ga0105241_10169466 3300009174 Bacteria 1802
167 Ga0105242_10003409 3300009176 Bacteria 12363
168 Ga0105242_10022416 3300009176 Bacteria 4966
169 Ga0105248_10008226 3300009177 Bacteria 11458
170 Ga0105248_10261002 3300009177 Bacteria 1950
171 Ga0105248_10627069 3300009177 Bacteria 1213
172 Ga0105237_10025234 3300009545 Bacteria 6079
173 Ga0105237_10025618 3300009545 Bacteria 6028
174 Ga0105237_10493479 3300009545 Bacteria 1231
175 Ga0105238_10030190 3300009551 Bacteria 5516
176 Ga0105239_10083102 3300010375 Bacteria 3526
177 Ga0105239_10803366 3300010375 Unclassified 1078
178 Ga0105246_10084672 3300011119 Bacteria 2269
179 Ga0157370_10032248 3300013104 Bacteria 5117
180 Ga0157370_10479005 3300013104 Bacteria 1144
181 Ga0157369_10087823 3300013105 Bacteria 3320
182 Ga0157374_10000383 3300013296 Bacteria 40730
183 Ga0157374_10122766 3300013296 Bacteria 2508
184 Ga0157374_10177264 3300013296 Bacteria 2081
185 Ga0157378_10019454 3300013297 Bacteria 5968
186 Ga0157378_10025316 3300013297 Bacteria 5226
187 Ga0157378_10235424 3300013297 Bacteria 1747
188 Ga0157378_10398153 3300013297 Bacteria 1356
189 Ga0163162_10021592 3300013306 Bacteria 6342
190 Ga0163162_10049848 3300013306 Bacteria 4198
191 Ga0163162_10147274 3300013306 Bacteria 2471
192 Ga0163162_10723278 3300013306 Bacteria 1116
193 Ga0157372_10158281 3300013307 Bacteria 2617
194 Ga0157375_10013470 3300013308 Bacteria 7280
195 Ga0157375_10035561 3300013308 Bacteria 4756
196 Ga0157375_10046915 3300013308 Bacteria 4215
197 Ga0157375_10081010 3300013308 Bacteria 3286
198 Ga0157375_10130851 3300013308 Bacteria 2628
199 Ga0163163_10000750 3300014325 Bacteria 27660
200 Ga0163163_10015389 3300014325 Bacteria 7072
201 Ga0163163_10063665 3300014325 Bacteria 3657
202 Ga0157380_10128540 3300014326 Bacteria 2158
203 Ga0182008_10032276 3300014497 Bacteria 2632
204 Ga0157379_10000112 3300014968 Bacteria 56064
205 Ga0157379_10002213 3300014968 Bacteria 16179
206 Ga0157379_10029392 3300014968 Bacteria 4888
207 Ga0157379_10549489 3300014968 Bacteria 1074
208 Ga0157376_10014083 3300014969 Bacteria 5989
209 Ga0157376_10018290 3300014969 Bacteria 5368
210 Ga0157376_10142848 3300014969 Bacteria 2149
211 Ga0163161_10040855 3300017792 Bacteria 3332
212 Ga0213872_10035600 3300021361 Bacteria 2276
213 Ga0207656_10192072 3300025321 Bacteria 983
214 Ga0207692_10007849 3300025898 Bacteria 4394
215 Ga0207642_10009344 3300025899 Bacteria 3407
216 Ga0207688_10114802 3300025901 Bacteria 1566
217 Ga0207680_10001440 3300025903 Bacteria 11281
218 Ga0207680_10016754 3300025903 Bacteria 3855
219 Ga0207680_10072519 3300025903 Bacteria 2138
220 Ga0207699_10030506 3300025906 Bacteria 3018
221 Ga0207699_10206703 3300025906 Bacteria 1333
222 Ga0207645_10049131 3300025907 Bacteria 2694
223 Ga0207705_10010151 3300025909 Bacteria 6852
224 Ga0207705_10402309 3300025909 Bacteria 1059
225 Ga0207684_10014943 3300025910 Bacteria 6682
226 Ga0207684_10106011 3300025910 Bacteria 2404
227 Ga0207707_10024191 3300025912 Bacteria 5313
228 Ga0207671_10092169 3300025914 Bacteria 2284
229 Ga0207693_10000254 3300025915 Bacteria 49362
230 Ga0207693_10020124 3300025915 Bacteria 5308
231 Ga0207663_10004204 3300025916 Bacteria 7136
232 Ga0207662_10135206 3300025918 Bacteria 1558
233 Ga0207662_10227014 3300025918 Bacteria 1218
234 Ga0207657_10002586 3300025919 Bacteria 19581
235 Ga0207657_10022283 3300025919 Bacteria 5934
236 Ga0207649_10084833 3300025920 Bacteria 2060
237 Ga0207652_10083225 3300025921 Bacteria 2802
238 Ga0207646_10005236 3300025922 Bacteria 13690
239 Ga0207646_10028303 3300025922 Bacteria 5103
240 Ga0207681_10014245 3300025923 Bacteria 4936
241 Ga0207681_10170819 3300025923 Bacteria 1648
242 Ga0207694_10364279 3300025924 Bacteria 1198
243 Ga0207650_10003372 3300025925 Bacteria 10997
244 Ga0207650_10022846 3300025925 Bacteria 4432
245 Ga0207650_10043249 3300025925 Bacteria 3306
246 Ga0207650_10141427 3300025925 Bacteria 1892
247 Ga0207659_10028025 3300025926 Bacteria 3821
248 Ga0207687_10006284 3300025927 Bacteria 7856
249 Ga0207687_10011076 3300025927 Bacteria 5896
250 Ga0207700_10000049 3300025928 Bacteria 80608
251 Ga0207664_10525431 3300025929 Bacteria 1061
252 Ga0207644_10002924 3300025931 Bacteria 11000
253 Ga0207644_10017931 3300025931 Bacteria 4787
254 Ga0207644_10072929 3300025931 Bacteria 2516
255 Ga0207690_10295391 3300025932 Unclassified 1266
256 Ga0207706_10023675 3300025933 Bacteria 5513
257 Ga0207686_10000302 3300025934 Bacteria 35955
258 Ga0207686_10121309 3300025934 Bacteria 1780
259 Ga0207670_10006135 3300025936 Bacteria 6647
260 Ga0207669_10076552 3300025937 Bacteria 2124
261 Ga0207704_10154064 3300025938 Bacteria 1626
262 Ga0207704_10275309 3300025938 Bacteria 1276
263 Ga0207665_10010629 3300025939 Bacteria 6047
264 Ga0207691_10004126 3300025940 Bacteria 14114
265 Ga0207691_10005913 3300025940 Bacteria 11816
266 Ga0207691_10007106 3300025940 Bacteria 10808
267 Ga0207691_10073310 3300025940 Bacteria 3088
268 Ga0207691_10347223 3300025940 Bacteria 1270
269 Ga0207691_10479076 3300025940 Bacteria 1058
270 Ga0207711_10006666 3300025941 Bacteria 9721
271 Ga0207711_10359711 3300025941 Bacteria 1348
272 Ga0207689_10004808 3300025942 Bacteria 12180
273 Ga0207689_10030414 3300025942 Bacteria 4500
274 Ga0207689_10073469 3300025942 Bacteria 2809
275 Ga0207689_10186290 3300025942 Bacteria 1712
276 Ga0207679_10192797 3300025945 Bacteria 1696
277 Ga0207651_10007164 3300025960 Bacteria 5925
278 Ga0207668_10007805 3300025972 Bacteria 6365
279 Ga0207668_10022684 3300025972 Bacteria 4023
280 Ga0207668_10024000 3300025972 Bacteria 3930
281 Ga0207668_10055507 3300025972 Bacteria 2754
282 Ga0207668_10181996 3300025972 Bacteria 1659
283 Ga0207658_10005387 3300025986 Bacteria 8782
284 Ga0207658_10033765 3300025986 Bacteria 3651
