F452364

General Info

Members Datasets Scaffolds Average Seq Length
481 273 462 320

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100009513|Ga0070659_1000095139
Length 388
Sequence MHTVVVHIDKNVIVSCDLVFRIGTRFQTSARYFSRDTARSVGQYSLTTNQPQLEVNGDMRQVSNLWTKRSFAGLSTCCLVVAALALVAVLAAPAQAQDNKMTPIATPAQPNAIEIGTGPLPDAKNPESWHSQYGSKFARNVTVATLTPFLPDPTKASGAAVVVAPGGGFRTLSMENEGWNVARALAEKGVAAFVLKYRLNQTPADMPGFEQSMREMFSGTARPPRPDPEKAMAGLAPQIADARAAFALIRKRAAEWHVDPNRIGMVGFSAGAMLTMATTLAGEDAKPAFIGNIYGPLAPLTVPADAPPLFIALAADDPFFANGGYGLIDSWKAAKHPVEFHLYEQGGHGFGMYPKETTSTGWFEAFVRWIGMHGMLKPPASGSGGAAN

Samples

Sample ID Description Type Environment
1 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
2 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
3 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
4 2643221642 Caulobacter sp. Root343 Isolate Unclassified
5 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
6 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
7 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
8 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
9 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
10 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
11 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
12 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
13 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
14 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
15 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
16 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
17 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
22 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
23 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
26 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
27 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
28 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
29 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
30 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
35 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
46 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
122 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
123 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
125 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
194 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
211 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
212 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
225 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
230 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
231 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
232 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
233 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
234 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
235 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
241 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
260 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
265 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
266 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
267 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
268 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
272 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
273 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.84
Metatranscriptomes 0
Isolates 4.16

Biome Distribution

Category Percentage (%)
Aerial Root 0.83
Bulb 0
Endosphere 8.73
Nodule 0
Rhizoplane 3.74
Rhizosphere 82.54
Stem 0
Stem Tuber 0
Unclassified 4.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10008882 3300001990 Bacteria 3354
2 JGI24735J21928_10017258 3300002067 Bacteria 2233
3 JGI25406J46586_10004109 3300003203 Bacteria 6801
4 JGI25165J46597_1000120 3300003214 Bacteria 136275
5 JGI25153J46596_10001019 3300003215 Bacteria 17024
6 rootH2_10056391 3300003320 Bacteria 11934
7 rootH1_10007730 3300003316 Bacteria 2158
8 rootH1_10007730 3300003323 Bacteria 11381
9 Ga0055542_1008800 3300003762 Bacteria 1949
10 Ga0055529_1000068 3300003763 Bacteria 163911
11 Ga0055537_1000488 3300003773 Bacteria 24384
12 Ga0055524_1000095 3300003775 Bacteria 109223
13 Ga0055536_1000379 3300003781 Bacteria 32677
14 Ga0055528_1002530 3300003790 Bacteria 9735
15 Ga0055530_10009361 3300003791 Bacteria 3774
16 Ga0055530_10011078 3300003791 Bacteria 3270
17 Ga0055531_10000560 3300003794 Bacteria 32677
18 Ga0055531_10007451 3300003794 Bacteria 5971
19 Ga0065165_1000840 3300005262 Bacteria 40310
20 Ga0065165_1002885 3300005262 Bacteria 13219
21 Ga0065165_1005700 3300005262 Bacteria 6854
22 Ga0065712_10072716 3300005290 Bacteria 4641
23 Ga0065715_10111295 3300005293 Bacteria 2580
24 Ga0070658_10000013 3300005327 Bacteria 267776
25 Ga0070658_10000734 3300005327 Bacteria 28171
26 Ga0070658_10165864 3300005327 Bacteria 1854
27 Ga0070676_10011018 3300005328 Bacteria 4913
28 Ga0070676_10153346 3300005328 Bacteria 1477
29 Ga0070690_100001641 3300005330 Bacteria 11763
30 Ga0070690_100011164 3300005330 Bacteria 5248
31 Ga0070670_100001022 3300005331 Bacteria 22109
32 Ga0070670_100291914 3300005331 Bacteria 1425
33 Ga0068869_100000655 3300005334 Bacteria 19610
34 Ga0070666_10023221 3300005335 Bacteria 4036
35 Ga0070666_10085003 3300005335 Bacteria 2166
36 Ga0070666_10099997 3300005335 Bacteria 1997
37 Ga0070680_100040989 3300005336 Bacteria 3753
38 Ga0068868_100000025 3300005338 Bacteria 82086
39 Ga0068868_100044910 3300005338 Bacteria 3456
40 Ga0068868_100045315 3300005338 Bacteria 3440
41 Ga0068868_100318508 3300005338 Bacteria 1324
42 Ga0070660_100000888 3300005339 Bacteria 19990
43 Ga0070660_100004197 3300005339 Bacteria 9950
44 Ga0070660_100043986 3300005339 Bacteria 3413
45 Ga0070689_100155280 3300005340 Bacteria 1847
46 Ga0070687_100076446 3300005343 Bacteria 1813
47 Ga0070687_100078462 3300005343 Bacteria 1795
48 Ga0070661_100013638 3300005344 Bacteria 5707
49 Ga0070661_100094129 3300005344 Bacteria 2220
50 Ga0070661_100202611 3300005344 Bacteria 1517
51 Ga0070669_100017299 3300005353 Bacteria 5143
52 Ga0070669_100025370 3300005353 Bacteria 4257
53 Ga0070669_100084425 3300005353 Bacteria 2369
54 Ga0070675_100000925 3300005354 Bacteria 20897
55 Ga0070675_100165130 3300005354 Bacteria 1907
56 Ga0070671_100001039 3300005355 Bacteria 20441
57 Ga0070671_100318883 3300005355 Bacteria 1324
58 Ga0070674_100032237 3300005356 Bacteria 3478
59 Ga0070673_100000016 3300005364 Bacteria 114927