285 Ga0207658_10053479 3300025986 Bacteria 2984
286 Ga0207677_10000739 3300026023 Bacteria 18996
287 Ga0207677_10100627 3300026023 Bacteria 2126
288 Ga0207677_10144234 3300026023 Bacteria 1828
289 Ga0207703_10002596 3300026035 Bacteria 15609
290 Ga0207703_10544498 3300026035 Bacteria 1094
291 Ga0207678_10123751 3300026067 Bacteria 2207
292 Ga0207702_10015788 3300026078 Bacteria 6253
293 Ga0207702_10038768 3300026078 Bacteria 3991
294 Ga0207702_10046785 3300026078 Bacteria 3643
295 Ga0207641_10023067 3300026088 Bacteria 5127
296 Ga0207641_10264203 3300026088 Bacteria 1613
297 Ga0207641_10319869 3300026088 Bacteria 1471
298 Ga0207648_10007249 3300026089 Bacteria 10934
299 Ga0207648_10077720 3300026089 Bacteria 2894
300 Ga0207648_10090062 3300026089 Bacteria 2680
301 Ga0207676_10000470 3300026095 Bacteria 33856
302 Ga0207676_10029810 3300026095 Bacteria 4089
303 Ga0207676_10104808 3300026095 Bacteria 2353
304 Ga0207676_10238032 3300026095 Bacteria 1631
305 Ga0207674_10003107 3300026116 Bacteria 20492
306 Ga0207674_10003808 3300026116 Bacteria 18395
307 Ga0207674_10048201 3300026116 Bacteria 4361
308 Ga0207675_100002525 3300026118 Bacteria 18102
309 Ga0207675_100630597 3300026118 Bacteria 1077
310 Ga0207675_100635506 3300026118 Bacteria 1073
311 Ga0207683_10000227 3300026121 Bacteria 49549
312 Ga0207683_10001514 3300026121 Bacteria 20930
313 Ga0207683_10002399 3300026121 Bacteria 16367
314 Ga0207683_10003576 3300026121 Bacteria 13558
315 Ga0207683_10182550 3300026121 Bacteria 1903
316 Ga0207698_10267116 3300026142 Bacteria 1575
317 Ga0207698_10464716 3300026142 Bacteria 1224
318 Ga0207698_10555213 3300026142 Bacteria 1126
319 Ga0209967_1014090 3300027364 Bacteria 1137
320 Ga0209999_1035657 3300027543 Unclassified 928
321 Ga0209983_1019630 3300027665 Bacteria 1406
322 Ga0209974_10003496 3300027876 Bacteria 5660
323 Ga0268266_10005484 3300028379 Bacteria 11812
324 Ga0268266_10010114 3300028379 Bacteria 8271
325 Ga0268266_10211276 3300028379 Bacteria 1780
326 Ga0268265_10009063 3300028380 Bacteria 6729
327 Ga0268265_10076826 3300028380 Bacteria 2621
328 Ga0268265_10093159 3300028380 Bacteria 2413
329 Ga0268264_10000702 3300028381 Bacteria 38628
330 Ga0268264_10006554 3300028381 Bacteria 9801
331 Ga0268264_10078151 3300028381 Bacteria 2820
332 Ga0268264_10396243 3300028381 Bacteria 1326
333 Ga0265318_10002465 3300028577 Bacteria 9884
334 Ga0265330_10007917 3300031235 Bacteria 5149
335 Ga0265332_10000024 3300031238 Bacteria 209663
336 Ga0265332_10012989 3300031238 Bacteria 3692
337 Ga0265320_10010001 3300031240 Bacteria 5674
338 Ga0265340_10178076 3300031247 Bacteria 962
339 Ga0265331_10027333 3300031250 Bacteria 2860
340 Ga0265316_10072674 3300031344 Bacteria 2649
341 Ga0307509_10000815 3300031507 Bacteria 53574
342 Ga0265314_10051912 3300031711 Bacteria 2853
343 Ga0307413_10034109 3300031824 Bacteria 2906
344 Ga0307410_10091601 3300031852 Bacteria 2159
345 Ga0307406_10021900 3300031901 Bacteria 3787
346 Ga0307409_100389747 3300031995 Bacteria 1327
347 Ga0307416_100017853 3300032002 Bacteria 4979
348 Ga0307416_100282592 3300032002 Bacteria 1637
349 Ga0316583_10006660 3300032133 Bacteria 4159
350 Ga0373934_0005807 3300035086 Bacteria 4565
351 Ga0373952_0000515 3300035092 Bacteria 6774
352 Ga0373936_0032369 3300035113 Bacteria 2068
353 Ga0373936_0033891 3300035113 Bacteria 2026
354 Ga0373945_0006038 3300035116 Bacteria 3893
355 Ga0373945_0082763 3300035116 Bacteria 1232
356 Ga0373953_0000549 3300035117 Bacteria 10399
357 Ga0373954_0001605 3300035118 Bacteria 9228
358 Ga0373954_0135619 3300035118 Bacteria 1199
359 Ga0373957_0105424 3300035120 Bacteria 1132
360 Ga0373957_0112621 3300035120 Bacteria 1097
361 Ga0373960_0006266 3300035121 Bacteria 2786
362 Ga0373943_0029419 3300035170 Bacteria 2595
363 Ga0373955_0014310 3300035172 Bacteria 3856
364 Ga0373942_0159161 3300035207 Bacteria 729
365 Ga0373924_0024079 3300035410 Bacteria 2395
366 Ga0373935_0010365 3300035692 Bacteria 5592
367 Ga0373935_0041372 3300035692 Bacteria 2895
368 Ga0373935_0275849 3300035692 Bacteria 1183
369 Ga0373927_0009637 3300035695 Bacteria 6478
370 Ga0373927_0015224 3300035695 Bacteria 5083
371 Ga0373927_0028599 3300035695 Bacteria 3636
372 Ga0373927_0039810 3300035695 Bacteria 3050
373 Ga0373927_0193483 3300035695 Bacteria 1335
374 Ga0373947_0010860 3300035725 Bacteria 5225
375 Ga0373947_0031390 3300035725 Bacteria 3126
376 Ga0373947_0095402 3300035725 Bacteria 1861
377 Ga0373937_0019525 3300036401 Bacteria 6064
378 Ga0373937_0030445 3300036401 Bacteria 4888
379 Ga0373937_0038232 3300036401 Bacteria 4374
380 Ga0373937_0144248 3300036401 Bacteria 2228
381 Ga0373937_0288277 3300036401 Bacteria 1551
382 Ga0373925_0048763 3300037068 Bacteria 3156
383 Ga0373925_0305978 3300037068 Bacteria 1284
384 Ga0373925_0322078 3300037068 Bacteria 1251
385 Ga0400483_229594 3300039062 Bacteria 4814
386 Ga0436361_0941704 3300039447 Bacteria 6776
387 Ga0439443_000680 3300042003 Bacteria 3258
388 Ga0439435_0000079 3300042436 Bacteria 11718
389 Ga0439460_0003488 3300042461 Bacteria 3803
390 Ga0451577_0159968 3300042876 Bacteria 2028
391 Ga0453684_0012407 3300044712 Bacteria 14056
392 Ga0451576_0635245 3300045051 Bacteria 1122
393 Ga0466967_0131979 3300045976 Bacteria 2320
394 Ga0495629_0018980 3300046459 Bacteria 4917
395 Ga0495651_0067842 3300046462 Bacteria 2720
396 Ga0495653_0053033 3300046463 Bacteria 3104
397 Ga0495580_0011057 3300046472 Bacteria 6997
398 Ga0495580_0049671 3300046472 Bacteria 2968
399 Ga0495580_0100998 3300046472 Bacteria 2006
400 Ga0495582_0027788 3300046473 Bacteria 3102
401 Ga0495630_0268024 3300046517 Bacteria 1305
402 Ga0495665_0025696 3300046531 Bacteria 3162
403 Ga0495586_0053751 3300046535 Bacteria 2182