60 Ga0070673_100001707 3300005364 Bacteria 13050
61 Ga0070673_100034457 3300005364 Bacteria 3832
62 Ga0070688_100135175 3300005365 Bacteria 1668
63 Ga0070659_100009513 3300005366 Bacteria 7140
64 Ga0070659_100011148 3300005366 Bacteria 6640
65 Ga0070659_100028786 3300005366 Bacteria 4292
66 Ga0070659_100184379 3300005366 Bacteria 1713
67 Ga0070667_100061776 3300005367 Bacteria 3172
68 Ga0070714_100019094 3300005435 Bacteria 5579
69 Ga0070714_100277689 3300005435 Bacteria 1555
70 Ga0070701_10028617 3300005438 Bacteria 2740
71 Ga0070711_100097786 3300005439 Bacteria 2129
72 Ga0070694_100001287 3300005444 Bacteria 14572
73 Ga0070663_100000572 3300005455 Bacteria 19682
74 Ga0070663_100030580 3300005455 Bacteria 3692
75 Ga0070678_100002092 3300005456 Bacteria 10822
76 Ga0070678_100070387 3300005456 Bacteria 2615
77 Ga0070662_100035107 3300005457 Bacteria 3539
78 Ga0070662_100036785 3300005457 Bacteria 3466
79 Ga0070662_100111639 3300005457 Bacteria 2083
80 Ga0070681_10008869 3300005458 Bacteria 9881
81 Ga0068867_100000299 3300005459 Bacteria 32625
82 Ga0068867_100018326 3300005459 Bacteria 4976
83 Ga0070679_100157760 3300005530 Bacteria 2244
84 Ga0068853_100022796 3300005539 Bacteria 5233
85 Ga0068853_100087520 3300005539 Bacteria 2734
86 Ga0068853_100135534 3300005539 Bacteria 2207
87 Ga0070672_100000571 3300005543 Bacteria 21614
88 Ga0070672_100045039 3300005543 Bacteria 3410
89 Ga0070672_100124758 3300005543 Bacteria 2111
90 Ga0070695_100302992 3300005545 Unclassified 1182
91 Ga0070665_100054088 3300005548 Bacteria 4026
92 Ga0068855_100001290 3300005563 Bacteria 31069
93 Ga0068855_100009554 3300005563 Bacteria 11712
94 Ga0070664_100025677 3300005564 Bacteria 4885
95 Ga0070664_100035410 3300005564 Bacteria 4191
96 Ga0070664_100222953 3300005564 Bacteria 1687
97 Ga0070664_100280478 3300005564 Bacteria 1502
98 Ga0068857_100005243 3300005577 Bacteria 11035
99 Ga0068857_100046973 3300005577 Bacteria 3832
100 Ga0068854_100026880 3300005578 Bacteria 3959
101 Ga0068854_100057892 3300005578 Bacteria 2796
102 Ga0068854_100102813 3300005578 Bacteria 2144
103 Ga0068854_100412887 3300005578 Bacteria 1119
104 Ga0068856_100002933 3300005614 Bacteria 17472
105 Ga0068856_100026258 3300005614 Bacteria 5679
106 Ga0068856_100091891 3300005614 Bacteria 3019
107 Ga0068852_100056659 3300005616 Bacteria 3388
108 Ga0068852_100133802 3300005616 Unclassified 2286
109 Ga0068852_100306172 3300005616 Bacteria 1539
110 Ga0068859_100009808 3300005617 Bacteria 9671
111 Ga0068859_100035981 3300005617 Bacteria 4968
112 Ga0068859_100050186 3300005617 Bacteria 4191
113 Ga0068864_100030745 3300005618 Bacteria 4553
114 Ga0068864_100090763 3300005618 Bacteria 2694
115 Ga0068864_100138745 3300005618 Bacteria 2191
116 Ga0068866_10003217 3300005718 Bacteria 6736
117 Ga0068866_10040172 3300005718 Bacteria 2314
118 Ga0068861_100093255 3300005719 Bacteria 2380
119 Ga0068861_100393129 3300005719 Bacteria 1228
120 Ga0068851_10000356 3300005834 Bacteria 20687
121 Ga0068851_10043143 3300005834 Bacteria 2272
122 Ga0068863_100048009 3300005841 Bacteria 4048
123 Ga0068863_100386428 3300005841 Bacteria 1367
124 Ga0068858_100040666 3300005842 Bacteria 4312
125 Ga0068858_100042945 3300005842 Bacteria 4192
126 Ga0068858_100255061 3300005842 Bacteria 1666
127 Ga0068860_100046349 3300005843 Bacteria 4145
128 Ga0068860_100079374 3300005843 Bacteria 3120
129 Ga0068862_100049996 3300005844 Bacteria 3572
130 Ga0068862_100052122 3300005844 Bacteria 3500
131 Ga0081539_10003170 3300005985 Bacteria 20838
132 Ga0081539_10027851 3300005985 Bacteria 3569
133 Ga0081539_10039290 3300005985 Bacteria 2795
134 Ga0070716_100063790 3300006173 Unclassified 2140
135 Ga0070712_100450048 3300006175 Bacteria 1072
136 Ga0097621_100000367 3300006237 Bacteria 31296
137 Ga0097621_100006959 3300006237 Bacteria 8053
138 Ga0097621_100046372 3300006237 Bacteria 3516
139 Ga0097621_100259326 3300006237 Bacteria 1524
140 Ga0068871_100000479 3300006358 Bacteria 27366
141 Ga0068871_100002343 3300006358 Bacteria 12903
142 Ga0068871_100351726 3300006358 Bacteria 1303
143 Ga0075433_10221019 3300006852 Bacteria 1682
144 Ga0075429_100040112 3300006880 Bacteria 4075
145 Ga0068865_100000026 3300006881 Bacteria 93349
146 Ga0068865_100004123 3300006881 Bacteria 8738
147 Ga0097620_100009808 3300006931 Bacteria 9671
148 Ga0097620_100035978 3300006931 Bacteria 4968
149 Ga0097620_100050187 3300006931 Bacteria 4191
150 Ga0105244_10132662 3300009036 Bacteria 1202
151 Ga0105240_10028301 3300009093 Bacteria 7321
152 Ga0105240_10031815 3300009093 Bacteria 6836
153 Ga0105240_10043192 3300009093 Bacteria 5738
154 Ga0111539_10322898 3300009094 Bacteria 1796
155 Ga0111539_10546648 3300009094 Bacteria 1349
156 Ga0105245_10000078 3300009098 Bacteria 100583
157 Ga0105245_10088225 3300009098 Bacteria 2848
158 Ga0105245_10114809 3300009098 Bacteria 2508
159 Ga0105245_10280750 3300009098 Bacteria 1627
160 Ga0105243_10001224 3300009148 Bacteria 23118
161 Ga0105243_10016028 3300009148 Bacteria 5670
162 Ga0105241_10013272 3300009174 Bacteria 6038
163 Ga0105241_10087190 3300009174 Bacteria 2456
164 Ga0105241_10165217 3300009174 Bacteria 1823
165 Ga0105242_10006070 3300009176 Bacteria 9314
166 Ga0105242_10019056 3300009176 Bacteria 5375
167 Ga0105237_10029531 3300009545 Bacteria 5572
168 Ga0105238_10007923 3300009551 Bacteria 10631
169 Ga0105249_10011695 3300009553 Bacteria 7719
170 Ga0105249_10011803 3300009553 Bacteria 7681
171 Ga0105239_10015928 3300010375 Bacteria 8320
172 Ga0105246_10000711 3300011119 Bacteria 18783
173 Ga0105246_10407780 3300011119 Bacteria 1130
174 Ga0157373_10044608 3300013100 Bacteria 3165
175 Ga0157370_10002033 3300013104 Bacteria 24869
176 Ga0157370_10012906 3300013104 Bacteria 8635
177 Ga0157370_10331321 3300013104 Bacteria 1403
178 Ga0157370_10349195 3300013104 Bacteria 1363
179 Ga0157369_10048030 3300013105 Bacteria 4632
180 Ga0157369_10127079 3300013105 Bacteria 2702
181 Ga0157369_10341700 3300013105 Bacteria 1555
182 Ga0157374_10000087 3300013296 Bacteria 91263
183 Ga0157374_10121444 3300013296 Bacteria 2522
184 Ga0157374_10723579 3300013296 Bacteria 1009
185 Ga0157378_10000083 3300013297 Bacteria 87820
186 Ga0157378_10090407 3300013297 Bacteria 2782
187 Ga0157378_10259048 3300013297 Bacteria 1668
188 Ga0163162_10163688 3300013306 Bacteria 2347
189 Ga0163162_10241179 3300013306 Bacteria 1938
190 Ga0157372_10097702 3300013307 Bacteria 3349
191 Ga0157375_10002225 3300013308 Bacteria 16788