404 Ga0495621_0005344 3300046539 Bacteria 3684
405 Ga0495645_0214945 3300046543 Bacteria 1296
406 Ga0495667_0109209 3300046559 Bacteria 1787
407 Ga0495634_0057629 3300046642 Bacteria 2592
408 Ga0495635_0006317 3300046663 Bacteria 8257
409 Ga0495588_0234180 3300046674 Bacteria 969
410 Ga0495623_0025646 3300046679 Bacteria 3797
411 Ga0495658_0064077 3300046683 Bacteria 2116
412 Ga0495613_0049498 3300046689 Bacteria 3101
413 Ga0495624_0189480 3300046690 Bacteria 1251
414 Ga0495581_0030885 3300047315 Bacteria 3103
415 Ga0495680_0027008 3300047322 Bacteria 4723
416 Ga0495684_0028776 3300047471 Bacteria 4265
417 Ga0495602_0195212 3300048088 Bacteria 1549
418 Ga0496100_0041720 3300048903 Bacteria 2927
419 Ga0496102_0004079 3300048905 Bacteria 12387
420 Ga0496102_0101336 3300048905 Bacteria 2675
421 Ga0496103_0069431 3300048906 Bacteria 2203
422 Ga0496104_0003970 3300048907 Bacteria 12806
423 Ga0496105_0004163 3300048908 Bacteria 10856
424 Ga0496106_0131683 3300048909 Bacteria 1962
425 Ga0496108_0046399 3300048911 Bacteria 3630
426 Ga0496108_0062332 3300048911 Bacteria 3140
427 Ga0496108_0418158 3300048911 Bacteria 1171
428 Ga0496109_0025150 3300048912 Bacteria 5303
429 Ga0496109_0149391 3300048912 Bacteria 2187
430 Ga0496109_0171316 3300048912 Bacteria 2037
431 Ga0496110_0032191 3300048913 Bacteria 4527
432 Ga0496110_0075266 3300048913 Bacteria 3000
433 Ga0496110_0132225 3300048913 Bacteria 2254
434 Ga0496112_0000755 3300048915 Bacteria 22673
435 Ga0496112_0009610 3300048915 Bacteria 8723
436 Ga0496113_0050405 3300048916 Bacteria 3104
437 Ga0496115_0011797 3300048918 Bacteria 6562
438 Ga0501034_0008170 3300049571 Bacteria 11097
439 Ga0501034_0038528 3300049571 Bacteria 4840
440 Ga0501034_0057116 3300049571 Bacteria 3924
441 Ga0501038_0013506 3300049574 Bacteria 7443
442 Ga0501039_0044257 3300049575 Bacteria 3438
443 Ga0501040_0011648 3300049576 Bacteria 5756
444 Ga0501041_0006362 3300049577 Bacteria 6913
445 Ga0501042_0073100 3300049578 Bacteria 2453
446 Ga0501043_0023345 3300049579 Bacteria 4851
447 Ga0501046_0080196 3300049580 Bacteria 2523
448 Ga0501046_0161941 3300049580 Bacteria 1682
449 Ga0501048_0181744 3300049582 Bacteria 1491
450 Ga0501070_0368473 3300049586 Bacteria 1165
451 Ga0501071_0023735 3300049587 Bacteria 4284
452 Ga0501072_0000580 3300049588 Bacteria 26434
453 Ga0501072_0001967 3300049588 Bacteria 15316
454 Ga0501075_0013403 3300049591 Bacteria 5850
455 Ga0501076_0000054 3300049592 Bacteria 56703
456 Ga0501079_0002440 3300049741 Bacteria 13508
457 Ga0501081_0063164 3300049743 Bacteria 2570
458 Ga0501081_0071252 3300049743 Bacteria 2422
459 Ga0501280_000227 3300049776 Bacteria 14214
460 Ga0501045_0059387 3300049824 Bacteria 2801
461 nmdc:mga0n895_100249_c1 3300050512 Bacteria 2905
462 nmdc:mga0n895_1205222_c1 3300050512 Unclassified 731
463 nmdc:mga0n895_209538_c1 3300050512 Bacteria 1979
464 nmdc:mga0n895_494204_c1 3300050512 Bacteria 1233
465 nmdc:mga0rr50_116972_c1 3300050513 Bacteria 2117
466 nmdc:mga0rr50_54962_c1 3300050513 Bacteria 2968
467 nmdc:mga0a205_728731_c1 3300050515 Bacteria 841
468 Ga0495601_0186000 3300053077 Unclassified 1358
469 Ga0495601_0256938 3300053077 Bacteria 1141
470 Ga0495612_0039588 3300053078 Bacteria 1918
471 Ga0495619_0010303 3300053085 Bacteria 5883
472 Ga0500607_009339 3300053121 Bacteria 5906
473 Ga0500559_0023713 3300053136 Bacteria 2606
474 Ga0500636_0000185 3300053177 Bacteria 33554
475 Ga0500637_0009159 3300053178 Bacteria 5025
476 Ga0500625_002765 3300053729 Bacteria 6694
477 Ga0501084_0009826 3300054114 Bacteria 7907
478 Ga0501082_0425751 3300060353 Bacteria 1159
479 Ga0530510_0000037 3300061734 Bacteria 60389

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035207 Ga0373942_0159161 Ga0373942_0159161_30_719 185
2 3300049580 Ga0501046_0161941 Ga0501046_0161941_234_1016 204
3 3300027665 Ga0209983_1019630 Ga0209983_10196302 205
4 3300049743 Ga0501081_0063164 Ga0501081_0063164_23_805 205
5 3300048911 Ga0496108_0418158 Ga0496108_0418158_471_1142 209
6 3300048913 Ga0496110_0032191 Ga0496110_0032191_29_700 209
7 3300050512 nmdc:mga0n895_1205222_c1 nmdc:mga0n895_1205222_c1_11_718 218
8 3300035121 Ga0373960_0006266 Ga0373960_0006266_31_837 220
9 3300049571 Ga0501034_0057116 Ga0501034_0057116_2950_3765 223
10 3300026118 Ga0207675_100630597 Ga0207675_1006305972 224
11 3300049586 Ga0501070_0368473 Ga0501070_0368473_201_983 224
12 3300031238 Ga0265332_10000024 Ga0265332_1000002499 225
13 3300005331 Ga0070670_100213789 Ga0070670_1002137892 226
14 3300005543 Ga0070672_100157813 Ga0070672_1001578132 226
15 3300032133 Ga0316583_10006660 Ga0316583_100066603 226
16 3300050515 nmdc:mga0a205_728731_c1 nmdc:mga0a205_728731_c1_47_802 226
17 3300005339 Ga0070660_100018593 Ga0070660_1000185934 227
18 3300005467 Ga0070706_100039973 Ga0070706_1000399733 227
19 3300005530 Ga0070679_100109983 Ga0070679_1001099832 227
20 3300005536 Ga0070697_100004907 Ga0070697_1000049078 227
21 3300005616 Ga0068852_100040276 Ga0068852_1000402762 227
22 3300013105 Ga0157369_10087823 Ga0157369_100878233 227
23 3300025910 Ga0207684_10106011 Ga0207684_101060112 227
24 3300025919 Ga0207657_10022283 Ga0207657_100222834 227
25 3300025920 Ga0207649_10084833 Ga0207649_100848332 227
26 3300050512 nmdc:mga0n895_494204_c1 nmdc:mga0n895_494204_c1_281_1126 229
27 3300053729 Ga0500625_002765 Ga0500625_002765_3451_4239 229
28 3300026078 Ga0207702_10038768 Ga0207702_100387682 230
29 3300045976 Ga0466967_0131979 Ga0466967_0131979_419_1261 230
30 3300005616 Ga0068852_100624307 Ga0068852_1006243071 231
31 3300026142 Ga0207698_10464716 Ga0207698_104647162 232
32 3300049574 Ga0501038_0013506 Ga0501038_0013506_3555_4337 232
33 3300049575 Ga0501039_0044257 Ga0501039_0044257_2351_3133 232
34 3300049576 Ga0501040_0011648 Ga0501040_0011648_1570_2352 232
35 3300049577 Ga0501041_0006362 Ga0501041_0006362_2444_3226 232
36 3300049578 Ga0501042_0073100 Ga0501042_0073100_539_1321 232
37 3300049579 Ga0501043_0023345 Ga0501043_0023345_1490_2272 232
38 3300049580 Ga0501046_0080196 Ga0501046_0080196_574_1356 232
39 3300049587 Ga0501071_0023735 Ga0501071_0023735_39_821 232
40 3300049588 Ga0501072_0001967 Ga0501072_0001967_11788_12570 232
41 3300049591 Ga0501075_0013403 Ga0501075_0013403_3341_4123 232
42 3300049592 Ga0501076_0000054 Ga0501076_0000054_31863_32645 232
43 3300049741 Ga0501079_0002440 Ga0501079_0002440_1696_2478 232
44 3300049743 Ga0501081_0071252 Ga0501081_0071252_713_1495 232
45 3300049824 Ga0501045_0059387 Ga0501045_0059387_349_1131 232
46 3300054114 Ga0501084_0009826 Ga0501084_0009826_2881_3663 232
47 3300061734 Ga0530510_0000037 Ga0530510_0000037_42633_43415 232
48 3300026142 Ga0207698_10555213 Ga0207698_105552132 233
49 3300035092 Ga0373952_0000515 Ga0373952_0000515_2978_3784 233
50 3300007076 Ga0075435_100206801 Ga0075435_1002068012 234
51 3300009098 Ga0105245_10116907 Ga0105245_101169071 234
52 3300025907 Ga0207645_10049131 Ga0207645_100491312 234
53 3300028577 Ga0265318_10002465 Ga0265318_1000246510 234
54 3300031235 Ga0265330_10007917 Ga0265330_100079176 234
55 3300031238 Ga0265332_10012989 Ga0265332_100129893 234
56 3300031240 Ga0265320_10010001 Ga0265320_100100013 234
57 3300031247 Ga0265340_10178076 Ga0265340_101780761 234
58 3300031250 Ga0265331_10027333 Ga0265331_100273331 234
59 3300031344 Ga0265316_10072674 Ga0265316_100726743 234
60 3300031711 Ga0265314_10051912 Ga0265314_100519122 234
61 3300014968 Ga0157379_10029392 Ga0157379_100293922 235
62 3300026095 Ga0207676_10104808 Ga0207676_101048082 235
63 3300009177 Ga0105248_10261002 Ga0105248_102610022 236
64 3300014497 Ga0182008_10032276 Ga0182008_100322763 236
65 3300025931 Ga0207644_10072929 Ga0207644_100729293 236
66 3300028380 Ga0268265_10076826 Ga0268265_100768262 236
67 3300028381 Ga0268264_10396243 Ga0268264_103962432 236
68 3300049776 Ga0501280_000227 Ga0501280_000227_358_1194 236
69 3300050512 nmdc:mga0n895_209538_c1 nmdc:mga0n895_209538_c1_569_1411 236
70 3300035120 Ga0373957_0105424 Ga0373957_0105424_166_1020 237
71 3300006844 Ga0075428_100058671 Ga0075428_1000586713 238
72 3300039062 Ga0400483_229594 Ga0400483_229594_2523_3356 238
73 3300006051 Ga0075364_10008343 Ga0075364_100083436 239
74 3300044712 Ga0453684_0012407 Ga0453684_0012407_6624_7421 239
75 3300005437 Ga0070710_10129276 Ga0070710_101292761 240
76 3300027364 Ga0209967_1014090 Ga0209967_10140902 240
77 3300027543 Ga0209999_1035657 Ga0209999_10356571 240
78 3300027876 Ga0209974_10003496 Ga0209974_100034962 240
79 3300026118 Ga0207675_100635506 Ga0207675_1006355061 241
80 3300042876 Ga0451577_0159968 Ga0451577_0159968_172_993 241
81 iso_pu_bacteria 2547132512 2548846814 241
82 3300005331 Ga0070670_100160578 Ga0070670_1001605783 242
83 3300005334 Ga0068869_100348243 Ga0068869_1003482432 242
84 3300025925 Ga0207650_10043249 Ga0207650_100432493 242
85 3300036401 Ga0373937_0144248 Ga0373937_0144248_964_1791 242
86 3300005366 Ga0070659_100255384 Ga0070659_1002553842 243
87 3300005577 Ga0068857_100120815 Ga0068857_1001208152 243
88 3300005718 Ga0068866_10064800 Ga0068866_100648002 243
89 3300005844 Ga0068862_100225608 Ga0068862_1002256082 243
90 3300009174 Ga0105241_10147795 Ga0105241_101477952 243
91 3300009545 Ga0105237_10025618 Ga0105237_100256182 243
92 3300025912 Ga0207707_10024191 Ga0207707_100241912 243
93 3300025914 Ga0207671_10092169 Ga0207671_100921693 243
94 3300025932 Ga0207690_10295391 Ga0207690_102953912 243
95 3300025940 Ga0207691_10479076 Ga0207691_104790762 243
96 3300026116 Ga0207674_10048201 Ga0207674_100482012 243
97 3300035113 Ga0373936_0033891 Ga0373936_0033891_132_986 243
98 3300035692 Ga0373935_0275849 Ga0373935_0275849_259_1044 243
99 3300035695 Ga0373927_0193483 Ga0373927_0193483_99_884 243
100 3300037068 Ga0373925_0322078 Ga0373925_0322078_248_1033 243
101 3300046535 Ga0495586_0053751 Ga0495586_0053751_1050_1904 243
102 3300005338 Ga0068868_100124434 Ga0068868_1001244341 244
103 3300005564 Ga0070664_100557199 Ga0070664_1005571992 244
104 3300009098 Ga0105245_10241710 Ga0105245_102417102 244
105 3300013308 Ga0157375_10130851 Ga0157375_101308513 244
106 3300025942 Ga0207689_10186290 Ga0207689_101862902 244
107 3300025945 Ga0207679_10192797 Ga0207679_101927971 244
108 3300026023 Ga0207677_10100627 Ga0207677_101006272 244
109 3300042003 Ga0439443_000680 Ga0439443_000680_2135_2917 244
110 3300042436 Ga0439435_0000079 Ga0439435_0000079_3865_4647 244
111 3300042461 Ga0439460_0003488 Ga0439460_0003488_935_1717 244
112 3300048913 Ga0496110_0075266 Ga0496110_0075266_1456_2274 244
113 3300005328 Ga0070676_10108824 Ga0070676_101088241 245
114 3300005329 Ga0070683_100125684 Ga0070683_1001256843 245
115 3300005334 Ga0068869_100046517 Ga0068869_1000465172 245
116 3300005339 Ga0070660_100024064 Ga0070660_1000240642 245
117 3300005354 Ga0070675_100101557 Ga0070675_1001015571 245
118 3300005471 Ga0070698_100142986 Ga0070698_1001429863 245
119 3300005530 Ga0070679_100062011 Ga0070679_1000620112 245
120 3300005543 Ga0070672_100002371 Ga0070672_1000023715 245
121 3300005545 Ga0070695_100041257 Ga0070695_1000412573 245
122 3300005546 Ga0070696_100041408 Ga0070696_1000414084 245
123 3300005547 Ga0070693_100150313 Ga0070693_1001503132 245
124 3300005549 Ga0070704_100028458 Ga0070704_1000284584 245
125 3300005578 Ga0068854_100059262 Ga0068854_1000592623 245
126 3300009545 Ga0105237_10025234 Ga0105237_100252346 245
127 3300010375 Ga0105239_10083102 Ga0105239_100831023 245
128 3300017792 Ga0163161_10040855 Ga0163161_100408553 245
129 3300025918 Ga0207662_10135206 Ga0207662_101352062 245
130 3300025919 Ga0207657_10002586 Ga0207657_100025869 245