192 Ga0157375_10162430 3300013308 Bacteria 2376
193 Ga0157375_10688484 3300013308 Bacteria 1176
194 Ga0163163_10023927 3300014325 Bacteria 5807
195 Ga0163163_10043736 3300014325 Bacteria 4393
196 Ga0163163_10098263 3300014325 Bacteria 2948
197 Ga0157380_10109062 3300014326 Bacteria 2322
198 Ga0157379_10237541 3300014968 Bacteria 1653
199 Ga0157376_10000071 3300014969 Bacteria 82759
200 Ga0157376_10052882 3300014969 Bacteria 3379
201 Ga0163161_10043519 3300017792 Bacteria 3233
202 Ga0213876_10001857 3300021384 Bacteria 12724
203 Ga0209147_100266 3300025229 Bacteria 47344
204 Ga0209437_108758 3300025233 Bacteria 1605
205 Ga0209026_1002564 3300025250 Bacteria 6698
206 Ga0209148_1000061 3300025254 Bacteria 349575
207 Ga0209233_1000003 3300025261 Bacteria 1607366
208 Ga0209233_1000026 3300025261 Bacteria 678466
209 Ga0209233_1014267 3300025261 Bacteria 2243
210 Ga0209565_1000008 3300025263 Bacteria 774179
211 Ga0209565_1000522 3300025263 Bacteria 27324
212 Ga0209455_1000026 3300025272 Bacteria 653778
213 Ga0209673_1000645 3300025273 Bacteria 51774
214 Ga0209673_1001385 3300025273 Bacteria 23781
215 Ga0209676_1000483 3300025292 Bacteria 65133
216 Ga0209564_1008979 3300025295 Bacteria 4838
217 Ga0209758_1003157 3300025297 Bacteria 15483
218 Ga0209758_1005516 3300025297 Bacteria 9666
219 Ga0209050_1000010 3300025298 Bacteria 980454
220 Ga0209050_1000215 3300025298 Bacteria 129179
221 Ga0209050_1001022 3300025298 Bacteria 34910
222 Ga0209050_1002559 3300025298 Bacteria 15174
223 Ga0209256_1000009 3300025299 Bacteria 922071
224 Ga0209256_1000010 3300025299 Bacteria 912110
225 Ga0209256_1002486 3300025299 Bacteria 14935
226 Ga0209257_1000027 3300025304 Bacteria 703541
227 Ga0209257_1000532 3300025304 Bacteria 66089
228 Ga0209257_1004045 3300025304 Bacteria 11783
229 Ga0207697_10088367 3300025315 Bacteria 1312
230 Ga0207656_10014892 3300025321 Bacteria 3005
231 Ga0207656_10031456 3300025321 Bacteria 2199
232 Ga0207682_10084397 3300025893 Bacteria 1367
233 Ga0207642_10011848 3300025899 Bacteria 3127
234 Ga0207680_10018488 3300025903 Bacteria 3706
235 Ga0207647_10004220 3300025904 Bacteria 10655
236 Ga0207645_10000217 3300025907 Bacteria 47483
237 Ga0207645_10062188 3300025907 Bacteria 2385
238 Ga0207645_10151062 3300025907 Bacteria 1516
239 Ga0207705_10000002 3300025909 Bacteria 2046852
240 Ga0207705_10000018 3300025909 Bacteria 319792
241 Ga0207705_10031816 3300025909 Bacteria 3768
242 Ga0207705_10032851 3300025909 Bacteria 3707
243 Ga0207684_10005643 3300025910 Bacteria 11496
244 Ga0207707_10001374 3300025912 Bacteria 22568
245 Ga0207695_10016004 3300025913 Bacteria 8804
246 Ga0207695_10055766 3300025913 Bacteria 4116
247 Ga0207695_10108723 3300025913 Bacteria 2756
248 Ga0207695_10130137 3300025913 Bacteria 2475
249 Ga0207695_10315698 3300025913 Bacteria 1452
250 Ga0207671_10213979 3300025914 Bacteria 1508
251 Ga0207693_10034480 3300025915 Bacteria 3992
252 Ga0207663_10178228 3300025916 Bacteria 1515
253 Ga0207660_10039985 3300025917 Bacteria 3281
254 Ga0207660_10326127 3300025917 Unclassified 1227
255 Ga0207657_10000273 3300025919 Bacteria 54891
256 Ga0207657_10008526 3300025919 Bacteria 10394
257 Ga0207657_10083491 3300025919 Bacteria 2680
258 Ga0207657_10139722 3300025919 Bacteria 1979
259 Ga0207649_10002638 3300025920 Bacteria 9956
260 Ga0207649_10065359 3300025920 Bacteria 2302
261 Ga0207649_10197431 3300025920 Bacteria 1419
262 Ga0207649_10331634 3300025920 Bacteria 1121
263 Ga0207652_10055877 3300025921 Bacteria 3397
264 Ga0207652_10118673 3300025921 Bacteria 2352
265 Ga0207681_10012369 3300025923 Bacteria 5266
266 Ga0207681_10037243 3300025923 Bacteria 3214
267 Ga0207681_10304572 3300025923 Bacteria 1262
268 Ga0207694_10005534 3300025924 Bacteria 9690
269 Ga0207650_10019174 3300025925 Bacteria 4806
270 Ga0207659_10005328 3300025926 Bacteria 7795
271 Ga0207687_10000316 3300025927 Bacteria 32985
272 Ga0207687_10069976 3300025927 Bacteria 2504
273 Ga0207700_10053313 3300025928 Bacteria 3030
274 Ga0207664_10036629 3300025929 Bacteria 3792
275 Ga0207664_10098427 3300025929 Bacteria 2412
276 Ga0207644_10032375 3300025931 Bacteria 3647
277 Ga0207644_10039932 3300025931 Bacteria 3314
278 Ga0207690_10007103 3300025932 Bacteria 6652
279 Ga0207690_10014886 3300025932 Bacteria 4708
280 Ga0207690_10042225 3300025932 Bacteria 2994
281 Ga0207706_10043075 3300025933 Bacteria 4000
282 Ga0207706_10056210 3300025933 Bacteria 3470
283 Ga0207706_10078142 3300025933 Bacteria 2911
284 Ga0207686_10001161 3300025934 Bacteria 15196
285 Ga0207686_10018341 3300025934 Bacteria 3961
286 Ga0207686_10048023 3300025934 Bacteria 2642
287 Ga0207709_10000187 3300025935 Bacteria 82937
288 Ga0207670_10028365 3300025936 Bacteria 3553
289 Ga0207669_10022506 3300025937 Bacteria 3349
290 Ga0207669_10038279 3300025937 Bacteria 2760
291 Ga0207704_10000006 3300025938 Bacteria 220005
292 Ga0207704_10021819 3300025938 Bacteria 3418
293 Ga0207704_10436103 3300025938 Bacteria 1042
294 Ga0207665_10112182 3300025939 Unclassified 1917
295 Ga0207691_10001609 3300025940 Bacteria 22430
296 Ga0207691_10021175 3300025940 Bacteria 6143
297 Ga0207691_10040504 3300025940 Bacteria 4303
298 Ga0207711_10023269 3300025941 Bacteria 5184
299 Ga0207711_10033869 3300025941 Bacteria 4324
300 Ga0207689_10002159 3300025942 Bacteria 18500
301 Ga0207661_10287170 3300025944 Bacteria 1472
302 Ga0207679_10075851 3300025945 Bacteria 2553
303 Ga0207679_10081940 3300025945 Bacteria 2469
304 Ga0207667_10000038 3300025949 Bacteria 280720
305 Ga0207667_10000525 3300025949 Bacteria 50627
306 Ga0207667_10007338 3300025949 Bacteria 13269
307 Ga0207667_10011273 3300025949 Bacteria 10396
308 Ga0207667_10062204 3300025949 Bacteria 3904
309 Ga0207651_10000001 3300025960 Bacteria 516823
310 Ga0207651_10012408 3300025960 Bacteria 4822
311 Ga0207651_10020343 3300025960 Bacteria 4003
312 Ga0207712_10006935 3300025961 Bacteria 7147
313 Ga0207712_10080228 3300025961 Bacteria 2373
314 Ga0207640_10001904 3300025981 Bacteria 11203
315 Ga0207640_10028144 3300025981 Bacteria 3433
316 Ga0207640_10124394 3300025981 Bacteria 1854
317 Ga0207640_10156327 3300025981 Bacteria 1681
318 Ga0207658_10047329 3300025986 Bacteria 3147
319 Ga0207658_10263190 3300025986 Bacteria 1470
320 Ga0207677_10000016 3300026023 Bacteria 153771
321 Ga0207677_10017913 3300026023 Bacteria 4238
322 Ga0207703_10025102 3300026035 Bacteria 4687
323 Ga0207703_10045573 3300026035 Bacteria 3528