131 3300025942 Ga0207689_10030414 Ga0207689_100304146 245
132 3300026121 Ga0207683_10002399 Ga0207683_100023997 245
133 3300048905 Ga0496102_0101336 Ga0496102_0101336_761_1615 245
134 3300048909 Ga0496106_0131683 Ga0496106_0131683_431_1285 245
135 3300005834 Ga0068851_10008673 Ga0068851_100086732 246
136 3300025934 Ga0207686_10121309 Ga0207686_101213092 246
137 3300031995 Ga0307409_100389747 Ga0307409_1003897472 246
138 3300053121 Ga0500607_009339 Ga0500607_009339_2749_3537 246
139 3300053136 Ga0500559_0023713 Ga0500559_0023713_37_825 246
140 3300053177 Ga0500636_0000185 Ga0500636_0000185_3109_3897 246
141 3300053178 Ga0500637_0009159 Ga0500637_0009159_2818_3606 246
142 3300005467 Ga0070706_100078436 Ga0070706_1000784364 247
143 3300005467 Ga0070706_100487778 Ga0070706_1004877781 247
144 3300005468 Ga0070707_100066533 Ga0070707_1000665333 247
145 3300005468 Ga0070707_100073611 Ga0070707_1000736111 247
146 3300005471 Ga0070698_100076838 Ga0070698_1000768383 247
147 3300005530 Ga0070679_100168082 Ga0070679_1001680822 247
148 3300005536 Ga0070697_100301509 Ga0070697_1003015092 247
149 3300006852 Ga0075433_10456409 Ga0075433_104564092 247
150 3300006871 Ga0075434_100010815 Ga0075434_1000108158 247
151 3300009551 Ga0105238_10030190 Ga0105238_100301906 247
152 3300013307 Ga0157372_10158281 Ga0157372_101582812 247
153 3300025909 Ga0207705_10402309 Ga0207705_104023092 247
154 3300025910 Ga0207684_10014943 Ga0207684_100149434 247
155 3300025921 Ga0207652_10083225 Ga0207652_100832252 247
156 3300025922 Ga0207646_10005236 Ga0207646_100052366 247
157 3300025924 Ga0207694_10364279 Ga0207694_103642792 247
158 3300026023 Ga0207677_10144234 Ga0207677_101442342 247
159 3300026078 Ga0207702_10046785 Ga0207702_100467855 247
160 3300026116 Ga0207674_10003107 Ga0207674_1000310713 247
161 3300032002 Ga0307416_100282592 Ga0307416_1002825922 247
162 3300050513 nmdc:mga0rr50_116972_c1 nmdc:mga0rr50_116972_c1_232_1077 247
163 iso_pu_bacteria 2574179768 2574432047 247
164 3300005434 Ga0070709_10157780 Ga0070709_101577802 248
165 3300005445 Ga0070708_100028043 Ga0070708_1000280434 248
166 3300011119 Ga0105246_10084672 Ga0105246_100846722 248
167 3300025906 Ga0207699_10206703 Ga0207699_102067032 248
168 3300025915 Ga0207693_10020124 Ga0207693_100201246 248
169 3300005841 Ga0068863_100029725 Ga0068863_1000297256 249
170 3300005844 Ga0068862_100152444 Ga0068862_1001524443 249
171 3300031507 Ga0307509_10000815 Ga0307509_1000081522 249
172 3300035695 Ga0373927_0015224 Ga0373927_0015224_256_1101 249
173 3300046472 Ga0495580_0049671 Ga0495580_0049671_552_1397 249
174 3300049582 Ga0501048_0181744 Ga0501048_0181744_419_1246 249
175 3300005338 Ga0068868_100352947 Ga0068868_1003529472 250
176 3300005548 Ga0070665_100026083 Ga0070665_1000260833 250
177 3300025940 Ga0207691_10347223 Ga0207691_103472232 250
178 3300028379 Ga0268266_10211276 Ga0268266_102112762 250
179 3300036401 Ga0373937_0038232 Ga0373937_0038232_1323_2171 250
180 3300005445 Ga0070708_100000482 Ga0070708_10000048226 251
181 3300005327 Ga0070658_10201020 Ga0070658_102010202 253
182 3300005331 Ga0070670_100006956 Ga0070670_1000069562 253
183 3300005335 Ga0070666_10225744 Ga0070666_102257442 253
184 3300005344 Ga0070661_100239774 Ga0070661_1002397742 253
185 3300005353 Ga0070669_100299144 Ga0070669_1002991442 253
186 3300005354 Ga0070675_100177355 Ga0070675_1001773552 253
187 3300005355 Ga0070671_100027234 Ga0070671_1000272344 253
188 3300005356 Ga0070674_100174342 Ga0070674_1001743422 253
189 3300005364 Ga0070673_100463954 Ga0070673_1004639542 253
190 3300005457 Ga0070662_100384957 Ga0070662_1003849572 253
191 3300005459 Ga0068867_100195834 Ga0068867_1001958342 253
192 3300005543 Ga0070672_100169914 Ga0070672_1001699142 253
193 3300005545 Ga0070695_100110791 Ga0070695_1001107912 253
194 3300005564 Ga0070664_100015472 Ga0070664_1000154728 253
195 3300005616 Ga0068852_100095763 Ga0068852_1000957634 253
196 3300005618 Ga0068864_100288575 Ga0068864_1002885752 253
197 3300006237 Ga0097621_100003683 Ga0097621_10000368310 253
198 3300006358 Ga0068871_100140351 Ga0068871_1001403512 253
199 3300009174 Ga0105241_10127366 Ga0105241_101273663 253
200 3300013104 Ga0157370_10479005 Ga0157370_104790052 253
201 3300013296 Ga0157374_10122766 Ga0157374_101227662 253
202 3300013297 Ga0157378_10398153 Ga0157378_103981532 253
203 3300013306 Ga0163162_10723278 Ga0163162_107232781 253
204 3300013308 Ga0157375_10081010 Ga0157375_100810102 253
205 3300014969 Ga0157376_10142848 Ga0157376_101428482 253
206 3300021361 Ga0213872_10035600 Ga0213872_100356002 253
207 3300025321 Ga0207656_10192072 Ga0207656_101920722 253
208 3300025903 Ga0207680_10072519 Ga0207680_100725192 253
209 3300025925 Ga0207650_10141427 Ga0207650_101414272 253
210 3300025931 Ga0207644_10017931 Ga0207644_100179312 253
211 3300025940 Ga0207691_10007106 Ga0207691_1000710610 253
212 3300026089 Ga0207648_10090062 Ga0207648_100900623 253
213 3300026095 Ga0207676_10029810 Ga0207676_100298105 253
214 3300026121 Ga0207683_10003576 Ga0207683_100035767 253
215 3300026142 Ga0207698_10267116 Ga0207698_102671162 253
216 3300039447 Ga0436361_0941704 Ga0436361_0941704_4566_5405 253
217 3300005331 Ga0070670_100011317 Ga0070670_1000113176 254
218 3300005347 Ga0070668_100013830 Ga0070668_1000138304 254
219 3300025925 Ga0207650_10022846 Ga0207650_100228463 254
220 3300025972 Ga0207668_10024000 Ga0207668_100240004 254
221 3300028380 Ga0268265_10093159 Ga0268265_100931593 254
222 3300049571 Ga0501034_0008170 Ga0501034_0008170_6508_7356 254
223 3300049571 Ga0501034_0038528 Ga0501034_0038528_1544_2392 254
224 3300049588 Ga0501072_0000580 Ga0501072_0000580_14587_15435 254
225 3300005366 Ga0070659_100074168 Ga0070659_1000741683 255