324 Ga0207639_10000100 3300026041 Bacteria 70921
325 Ga0207639_10085754 3300026041 Bacteria 2505
326 Ga0207639_10191705 3300026041 Bacteria 1746
327 Ga0207678_10000007 3300026067 Bacteria 179943
328 Ga0207678_10002851 3300026067 Bacteria 15681
329 Ga0207678_10141069 3300026067 Bacteria 2056
330 Ga0207708_10071259 3300026075 Bacteria 2662
331 Ga0207702_10000447 3300026078 Bacteria 46576
332 Ga0207702_10000959 3300026078 Bacteria 29645
333 Ga0207702_10002844 3300026078 Bacteria 16184
334 Ga0207702_10023208 3300026078 Bacteria 5144
335 Ga0207641_10497351 3300026088 Bacteria 1183
336 Ga0207648_10000042 3300026089 Bacteria 114885
337 Ga0207648_10002179 3300026089 Bacteria 21248
338 Ga0207648_10057292 3300026089 Bacteria 3399
339 Ga0207676_10191504 3300026095 Bacteria 1800
340 Ga0207676_10241653 3300026095 Bacteria 1620
341 Ga0207676_10255818 3300026095 Bacteria 1578
342 Ga0207674_10001906 3300026116 Bacteria 26496
343 Ga0207674_10215621 3300026116 Bacteria 1868
344 Ga0207675_100043571 3300026118 Bacteria 4191
345 Ga0207683_10003596 3300026121 Bacteria 13514
346 Ga0207683_10045788 3300026121 Bacteria 3826
347 Ga0207698_10043667 3300026142 Bacteria 3360
348 Ga0207698_10098916 3300026142 Unclassified 2411
349 Ga0268266_10000103 3300028379 Bacteria 179736
350 Ga0268264_10371189 3300028381 Bacteria 1367
351 Ga0265338_10146926 3300028800 Bacteria 1838
352 Ga0265330_10012699 3300031235 Bacteria 3934
353 Ga0307408_100243376 3300031548 Bacteria 1479
354 Ga0265313_10118462 3300031595 Bacteria 1157
355 Ga0265314_10000420 3300031711 Bacteria 57180
356 Ga0265342_10004424 3300031712 Bacteria 11081
357 Ga0307405_10013715 3300031731 Bacteria 4330
358 Ga0307413_10012299 3300031824 Bacteria 4254
359 Ga0307410_10058567 3300031852 Bacteria 2626
360 Ga0307406_10108276 3300031901 Bacteria 1907
361 Ga0307406_10134431 3300031901 Bacteria 1741
362 Ga0307406_10242171 3300031901 Bacteria 1353
363 Ga0307407_10012169 3300031903 Bacteria 4127
364 Ga0307407_10090473 3300031903 Bacteria 1874
365 Ga0307412_10006690 3300031911 Bacteria 6535
366 Ga0307412_10065118 3300031911 Bacteria 2465
367 Ga0307412_10225938 3300031911 Bacteria 1438
368 Ga0307409_100000049 3300031995 Bacteria 42215
369 Ga0307409_100081170 3300031995 Bacteria 2620
370 Ga0307416_100020682 3300032002 Bacteria 4703
371 Ga0307416_100059825 3300032002 Bacteria 3098
372 Ga0307416_100311741 3300032002 Bacteria 1570
373 Ga0307414_10001517 3300032004 Bacteria 12061
374 Ga0307414_10002005 3300032004 Bacteria 10566
375 Ga0307414_10015197 3300032004 Bacteria 4641
376 Ga0307414_10090727 3300032004 Bacteria 2269
377 Ga0307411_10003770 3300032005 Bacteria 7118
378 Ga0307411_10024109 3300032005 Bacteria 3620
379 Ga0307415_100012691 3300032126 Bacteria 4881
380 Ga0307415_100072536 3300032126 Bacteria 2425
381 Ga0373944_0078838 3300035089 Bacteria 1085
382 Ga0373946_0071372 3300035171 Bacteria 1501
383 Ga0373955_0066547 3300035172 Bacteria 2003
384 Ga0373927_0066085 3300035695 Bacteria 2339
385 Ga0373927_0249265 3300035695 Bacteria 1167
386 Ga0373933_0107381 3300035724 Bacteria 1737
387 Ga0373947_0002938 3300035725 Bacteria 10172
388 Ga0373937_0031347 3300036401 Bacteria 4817
389 Ga0373925_0005490 3300037068 Bacteria 9437
390 Ga0373925_0020760 3300037068 Bacteria 4786
391 Ga0395899_0000542 3300037312 Bacteria 40992
392 Ga0395899_0000670 3300037312 Bacteria 34678
393 Ga0395900_0000266 3300037418 Bacteria 81348
394 Ga0395900_0000858 3300037418 Bacteria 40064
395 Ga0395900_0048376 3300037418 Bacteria 4380
396 Ga0395900_0077183 3300037418 Bacteria 3422
397 Ga0395900_0153815 3300037418 Bacteria 2350
398 Ga0395898_0031953 3300037466 Bacteria 5256
399 Ga0395898_0087020 3300037466 Bacteria 3011
400 Ga0395905_0032393 3300037471 Bacteria 4916
401 Ga0395905_0056648 3300037471 Bacteria 3666
402 Ga0395905_0086871 3300037471 Bacteria 2932
403 Ga0395901_0000174 3300038443 Bacteria 83279
404 Ga0395901_0001090 3300038443 Bacteria 28972
405 Ga0436365_0873465 3300039437 Bacteria 246686
406 Ga0466966_0278427 3300044684 Bacteria 1006
407 Ga0466963_0073094 3300044694 Bacteria 2311
408 Ga0466957_0000110 3300044842 Bacteria 34092
409 Ga0466957_0047316 3300044842 Bacteria 2613
410 Ga0466958_0018902 3300045836 Bacteria 4005
411 Ga0495662_0110848 3300046476 Bacteria 1345
412 Ga0495607_0148876 3300046501 Bacteria 1200
413 Ga0495606_0014096 3300046507 Bacteria 6260
414 Ga0495608_0171874 3300046511 Bacteria 1374
415 Ga0495610_0001958 3300046512 Bacteria 17717
416 Ga0495616_0000039 3300046513 Bacteria 123105
417 Ga0495620_0005136 3300046515 Bacteria 7328
418 Ga0495640_0213547 3300046533 Bacteria 1219
419 Ga0495587_0056814 3300046536 Bacteria 2302
420 Ga0495668_0002367 3300046616 Bacteria 15688
421 Ga0495668_0019330 3300046616 Bacteria 3928
422 Ga0495659_0011624 3300046664 Bacteria 2837
423 Ga0495604_0040539 3300047317 Bacteria 3656
424 Ga0495673_0043190 3300047469 Bacteria 2019
425 Ga0495681_0064465 3300047470 Bacteria 1678
426 Ga0495602_0041948 3300048088 Bacteria 4173
427 Ga0496100_0004476 3300048903 Bacteria 7415
428 Ga0496101_0170136 3300048904 Bacteria 1674
429 Ga0496102_0093685 3300048905 Bacteria 2783
430 Ga0496102_0219376 3300048905 Bacteria 1792
431 Ga0496103_0043024 3300048906 Bacteria 2780
432 Ga0496103_0247426 3300048906 Bacteria 1147
433 Ga0496104_0057604 3300048907 Bacteria 3676
434 Ga0496104_0256513 3300048907 Bacteria 1661
435 Ga0496106_0072192 3300048909 Bacteria 2639
436 Ga0496107_0042753 3300048910 Bacteria 3254
437 Ga0496108_0059350 3300048911 Bacteria 3217
438 Ga0496109_0385281 3300048912 Bacteria 1324
439 Ga0496110_0002065 3300048913 Bacteria 14971
440 Ga0496111_0217129 3300048914 Bacteria 1420
441 Ga0496112_0306038 3300048915 Bacteria 1534
442 Ga0496113_0025194 3300048916 Bacteria 4237
443 Ga0496113_0169859 3300048916 Bacteria 1727
444 Ga0496115_0112407 3300048918 Bacteria 2238
445 Ga0496116_0080339 3300048919 Bacteria 2025
446 Ga0496118_0019117 3300048921 Bacteria 6137
447 Ga0496119_0018618 3300048922 Bacteria 5159
448 Ga0496119_0020412 3300048922 Bacteria 4836
449 Ga0496120_0021094 3300048923 Bacteria 4122
450 Ga0496121_0044531 3300048924 Bacteria 3826
451 Ga0496121_0056589 3300048924 Bacteria 3256
452 Ga0496123_0018447 3300048926 Bacteria 5552
453 Ga0496125_0002931 3300048928 Bacteria 21477
454 Ga0501071_0065744 3300049587 Bacteria 2634
455 Ga0501207_000035 3300049654 Bacteria 9749
456 Ga0501216_012479 3300049660 Bacteria 1396
457 Ga0501227_002723 3300049665 Bacteria 3881
458 Ga0501225_0005997 3300049705 Bacteria 3553
459 Ga0501035_0037959 3300049822 Bacteria 4361
460 nmdc:mga08y16_64741_c1 3300050511 Bacteria 3816
461 Ga0500578_0000043 3300053086 Bacteria 128295
462 Ga0500608_012256 3300053122 Bacteria 3753

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10043192 Ga0105240_100431922 275
2 3300009098 Ga0105245_10114809 Ga0105245_101148092 275
3 3300009148 Ga0105243_10016028 Ga0105243_100160289 275
4 3300009176 Ga0105242_10019056 Ga0105242_100190567 275
5 3300009551 Ga0105238_10007923 Ga0105238_1000792316 275
6 3300013105 Ga0157369_10127079 Ga0157369_101270791 275
7 3300013297 Ga0157378_10259048 Ga0157378_102590482 275
8 3300013306 Ga0163162_10241179 Ga0163162_102411791 275
9 3300014325 Ga0163163_10023927 Ga0163163_100239279 275
10 3300014968 Ga0157379_10237541 Ga0157379_102375411 275
11 3300014969 Ga0157376_10052882 Ga0157376_100528822 275
12 3300026095 Ga0207676_10255818 Ga0207676_102558181 275
13 3300048903 Ga0496100_0004476 Ga0496100_0004476_1522_2370 275
14 3300048904 Ga0496101_0170136 Ga0496101_0170136_195_1043 275
15 3300048905 Ga0496102_0219376 Ga0496102_0219376_933_1781 275
16 3300048906 Ga0496103_0043024 Ga0496103_0043024_816_1664 275
17 3300048907 Ga0496104_0057604 Ga0496104_0057604_1802_2650 275
18 3300048909 Ga0496106_0072192 Ga0496106_0072192_1690_2538 275
19 3300048910 Ga0496107_0042753 Ga0496107_0042753_1245_2093 275
20 3300048911 Ga0496108_0059350 Ga0496108_0059350_1060_1908 275
21 3300048912 Ga0496109_0385281 Ga0496109_0385281_23_871 275
22 3300048913 Ga0496110_0002065 Ga0496110_0002065_9570_10418 275
23 3300048914 Ga0496111_0217129 Ga0496111_0217129_119_967 275
24 3300048915 Ga0496112_0306038 Ga0496112_0306038_23_871 275
25 3300048916 Ga0496113_0025194 Ga0496113_0025194_905_1753 275
26 3300009174 Ga0105241_10165217 Ga0105241_101652174 292
27 3300013296 Ga0157374_10723579 Ga0157374_107235791 292
28 3300013308 Ga0157375_10688484 Ga0157375_106884842 292
29 3300037418 Ga0395900_0153815 Ga0395900_0153815_1170_2048 292
30 3300005327 Ga0070658_10165864 Ga0070658_101658642 299
31 3300005330 Ga0070690_100001641 Ga0070690_1000016416 299
32 3300005356 Ga0070674_100032237 Ga0070674_1000322373 299
33 3300005364 Ga0070673_100034457 Ga0070673_1000344573 299
34 3300005457 Ga0070662_100036785 Ga0070662_1000367854 299
35 3300005459 Ga0068867_100018326 Ga0068867_1000183262 299
36 3300005543 Ga0070672_100045039 Ga0070672_1000450392 299
37 3300005578 Ga0068854_100026880 Ga0068854_1000268806 299
38 3300005616 Ga0068852_100056659 Ga0068852_1000566592 299
39 3300005617 Ga0068859_100009808 Ga0068859_10000980813 299
40 3300005618 Ga0068864_100138745 Ga0068864_1001387452 299
41 3300005718 Ga0068866_10003217 Ga0068866_100032172 299
42 3300005834 Ga0068851_10043143 Ga0068851_100431431 299
43 3300005841 Ga0068863_100048009 Ga0068863_1000480092 299
44 3300005842 Ga0068858_100040666 Ga0068858_1000406667 299
45 3300005843 Ga0068860_100046349 Ga0068860_1000463492 299
46 3300006237 Ga0097621_100046372 Ga0097621_1000463722 299
47 3300006881 Ga0068865_100004123 Ga0068865_10000412312 299
48 3300006931 Ga0097620_100009808 Ga0097620_10000980813 299
49 3300025321 Ga0207656_10014892 Ga0207656_100148921 299
50 3300025899 Ga0207642_10011848 Ga0207642_100118483 299
51 3300025907 Ga0207645_10062188 Ga0207645_100621882 299
52 3300025909 Ga0207705_10032851 Ga0207705_100328512 299
53 3300025913 Ga0207695_10108723 Ga0207695_101087232 299
54 3300025919 Ga0207657_10083491 Ga0207657_100834912 299
55 3300025927 Ga0207687_10069976 Ga0207687_100699761 299
56 3300025931 Ga0207644_10039932 Ga0207644_100399321 299
57 3300025933 Ga0207706_10056210 Ga0207706_100562102 299
58 3300025934 Ga0207686_10048023 Ga0207686_100480232 299
59 3300025937 Ga0207669_10022506 Ga0207669_100225062 299
60 3300025938 Ga0207704_10021819 Ga0207704_100218197 299
61 3300025940 Ga0207691_10021175 Ga0207691_100211754 299
62 3300025941 Ga0207711_10023269 Ga0207711_100232698 299
63 3300025960 Ga0207651_10020343 Ga0207651_100203432 299
64 3300025981 Ga0207640_10124394 Ga0207640_101243942 299
65 3300026023 Ga0207677_10017913 Ga0207677_100179132 299
66 3300026035 Ga0207703_10045573 Ga0207703_100455735 299
67 3300026089 Ga0207648_10002179 Ga0207648_1000217911 299
68 3300026121 Ga0207683_10003596 Ga0207683_100035968 299
69 3300026142 Ga0207698_10043667 Ga0207698_100436672 299
70 3300028381 Ga0268264_10371189 Ga0268264_103711892 299
71 3300003320 rootH2_10056391 rootH2_100563914 303
72 3300048919 Ga0496116_0080339 Ga0496116_0080339_522_1478 303
73 iso_pu_bacteria 2643221581 2643916079 303
74 iso_pu_bacteria 2923516293 2923519779 303
75 iso_pu_bacteria 8002869464 8002870005 303
76 3300005335 Ga0070666_10099997 Ga0070666_100999971 304
77 3300005338 Ga0068868_100318508 Ga0068868_1003185082 304
78 3300005355 Ga0070671_100318883 Ga0070671_1003188832 304
79 3300005366 Ga0070659_100184379 Ga0070659_1001843792 304
80 3300005367 Ga0070667_100061776 Ga0070667_1000617761 304
81 3300005456 Ga0070678_100002092 Ga0070678_1000020926 304
82 3300006358 Ga0068871_100351726 Ga0068871_1003517262 304
83 3300025986 Ga0207658_10263190 Ga0207658_102631902 304
84 3300026088 Ga0207641_10497351 Ga0207641_104973511 304
85 3300046616 Ga0495668_0019330 Ga0495668_0019330_2005_3081 304
86 iso_pu_bacteria 2990265787 2990269283 304
87 iso_pu_bacteria 2993693658 2993697374 304
88 iso_pu_bacteria 2818991438 2819554385 305
89 3300032004 Ga0307414_10015197 Ga0307414_100151973 306
90 3300046513 Ga0495616_0000039 Ga0495616_0000039_37887_38963 306
91 3300046515 Ga0495620_0005136 Ga0495620_0005136_2206_3231 306
92 3300047470 Ga0495681_0064465 Ga0495681_0064465_10_1035 306
93 3300025298 Ga0209050_1000010 Ga0209050_1000010699 307
94 3300025304 Ga0209257_1000027 Ga0209257_1000027341 307
95 3300005331 Ga0070670_100291914 Ga0070670_1002919142 308
96 3300005844 Ga0068862_100049996 Ga0068862_1000499963 308
97 3300025944 Ga0207661_10287170 Ga0207661_102871702 308
98 3300005338 Ga0068868_100044910 Ga0068868_1000449104 309
99 3300005339 Ga0070660_100043986 Ga0070660_1000439862 309
100 3300005344 Ga0070661_100202611 Ga0070661_1002026112 309
101 3300005457 Ga0070662_100111639 Ga0070662_1001116392 309
102 3300005563 Ga0068855_100009554 Ga0068855_1000095549 309
103 3300005564 Ga0070664_100280478 Ga0070664_1002804782 309
104 3300005616 Ga0068852_100306172 Ga0068852_1003061722 309
105 3300009036 Ga0105244_10132662 Ga0105244_101326621 309