226 3300005441 Ga0070700_100216255 Ga0070700_1002162552 255
227 3300005456 Ga0070678_100229786 Ga0070678_1002297862 255
228 3300005458 Ga0070681_10021800 Ga0070681_100218001 255
229 3300005467 Ga0070706_100079227 Ga0070706_1000792273 255
230 3300005468 Ga0070707_100027448 Ga0070707_1000274484 255
231 3300005549 Ga0070704_100403817 Ga0070704_1004038171 255
232 3300005718 Ga0068866_10104201 Ga0068866_101042011 255
233 3300006871 Ga0075434_100667644 Ga0075434_1006676441 255
234 3300009098 Ga0105245_10161080 Ga0105245_101610802 255
235 3300010375 Ga0105239_10803366 Ga0105239_108033661 255
236 3300013104 Ga0157370_10032248 Ga0157370_100322484 255
237 3300013296 Ga0157374_10177264 Ga0157374_101772642 255
238 3300025901 Ga0207688_10114802 Ga0207688_101148021 255
239 3300025922 Ga0207646_10028303 Ga0207646_100283031 255
240 3300025923 Ga0207681_10170819 Ga0207681_101708192 255
241 3300025972 Ga0207668_10181996 Ga0207668_101819961 255
242 3300026121 Ga0207683_10182550 Ga0207683_101825502 255
243 3300048911 Ga0496108_0046399 Ga0496108_0046399_2586_3425 255
244 3300048912 Ga0496109_0171316 Ga0496109_0171316_312_1151 255
245 3300048913 Ga0496110_0132225 Ga0496110_0132225_550_1389 255
246 3300048915 Ga0496112_0009610 Ga0496112_0009610_3149_3988 255
247 3300048916 Ga0496113_0050405 Ga0496113_0050405_1922_2761 255
248 3300005330 Ga0070690_100002011 Ga0070690_1000020116 256
249 3300005331 Ga0070670_100012383 Ga0070670_1000123839 256
250 3300005334 Ga0068869_100070193 Ga0068869_1000701933 256
251 3300005335 Ga0070666_10003998 Ga0070666_100039986 256
252 3300005335 Ga0070666_10018960 Ga0070666_100189602 256
253 3300005338 Ga0068868_100004147 Ga0068868_1000041476 256
254 3300005338 Ga0068868_100301845 Ga0068868_1003018452 256
255 3300005340 Ga0070689_100002136 Ga0070689_1000021368 256
256 3300005343 Ga0070687_100042509 Ga0070687_1000425092 256
257 3300005355 Ga0070671_100014809 Ga0070671_1000148095 256
258 3300005364 Ga0070673_100000088 Ga0070673_10000008820 256
259 3300005364 Ga0070673_100044091 Ga0070673_1000440913 256
260 3300005365 Ga0070688_100008679 Ga0070688_1000086792 256
261 3300005367 Ga0070667_100012878 Ga0070667_1000128786 256
262 3300005434 Ga0070709_10038399 Ga0070709_100383993 256
263 3300005435 Ga0070714_100002535 Ga0070714_1000025353 256
264 3300005435 Ga0070714_100584717 Ga0070714_1005847172 256
265 3300005436 Ga0070713_100000376 Ga0070713_10000037622 256
266 3300005436 Ga0070713_100093871 Ga0070713_1000938712 256
267 3300005437 Ga0070710_10006476 Ga0070710_100064764 256
268 3300005439 Ga0070711_100016030 Ga0070711_1000160302 256
269 3300005445 Ga0070708_100555152 Ga0070708_1005551521 256
270 3300005456 Ga0070678_100000393 Ga0070678_1000003933 256
271 3300005456 Ga0070678_100001701 Ga0070678_1000017019 256
272 3300005457 Ga0070662_100031472 Ga0070662_1000314723 256
273 3300005459 Ga0068867_100061854 Ga0068867_1000618542 256
274 3300005459 Ga0068867_100109870 Ga0068867_1001098702 256
275 3300005471 Ga0070698_100085695 Ga0070698_1000856953 256
276 3300005543 Ga0070672_100057271 Ga0070672_1000572713 256
277 3300005547 Ga0070693_100007503 Ga0070693_1000075036 256
278 3300005548 Ga0070665_100005083 Ga0070665_1000050835 256
279 3300005548 Ga0070665_100020278 Ga0070665_1000202784 256
280 3300005578 Ga0068854_100044733 Ga0068854_1000447334 256
281 3300005614 Ga0068856_100078837 Ga0068856_1000788373 256
282 3300005615 Ga0070702_100055257 Ga0070702_1000552573 256
283 3300005615 Ga0070702_100157490 Ga0070702_1001574902 256
284 3300005617 Ga0068859_100018817 Ga0068859_1000188176 256
285 3300005618 Ga0068864_100001261 Ga0068864_10000126111 256
286 3300005618 Ga0068864_100052916 Ga0068864_1000529162 256
287 3300005718 Ga0068866_10041312 Ga0068866_100413123 256
288 3300005834 Ga0068851_10052843 Ga0068851_100528433 256
289 3300005840 Ga0068870_10121228 Ga0068870_101212282 256
290 3300005841 Ga0068863_100001485 Ga0068863_10000148512 256
291 3300005841 Ga0068863_100125686 Ga0068863_1001256862 256
292 3300005842 Ga0068858_100001037 Ga0068858_10000103711 256
293 3300005842 Ga0068858_100270922 Ga0068858_1002709222 256
294 3300005843 Ga0068860_100028998 Ga0068860_1000289986 256
295 3300006173 Ga0070716_100005445 Ga0070716_1000054453 256
296 3300006175 Ga0070712_100001436 Ga0070712_10000143611 256
297 3300006237 Ga0097621_100016961 Ga0097621_1000169616 256
298 3300006237 Ga0097621_100018429 Ga0097621_1000184295 256
299 3300006358 Ga0068871_100042920 Ga0068871_1000429204 256
300 3300006871 Ga0075434_100089061 Ga0075434_1000890613 256
301 3300006871 Ga0075434_100141176 Ga0075434_1001411762 256
302 3300006881 Ga0068865_100061082 Ga0068865_1000610822 256
303 3300006881 Ga0068865_100174195 Ga0068865_1001741952 256
304 3300006931 Ga0097620_100018817 Ga0097620_1000188173 256
305 3300009094 Ga0111539_10676894 Ga0111539_106768942 256
306 3300009098 Ga0105245_10013253 Ga0105245_100132533 256
307 3300009098 Ga0105245_10017158 Ga0105245_100171583 256
308 3300009148 Ga0105243_10272546 Ga0105243_102725462 256
309 3300009174 Ga0105241_10169466 Ga0105241_101694662 256
310 3300009176 Ga0105242_10003409 Ga0105242_100034093 256
311 3300009176 Ga0105242_10022416 Ga0105242_100224166 256
312 3300009177 Ga0105248_10008226 Ga0105248_1000822613 256
313 3300009177 Ga0105248_10627069 Ga0105248_106270691 256
314 3300013296 Ga0157374_10000383 Ga0157374_1000038313 256
315 3300013297 Ga0157378_10019454 Ga0157378_100194545 256
316 3300013297 Ga0157378_10025316 Ga0157378_100253163 256
317 3300013297 Ga0157378_10235424 Ga0157378_102354242 256
318 3300013306 Ga0163162_10021592 Ga0163162_100215923 256
319 3300013306 Ga0163162_10049848 Ga0163162_100498482 256
320 3300013306 Ga0163162_10147274 Ga0163162_101472742 256
321 3300013308 Ga0157375_10013470 Ga0157375_100134703 256