106 3300009174 Ga0105241_10087190 Ga0105241_100871901 309
107 3300011119 Ga0105246_10407780 Ga0105246_104077802 309
108 3300013100 Ga0157373_10044608 Ga0157373_100446082 309
109 3300014325 Ga0163163_10098263 Ga0163163_100982632 309
110 3300025229 Ga0209147_100266 Ga0209147_10026631 309
111 3300025298 Ga0209050_1000215 Ga0209050_10002155 309
112 3300025909 Ga0207705_10031816 Ga0207705_100318162 309
113 3300025919 Ga0207657_10008526 Ga0207657_100085262 309
114 3300025920 Ga0207649_10065359 Ga0207649_100653592 309
115 3300025933 Ga0207706_10043075 Ga0207706_100430753 309
116 3300025949 Ga0207667_10007338 Ga0207667_100073388 309
117 3300025981 Ga0207640_10156327 Ga0207640_101563272 309
118 3300026067 Ga0207678_10141069 Ga0207678_101410692 309
119 3300031824 Ga0307413_10012299 Ga0307413_100122994 309
120 3300031852 Ga0307410_10058567 Ga0307410_100585672 309
121 3300031901 Ga0307406_10242171 Ga0307406_102421712 309
122 3300031903 Ga0307407_10012169 Ga0307407_100121692 309
123 3300031911 Ga0307412_10065118 Ga0307412_100651182 309
124 3300031995 Ga0307409_100000049 Ga0307409_10000004914 309
125 3300031995 Ga0307409_100081170 Ga0307409_1000811702 309
126 3300032002 Ga0307416_100020682 Ga0307416_1000206824 309
127 3300032004 Ga0307414_10001517 Ga0307414_100015179 309
128 3300032005 Ga0307411_10024109 Ga0307411_100241092 309
129 3300032126 Ga0307415_100072536 Ga0307415_1000725362 309
130 3300037312 Ga0395899_0000670 Ga0395899_0000670_21445_22383 309
131 3300037418 Ga0395900_0000266 Ga0395900_0000266_36069_37007 309
132 3300037418 Ga0395900_0000858 Ga0395900_0000858_37153_38091 309
133 3300037418 Ga0395900_0077183 Ga0395900_0077183_817_1755 309
134 3300037466 Ga0395898_0031953 Ga0395898_0031953_67_1005 309
135 3300037466 Ga0395898_0087020 Ga0395898_0087020_1328_2266 309
136 3300037471 Ga0395905_0056648 Ga0395905_0056648_629_1567 309
137 3300037471 Ga0395905_0086871 Ga0395905_0086871_215_1153 309
138 3300038443 Ga0395901_0000174 Ga0395901_0000174_12099_13037 309
139 3300038443 Ga0395901_0001090 Ga0395901_0001090_21118_22056 309
140 3300044694 Ga0466963_0073094 Ga0466963_0073094_529_1467 309
141 3300045836 Ga0466958_0018902 Ga0466958_0018902_2383_3321 309
142 3300049822 Ga0501035_0037959 Ga0501035_0037959_2956_3894 309
143 3300005327 Ga0070658_10000013 Ga0070658_1000001334 310
144 3300005366 Ga0070659_100011148 Ga0070659_1000111487 310
145 3300025909 Ga0207705_10000002 Ga0207705_10000002548 310
146 3300025932 Ga0207690_10007103 Ga0207690_100071037 310
147 3300047317 Ga0495604_0040539 Ga0495604_0040539_1202_2188 310
148 3300048907 Ga0496104_0256513 Ga0496104_0256513_589_1530 310
149 iso_pu_bacteria 2990265787 2990269130 310
150 iso_pu_bacteria 2993693658 2993694833 310
151 3300025921 Ga0207652_10055877 Ga0207652_100558772 311
152 3300025934 Ga0207686_10018341 Ga0207686_100183413 311
153 3300035172 Ga0373955_0066547 Ga0373955_0066547_82_1071 311
154 3300035695 Ga0373927_0066085 Ga0373927_0066085_783_1748 311
155 3300035724 Ga0373933_0107381 Ga0373933_0107381_79_1068 311
156 3300035725 Ga0373947_0002938 Ga0373947_0002938_5276_6241 311
157 3300036401 Ga0373937_0031347 Ga0373937_0031347_161_1150 311
158 3300037068 Ga0373925_0005490 Ga0373925_0005490_3872_4837 311
159 3300044684 Ga0466966_0278427 Ga0466966_0278427_47_991 311
160 3300044842 Ga0466957_0000110 Ga0466957_0000110_11537_12481 311
161 3300044842 Ga0466957_0047316 Ga0466957_0047316_871_1815 311
162 3300046511 Ga0495608_0171874 Ga0495608_0171874_93_1082 311
163 3300046536 Ga0495587_0056814 Ga0495587_0056814_240_1229 311
164 3300048088 Ga0495602_0041948 Ga0495602_0041948_1733_2722 311
165 3300049587 Ga0501071_0065744 Ga0501071_0065744_1035_2000 311
166 3300005455 Ga0070663_100000572 Ga0070663_10000057216 312
167 3300005834 Ga0068851_10000356 Ga0068851_100003562 312
168 3300009174 Ga0105241_10013272 Ga0105241_100132724 312
169 3300013104 Ga0157370_10012906 Ga0157370_100129062 312
170 3300025321 Ga0207656_10031456 Ga0207656_100314561 312
171 3300025913 Ga0207695_10130137 Ga0207695_101301372 312
172 3300025949 Ga0207667_10011273 Ga0207667_100112736 312
173 3300026041 Ga0207639_10000100 Ga0207639_1000010052 312
174 3300026067 Ga0207678_10000007 Ga0207678_1000000772 312
175 3300026078 Ga0207702_10000959 Ga0207702_1000095918 312
176 3300031548 Ga0307408_100243376 Ga0307408_1002433762 312
177 3300031731 Ga0307405_10013715 Ga0307405_100137153 312
178 3300031911 Ga0307412_10006690 Ga0307412_100066904 312
179 3300032002 Ga0307416_100311741 Ga0307416_1003117412 312
180 3300048921 Ga0496118_0019117 Ga0496118_0019117_306_1253 312
181 3300048922 Ga0496119_0018618 Ga0496119_0018618_86_1033 312
182 3300048923 Ga0496120_0021094 Ga0496120_0021094_2266_3213 312
183 3300048924 Ga0496121_0044531 Ga0496121_0044531_275_1222 312
184 3300048928 Ga0496125_0002931 Ga0496125_0002931_10572_11519 312
185 iso_pu_bacteria 2582581279 2585146439 312
186 iso_pu_bacteria 2643221577 2643896993 312
187 iso_pu_bacteria 2928531327 2928531337 312
188 iso_pu_bacteria 2946787523 2946790455 312
189 3300003781 Ga0055536_1000379 Ga0055536_100037914 313
190 3300003791 Ga0055530_10011078 Ga0055530_100110782 313
191 3300003794 Ga0055531_10000560 Ga0055531_100005606 313
192 3300005262 Ga0065165_1000840 Ga0065165_10008406 313
193 3300005353 Ga0070669_100084425 Ga0070669_1000844252 313
194 3300005545 Ga0070695_100302992 Ga0070695_1003029921 313
195 3300009098 Ga0105245_10280750 Ga0105245_102807502 313
196 3300025292 Ga0209676_1000483 Ga0209676_100048339 313
197 3300025298 Ga0209050_1001022 Ga0209050_100102214 313
198 3300025304 Ga0209257_1000532 Ga0209257_10005327 313
199 3300031595 Ga0265313_10118462 Ga0265313_101184621 313
200 3300031711 Ga0265314_10000420 Ga0265314_1000042049 313
201 3300031712 Ga0265342_10004424 Ga0265342_100044244 313
202 3300031911 Ga0307412_10225938 Ga0307412_102259381 313
203 iso_pu_bacteria 2895498888 2895503646 313
204 iso_pu_bacteria 2895511927 2895515532 313
205 iso_pu_bacteria 2895522137 2895524712 313
206 iso_pu_bacteria 2895525241 2895527663 313
207 3300003763 Ga0055529_1000068 Ga0055529_100006841 314
208 3300005435 Ga0070714_100019094 Ga0070714_1000190945 314
209 3300025272 Ga0209455_1000026 Ga0209455_1000026471 314
210 3300025928 Ga0207700_10053313 Ga0207700_100533132 314
211 3300025929 Ga0207664_10098427 Ga0207664_100984272 314
212 iso_pu_bacteria 2643221642 2644234536 314
213 iso_pu_bacteria 2739367756 2739791024 314
214 iso_pu_bacteria 2884960567 2884963644 314
215 3300003214 JGI25165J46597_1000120 JGI25165J46597_100012063 315
216 3300003215 JGI25153J46596_10001019 JGI25153J46596_100010198 315
217 3300003773 Ga0055537_1000488 Ga0055537_10004887 315
218 3300003775 Ga0055524_1000095 Ga0055524_100009519 315
219 3300003791 Ga0055530_10009361 Ga0055530_100093613 315
220 3300003794 Ga0055531_10007451 Ga0055531_100074514 315
221 3300005262 Ga0065165_1002885 Ga0065165_10028858 315
222 3300005262 Ga0065165_1005700 Ga0065165_10057004 315
223 3300005614 Ga0068856_100091891 Ga0068856_1000918912 315
224 3300009093 Ga0105240_10031815 Ga0105240_100318152 315
225 3300013105 Ga0157369_10048030 Ga0157369_100480304 315
226 3300014326 Ga0157380_10109062 Ga0157380_101090621 315
227 3300025250 Ga0209026_1002564 Ga0209026_10025643 315
228 3300025261 Ga0209233_1000003 Ga0209233_10000031505 315
229 3300025263 Ga0209565_1000008 Ga0209565_100000896 315
230 3300025273 Ga0209673_1001385 Ga0209673_10013857 315
231 3300025297 Ga0209758_1003157 Ga0209758_10031578 315
232 3300025298 Ga0209050_1002559 Ga0209050_10025597 315
233 3300025299 Ga0209256_1000009 Ga0209256_1000009775 315
234 3300025299 Ga0209256_1000010 Ga0209256_1000010699 315
235 3300025304 Ga0209257_1004045 Ga0209257_10040451 315
236 3300025913 Ga0207695_10315698 Ga0207695_103156982 315
237 3300025923 Ga0207681_10304572 Ga0207681_103045721 315
238 3300026075 Ga0207708_10071259 Ga0207708_100712592 315
239 3300026078 Ga0207702_10002844 Ga0207702_100028445 315
240 3300028379 Ga0268266_10000103 Ga0268266_10000103129 315
241 3300037312 Ga0395899_0000542 Ga0395899_0000542_26227_27183 315
242 3300037418 Ga0395900_0048376 Ga0395900_0048376_2055_3011 315
243 iso_pu_bacteria 3000865235 3000867803 315
244 3300003790 Ga0055528_1002530 Ga0055528_10025304 316
245 3300005290 Ga0065712_10072716 Ga0065712_100727169 316
246 3300005293 Ga0065715_10111295 Ga0065715_101112955 316
247 3300005328 Ga0070676_10153346 Ga0070676_101533462 316
248 3300005331 Ga0070670_100001022 Ga0070670_10000102219 316
249 3300005335 Ga0070666_10023221 Ga0070666_100232212 316
250 3300005344 Ga0070661_100013638 Ga0070661_1000136382 316
251 3300005354 Ga0070675_100000925 Ga0070675_10000092512 316
252 3300005355 Ga0070671_100001039 Ga0070671_1000010393 316
253 3300005364 Ga0070673_100001707 Ga0070673_1000017072 316
254 3300005366 Ga0070659_100028786 Ga0070659_1000287862 316
255 3300005435 Ga0070714_100277689 Ga0070714_1002776891 316
256 3300005456 Ga0070678_100070387 Ga0070678_1000703872 316
257 3300005457 Ga0070662_100035107 Ga0070662_1000351072 316
258 3300005543 Ga0070672_100000571 Ga0070672_10000057112 316
259 3300005548 Ga0070665_100054088 Ga0070665_1000540882 316
260 3300005564 Ga0070664_100035410 Ga0070664_1000354109 316
261 3300005564 Ga0070664_100222953 Ga0070664_1002229532 316
262 3300005618 Ga0068864_100090763 Ga0068864_1000907636 316
263 3300005841 Ga0068863_100386428 Ga0068863_1003864282 316
264 3300009093 Ga0105240_10028301 Ga0105240_100283011 316
265 3300009094 Ga0111539_10322898 Ga0111539_103228982 316
266 3300009098 Ga0105245_10088225 Ga0105245_100882253 316
267 3300013104 Ga0157370_10002033 Ga0157370_1000203323 316
268 3300013104 Ga0157370_10349195 Ga0157370_103491951 316
269 3300013297 Ga0157378_10090407 Ga0157378_100904073 316
270 3300014325 Ga0163163_10043736 Ga0163163_100437362 316
271 3300017792 Ga0163161_10043519 Ga0163161_100435192 316
272 3300025263 Ga0209565_1000522 Ga0209565_10005227 316
273 3300025273 Ga0209673_1000645 Ga0209673_100064527 316
274 3300025295 Ga0209564_1008979 Ga0209564_10089793 316
275 3300025297 Ga0209758_1005516 Ga0209758_10055164 316
276 3300025299 Ga0209256_1002486 Ga0209256_100248610 316
277 3300025315 Ga0207697_10088367 Ga0207697_100883671 316
278 3300025893 Ga0207682_10084397 Ga0207682_100843971 316
279 3300025903 Ga0207680_10018488 Ga0207680_100184882 316
280 3300025907 Ga0207645_10151062 Ga0207645_101510622 316
281 3300025915 Ga0207693_10034480 Ga0207693_100344804 316
282 3300025917 Ga0207660_10326127 Ga0207660_103261271 316
283 3300025920 Ga0207649_10002638 Ga0207649_100026382 316
284 3300025923 Ga0207681_10037243 Ga0207681_100372432 316
285 3300025925 Ga0207650_10019174 Ga0207650_100191744 316
286 3300025926 Ga0207659_10005328 Ga0207659_100053284 316
287 3300025931 Ga0207644_10032375 Ga0207644_100323754 316
288 3300025932 Ga0207690_10042225 Ga0207690_100422252 316
289 3300025933 Ga0207706_10078142 Ga0207706_100781422 316
290 3300025940 Ga0207691_10001609 Ga0207691_1000160913 316
291 3300025940 Ga0207691_10040504 Ga0207691_100405042 316
292 3300025941 Ga0207711_10033869 Ga0207711_100338692 316
293 3300025945 Ga0207679_10081940 Ga0207679_100819402 316
294 3300025960 Ga0207651_10012408 Ga0207651_100124083 316
295 3300025986 Ga0207658_10047329 Ga0207658_100473292 316
296 3300026041 Ga0207639_10085754 Ga0207639_100857542 316
297 3300026095 Ga0207676_10191504 Ga0207676_101915042 316
298 3300026121 Ga0207683_10045788 Ga0207683_100457884 316
299 3300028800 Ga0265338_10146926 Ga0265338_101469263 316
300 3300035089 Ga0373944_0078838 Ga0373944_0078838_39_1013 316
301 3300035171 Ga0373946_0071372 Ga0373946_0071372_178_1167 316
302 3300035695 Ga0373927_0249265 Ga0373927_0249265_67_1056 316
303 3300037068 Ga0373925_0020760 Ga0373925_0020760_3263_4237 316
304 3300039437 Ga0436365_0873465 Ga0436365_0873465_200214_201194 316
305 3300046501 Ga0495607_0148876 Ga0495607_0148876_161_1120 316
306 3300046507 Ga0495606_0014096 Ga0495606_0014096_3335_4294 316
307 3300046512 Ga0495610_0001958 Ga0495610_0001958_14787_15755 316
308 3300046616 Ga0495668_0002367 Ga0495668_0002367_6067_7026 316
309 3300049654 Ga0501207_000035 Ga0501207_000035_3723_4742 316
310 3300049660 Ga0501216_012479 Ga0501216_012479_313_1332 316
311 3300049665 Ga0501227_002723 Ga0501227_002723_2078_3097 316
312 3300049705 Ga0501225_0005997 Ga0501225_0005997_431_1450 316
313 3300053086 Ga0500578_0000043 Ga0500578_0000043_36572_37540 316
314 3300048924 Ga0496121_0056589 Ga0496121_0056589_71_1033 317
315 3300048926 Ga0496123_0018447 Ga0496123_0018447_1229_2191 317
316 3300003323 rootH1_10007730 rootH1_100077307 318
317 3300003762 Ga0055542_1008800 Ga0055542_10088002 318
318 3300005339 Ga0070660_100000888 Ga0070660_1000008884 318
319 3300005340 Ga0070689_100155280 Ga0070689_1001552802 318
320 3300005353 Ga0070669_100025370 Ga0070669_1000253702 318
321 3300005365 Ga0070688_100135175 Ga0070688_1001351751 318
322 3300005539 Ga0068853_100135534 Ga0068853_1001355341 318