322 3300013308 Ga0157375_10035561 Ga0157375_100355614 256
323 3300014325 Ga0163163_10000750 Ga0163163_1000075019 256
324 3300014325 Ga0163163_10063665 Ga0163163_100636653 256
325 3300014326 Ga0157380_10128540 Ga0157380_101285402 256
326 3300014968 Ga0157379_10002213 Ga0157379_1000221317 256
327 3300014968 Ga0157379_10549489 Ga0157379_105494892 256
328 3300014969 Ga0157376_10014083 Ga0157376_100140836 256
329 3300014969 Ga0157376_10018290 Ga0157376_100182903 256
330 3300025898 Ga0207692_10007849 Ga0207692_100078495 256
331 3300025899 Ga0207642_10009344 Ga0207642_100093442 256
332 3300025903 Ga0207680_10001440 Ga0207680_100014405 256
333 3300025903 Ga0207680_10016754 Ga0207680_100167544 256
334 3300025906 Ga0207699_10030506 Ga0207699_100305062 256
335 3300025915 Ga0207693_10000254 Ga0207693_100002546 256
336 3300025916 Ga0207663_10004204 Ga0207663_100042043 256
337 3300025923 Ga0207681_10014245 Ga0207681_100142454 256
338 3300025927 Ga0207687_10006284 Ga0207687_100062847 256
339 3300025927 Ga0207687_10011076 Ga0207687_100110766 256
340 3300025928 Ga0207700_10000049 Ga0207700_1000004984 256
341 3300025929 Ga0207664_10525431 Ga0207664_105254312 256
342 3300025931 Ga0207644_10002924 Ga0207644_100029246 256
343 3300025933 Ga0207706_10023675 Ga0207706_100236753 256
344 3300025934 Ga0207686_10000302 Ga0207686_1000030219 256
345 3300025936 Ga0207670_10006135 Ga0207670_100061355 256
346 3300025937 Ga0207669_10076552 Ga0207669_100765522 256
347 3300025938 Ga0207704_10154064 Ga0207704_101540642 256
348 3300025938 Ga0207704_10275309 Ga0207704_102753092 256
349 3300025939 Ga0207665_10010629 Ga0207665_100106296 256
350 3300025940 Ga0207691_10004126 Ga0207691_1000412612 256
351 3300025940 Ga0207691_10073310 Ga0207691_100733103 256
352 3300025941 Ga0207711_10006666 Ga0207711_100066663 256
353 3300025941 Ga0207711_10359711 Ga0207711_103597112 256
354 3300025942 Ga0207689_10004808 Ga0207689_1000480810 256
355 3300025942 Ga0207689_10073469 Ga0207689_100734693 256
356 3300025960 Ga0207651_10007164 Ga0207651_100071647 256
357 3300025972 Ga0207668_10055507 Ga0207668_100555073 256
358 3300025986 Ga0207658_10005387 Ga0207658_100053876 256
359 3300025986 Ga0207658_10033765 Ga0207658_100337652 256
360 3300026023 Ga0207677_10000739 Ga0207677_1000073911 256
361 3300026035 Ga0207703_10002596 Ga0207703_100025966 256
362 3300026035 Ga0207703_10544498 Ga0207703_105444981 256
363 3300026078 Ga0207702_10015788 Ga0207702_100157884 256
364 3300026088 Ga0207641_10319869 Ga0207641_103198692 256
365 3300026089 Ga0207648_10077720 Ga0207648_100777204 256
366 3300026095 Ga0207676_10000470 Ga0207676_1000047028 256
367 3300026095 Ga0207676_10238032 Ga0207676_102380322 256
368 3300026121 Ga0207683_10000227 Ga0207683_1000022734 256
369 3300026121 Ga0207683_10001514 Ga0207683_1000151415 256
370 3300028379 Ga0268266_10005484 Ga0268266_100054846 256
371 3300028379 Ga0268266_10010114 Ga0268266_100101147 256
372 3300028381 Ga0268264_10006554 Ga0268264_100065546 256
373 3300028381 Ga0268264_10078151 Ga0268264_100781513 256
374 3300035086 Ga0373934_0005807 Ga0373934_0005807_2465_3319 256
375 3300035113 Ga0373936_0032369 Ga0373936_0032369_682_1536 256
376 3300035116 Ga0373945_0006038 Ga0373945_0006038_1126_1980 256
377 3300035116 Ga0373945_0082763 Ga0373945_0082763_144_998 256
378 3300035117 Ga0373953_0000549 Ga0373953_0000549_3415_4269 256
379 3300035118 Ga0373954_0001605 Ga0373954_0001605_5697_6551 256
380 3300035118 Ga0373954_0135619 Ga0373954_0135619_296_1150 256
381 3300035120 Ga0373957_0112621 Ga0373957_0112621_24_863 256
382 3300035170 Ga0373943_0029419 Ga0373943_0029419_675_1529 256
383 3300035172 Ga0373955_0014310 Ga0373955_0014310_228_1082 256
384 3300035410 Ga0373924_0024079 Ga0373924_0024079_1309_2163 256
385 3300035692 Ga0373935_0010365 Ga0373935_0010365_3475_4320 256
386 3300035692 Ga0373935_0041372 Ga0373935_0041372_613_1467 256
387 3300035695 Ga0373927_0009637 Ga0373927_0009637_3655_4509 256
388 3300035695 Ga0373927_0028599 Ga0373927_0028599_2761_3615 256
389 3300035695 Ga0373927_0039810 Ga0373927_0039810_424_1269 256
390 3300035725 Ga0373947_0010860 Ga0373947_0010860_3674_4519 256
391 3300035725 Ga0373947_0031390 Ga0373947_0031390_1425_2279 256
392 3300035725 Ga0373947_0095402 Ga0373947_0095402_511_1365 256
393 3300036401 Ga0373937_0019525 Ga0373937_0019525_3724_4578 256
394 3300036401 Ga0373937_0030445 Ga0373937_0030445_2765_3619 256
395 3300036401 Ga0373937_0288277 Ga0373937_0288277_230_1075 256
396 3300037068 Ga0373925_0048763 Ga0373925_0048763_1377_2231 256
397 3300037068 Ga0373925_0305978 Ga0373925_0305978_379_1224 256
398 3300045051 Ga0451576_0635245 Ga0451576_0635245_146_991 256
399 3300046459 Ga0495629_0018980 Ga0495629_0018980_366_1220 256
400 3300046462 Ga0495651_0067842 Ga0495651_0067842_799_1653 256
401 3300046463 Ga0495653_0053033 Ga0495653_0053033_659_1513 256
402 3300046472 Ga0495580_0011057 Ga0495580_0011057_2099_2953 256
403 3300046472 Ga0495580_0100998 Ga0495580_0100998_194_1048 256
404 3300046473 Ga0495582_0027788 Ga0495582_0027788_138_992 256
405 3300046517 Ga0495630_0268024 Ga0495630_0268024_357_1211 256
406 3300046531 Ga0495665_0025696 Ga0495665_0025696_1593_2447 256
407 3300046539 Ga0495621_0005344 Ga0495621_0005344_1161_2015 256
408 3300046543 Ga0495645_0214945 Ga0495645_0214945_131_985 256
409 3300046559 Ga0495667_0109209 Ga0495667_0109209_734_1588 256
410 3300046642 Ga0495634_0057629 Ga0495634_0057629_882_1736 256
411 3300046663 Ga0495635_0006317 Ga0495635_0006317_3698_4552 256
412 3300046674 Ga0495588_0234180 Ga0495588_0234180_39_893 256
413 3300046679 Ga0495623_0025646 Ga0495623_0025646_2125_2979 256
414 3300046683 Ga0495658_0064077 Ga0495658_0064077_944_1798 256
415 3300046689 Ga0495613_0049498 Ga0495613_0049498_981_1835 256
416 3300046690 Ga0495624_0189480 Ga0495624_0189480_292_1146 256
417 3300047315 Ga0495581_0030885 Ga0495581_0030885_1491_2345 256
418 3300047322 Ga0495680_0027008 Ga0495680_0027008_1370_2224 256
419 3300047471 Ga0495684_0028776 Ga0495684_0028776_278_1132 256
420 3300048088 Ga0495602_0195212 Ga0495602_0195212_536_1390 256
421 3300048903 Ga0496100_0041720 Ga0496100_0041720_307_1161 256
422 3300048907 Ga0496104_0003970 Ga0496104_0003970_10559_11413 256
423 3300048908 Ga0496105_0004163 Ga0496105_0004163_9935_10789 256
424 3300048912 Ga0496109_0149391 Ga0496109_0149391_349_1203 256
425 3300048915 Ga0496112_0000755 Ga0496112_0000755_3132_3986 256
426 3300048918 Ga0496115_0011797 Ga0496115_0011797_3121_3975 256
427 3300050512 nmdc:mga0n895_100249_c1 nmdc:mga0n895_100249_c1_1806_2651 256
428 3300050513 nmdc:mga0rr50_54962_c1 nmdc:mga0rr50_54962_c1_960_1805 256
429 3300053077 Ga0495601_0186000 Ga0495601_0186000_416_1261 256
430 3300053077 Ga0495601_0256938 Ga0495601_0256938_252_1106 256
431 3300053078 Ga0495612_0039588 Ga0495612_0039588_961_1815 256
432 3300053085 Ga0495619_0010303 Ga0495619_0010303_2740_3594 256
433 3300060353 Ga0501082_0425751 Ga0501082_0425751_241_1101 256
434 3300005330 Ga0070690_100109143 Ga0070690_1001091432 257
435 3300005343 Ga0070687_100210445 Ga0070687_1002104452 257
436 3300005347 Ga0070668_100007765 Ga0070668_1000077656 257
437 3300005356 Ga0070674_100117189 Ga0070674_1001171892 257
438 3300005367 Ga0070667_100003652 Ga0070667_1000036526 257
439 3300005367 Ga0070667_100436132 Ga0070667_1004361322 257
440 3300005440 Ga0070705_100109337 Ga0070705_1001093372 257
441 3300005459 Ga0068867_100000771 Ga0068867_10000077118 257
442 3300005545 Ga0070695_100018224 Ga0070695_1000182242 257
443 3300005577 Ga0068857_100002661 Ga0068857_10000266116 257
444 3300005617 Ga0068859_100001228 Ga0068859_1000012286 257
445 3300005618 Ga0068864_100000494 Ga0068864_10000049429 257
446 3300005719 Ga0068861_100003374 Ga0068861_1000033749 257
447 3300005841 Ga0068863_100031264 Ga0068863_1000312643 257
448 3300005842 Ga0068858_100000936 Ga0068858_10000093618 257
449 3300005843 Ga0068860_100012199 Ga0068860_10001219911 257
450 3300005844 Ga0068862_100020430 Ga0068862_1000204302 257
451 3300006931 Ga0097620_100001228 Ga0097620_1000012286 257
452 3300009101 Ga0105247_10343411 Ga0105247_103434111 257
453 3300009545 Ga0105237_10493479 Ga0105237_104934792 257
454 3300013308 Ga0157375_10046915 Ga0157375_100469152 257
455 3300014325 Ga0163163_10015389 Ga0163163_100153895 257
456 3300014968 Ga0157379_10000112 Ga0157379_1000011238 257
457 3300025918 Ga0207662_10227014 Ga0207662_102270142 257
458 3300025925 Ga0207650_10003372 Ga0207650_100033723 257
459 3300025926 Ga0207659_10028025 Ga0207659_100280252 257
460 3300025940 Ga0207691_10005913 Ga0207691_1000591315 257
461 3300025972 Ga0207668_10007805 Ga0207668_100078054 257
462 3300025972 Ga0207668_10022684 Ga0207668_100226842 257
463 3300025986 Ga0207658_10053479 Ga0207658_100534792 257
464 3300026067 Ga0207678_10123751 Ga0207678_101237512 257
465 3300026088 Ga0207641_10023067 Ga0207641_100230673 257
466 3300026088 Ga0207641_10264203 Ga0207641_102642032 257
467 3300026089 Ga0207648_10007249 Ga0207648_100072497 257
468 3300026116 Ga0207674_10003808 Ga0207674_1000380819 257
469 3300026118 Ga0207675_100002525 Ga0207675_1000025257 257
470 3300028380 Ga0268265_10009063 Ga0268265_100090636 257
471 3300028381 Ga0268264_10000702 Ga0268264_1000070217 257
472 3300031824 Ga0307413_10034109 Ga0307413_100341092 257
473 3300031852 Ga0307410_10091601 Ga0307410_100916012 257
474 3300031901 Ga0307406_10021900 Ga0307406_100219004 257
475 3300032002 Ga0307416_100017853 Ga0307416_1000178534 257
476 3300048905 Ga0496102_0004079 Ga0496102_0004079_2862_3710 257
477 3300048906 Ga0496103_0069431 Ga0496103_0069431_918_1766 257
478 3300048911 Ga0496108_0062332 Ga0496108_0062332_1758_2606 257
479 3300048912 Ga0496109_0025150 Ga0496109_0025150_2917_3765 257
480 3300005327 Ga0070658_10002393 Ga0070658_1000239314 270
481 3300025909 Ga0207705_10010151 Ga0207705_100101513 270

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01148

CTP_transf_1

Cytidylyltransferase family

27

293

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.653 29 266
4q2g-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) 0.648 29 266
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.5936 29 266
4q2g-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) 0.591 29 266
8evu-assembly1.cif.gz_E cryo em structure of vibrio cholerae nqr 0.3869 88 269
ID Description Score Start End Superfamily
af_Q6P742_19_131_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4256 30 123 1.20.140.150
4u9nB00 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.4231 47 269 1.10.357.20
af_A0A0R4INZ3_302_489_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.4171 81 270 1.10.357.20
4u9nB00 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.4142 47 269 1.10.357.20
af_A0A0R4INZ3_302_489_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.3928 81 270 1.10.357.20
ID Description Score Start End GO Terms
AF-A0A3D1WB84-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.9263 1 270 GO:0004605
GO:0005886
GO:0016024
AF-A0A3D1WB84-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.9231 1 270 GO:0004605
GO:0005886
GO:0016024
AF-A0A3N5N7U7-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.9096 2 268 GO:0004605
GO:0005886
GO:0016024
AF-A0A3B8R9X2-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.904 1 269 GO:0004605
GO:0005886
GO:0016024
AF-A0A7V9IP37-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.9036 146 266 GO:0004605
GO:0005886
GO:0016024

Feature Viewer

pLDDT pTM Quality
83.72 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map