323 3300005617 Ga0068859_100050186 Ga0068859_1000501862 318
324 3300005719 Ga0068861_100093255 Ga0068861_1000932552 318
325 3300005844 Ga0068862_100052122 Ga0068862_1000521223 318
326 3300006931 Ga0097620_100050187 Ga0097620_1000501872 318
327 3300009545 Ga0105237_10029531 Ga0105237_100295313 318
328 3300009553 Ga0105249_10011695 Ga0105249_100116956 318
329 3300013104 Ga0157370_10331321 Ga0157370_103313211 318
330 3300013105 Ga0157369_10341700 Ga0157369_103417002 318
331 3300013306 Ga0163162_10163688 Ga0163162_101636881 318
332 3300013308 Ga0157375_10162430 Ga0157375_101624302 318
333 3300025233 Ga0209437_108758 Ga0209437_1087581 318
334 3300025254 Ga0209148_1000061 Ga0209148_100006195 318
335 3300025261 Ga0209233_1000026 Ga0209233_100002634 318
336 3300025261 Ga0209233_1014267 Ga0209233_10142672 318
337 3300025910 Ga0207684_10005643 Ga0207684_100056436 318
338 3300025914 Ga0207671_10213979 Ga0207671_102139792 318
339 3300025919 Ga0207657_10000273 Ga0207657_1000027332 318
340 3300025920 Ga0207649_10197431 Ga0207649_101974312 318
341 3300025936 Ga0207670_10028365 Ga0207670_100283654 318
342 3300025949 Ga0207667_10062204 Ga0207667_100622042 318
343 3300025961 Ga0207712_10080228 Ga0207712_100802282 318
344 3300026095 Ga0207676_10241653 Ga0207676_102416531 318
345 3300047469 Ga0495673_0043190 Ga0495673_0043190_170_1135 318
346 3300048918 Ga0496115_0112407 Ga0496115_0112407_158_1135 318
347 3300001990 JGI24737J22298_10008882 JGI24737J22298_100088822 319
348 3300002067 JGI24735J21928_10017258 JGI24735J21928_100172582 319
349 3300003203 JGI25406J46586_10004109 JGI25406J46586_100041095 319
350 3300005327 Ga0070658_10000734 Ga0070658_100007346 319
351 3300005328 Ga0070676_10011018 Ga0070676_100110181 319
352 3300005330 Ga0070690_100011164 Ga0070690_1000111641 319
353 3300005334 Ga0068869_100000655 Ga0068869_1000006557 319
354 3300005335 Ga0070666_10085003 Ga0070666_100850032 319
355 3300005336 Ga0070680_100040989 Ga0070680_1000409894 319
356 3300005338 Ga0068868_100000025 Ga0068868_10000002526 319
357 3300005338 Ga0068868_100045315 Ga0068868_1000453152 319
358 3300005339 Ga0070660_100004197 Ga0070660_1000041976 319
359 3300005343 Ga0070687_100076446 Ga0070687_1000764462 319
360 3300005343 Ga0070687_100078462 Ga0070687_1000784622 319
361 3300005344 Ga0070661_100094129 Ga0070661_1000941292 319
362 3300005353 Ga0070669_100017299 Ga0070669_1000172992 319
363 3300005354 Ga0070675_100165130 Ga0070675_1001651302 319
364 3300005364 Ga0070673_100000016 Ga0070673_10000001639 319
365 3300005366 Ga0070659_100009513 Ga0070659_1000095139 319
366 3300005438 Ga0070701_10028617 Ga0070701_100286173 319
367 3300005439 Ga0070711_100097786 Ga0070711_1000977862 319
368 3300005444 Ga0070694_100001287 Ga0070694_1000012874 319
369 3300005455 Ga0070663_100030580 Ga0070663_1000305803 319
370 3300005458 Ga0070681_10008869 Ga0070681_100088694 319
371 3300005459 Ga0068867_100000299 Ga0068867_1000002993 319
372 3300005530 Ga0070679_100157760 Ga0070679_1001577602 319
373 3300005539 Ga0068853_100022796 Ga0068853_1000227965 319
374 3300005539 Ga0068853_100087520 Ga0068853_1000875202 319
375 3300005543 Ga0070672_100124758 Ga0070672_1001247582 319
376 3300005563 Ga0068855_100001290 Ga0068855_10000129037 319
377 3300005564 Ga0070664_100025677 Ga0070664_1000256771 319
378 3300005577 Ga0068857_100005243 Ga0068857_10000524310 319
379 3300005577 Ga0068857_100046973 Ga0068857_1000469732 319
380 3300005578 Ga0068854_100057892 Ga0068854_1000578922 319
381 3300005578 Ga0068854_100102813 Ga0068854_1001028132 319
382 3300005578 Ga0068854_100412887 Ga0068854_1004128871 319
383 3300005614 Ga0068856_100002933 Ga0068856_10000293326 319
384 3300005614 Ga0068856_100026258 Ga0068856_1000262585 319
385 3300005616 Ga0068852_100133802 Ga0068852_1001338022 319
386 3300005617 Ga0068859_100035981 Ga0068859_1000359814 319
387 3300005618 Ga0068864_100030745 Ga0068864_1000307453 319
388 3300005718 Ga0068866_10040172 Ga0068866_100401722 319
389 3300005719 Ga0068861_100393129 Ga0068861_1003931291 319
390 3300005842 Ga0068858_100042945 Ga0068858_1000429454 319
391 3300005842 Ga0068858_100255061 Ga0068858_1002550612 319
392 3300005843 Ga0068860_100079374 Ga0068860_1000793743 319
393 3300005985 Ga0081539_10003170 Ga0081539_1000317012 319
394 3300005985 Ga0081539_10027851 Ga0081539_100278514 319
395 3300005985 Ga0081539_10039290 Ga0081539_100392903 319
396 3300006173 Ga0070716_100063790 Ga0070716_1000637901 319
397 3300006175 Ga0070712_100450048 Ga0070712_1004500481 319
398 3300006237 Ga0097621_100000367 Ga0097621_1000003672 319
399 3300006237 Ga0097621_100006959 Ga0097621_1000069595 319
400 3300006237 Ga0097621_100259326 Ga0097621_1002593262 319
401 3300006358 Ga0068871_100000479 Ga0068871_10000047936 319
402 3300006358 Ga0068871_100002343 Ga0068871_1000023438 319
403 3300006852 Ga0075433_10221019 Ga0075433_102210192 319
404 3300006880 Ga0075429_100040112 Ga0075429_1000401123 319
405 3300006881 Ga0068865_100000026 Ga0068865_10000002621 319
406 3300006931 Ga0097620_100035978 Ga0097620_1000359784 319
407 3300009094 Ga0111539_10546648 Ga0111539_105466482 319
408 3300009098 Ga0105245_10000078 Ga0105245_1000007826 319
409 3300009148 Ga0105243_10001224 Ga0105243_1000122416 319
410 3300009176 Ga0105242_10006070 Ga0105242_100060703 319
411 3300009553 Ga0105249_10011803 Ga0105249_100118033 319
412 3300010375 Ga0105239_10015928 Ga0105239_100159285 319
413 3300011119 Ga0105246_10000711 Ga0105246_1000071112 319
414 3300013296 Ga0157374_10000087 Ga0157374_1000008740 319
415 3300013296 Ga0157374_10121444 Ga0157374_101214443 319
416 3300013297 Ga0157378_10000083 Ga0157378_1000008342 319
417 3300013307 Ga0157372_10097702 Ga0157372_100977022 319
418 3300013308 Ga0157375_10002225 Ga0157375_100022254 319
419 3300014969 Ga0157376_10000071 Ga0157376_1000007142 319
420 3300021384 Ga0213876_10001857 Ga0213876_100018572 319
421 3300025904 Ga0207647_10004220 Ga0207647_100042208 319
422 3300025907 Ga0207645_10000217 Ga0207645_1000021724 319
423 3300025909 Ga0207705_10000018 Ga0207705_100000186 319
424 3300025912 Ga0207707_10001374 Ga0207707_1000137430 319
425 3300025913 Ga0207695_10016004 Ga0207695_1001600410 319
426 3300025913 Ga0207695_10055766 Ga0207695_100557662 319
427 3300025916 Ga0207663_10178228 Ga0207663_101782281 319
428 3300025917 Ga0207660_10039985 Ga0207660_100399854 319
429 3300025919 Ga0207657_10139722 Ga0207657_101397222 319
430 3300025920 Ga0207649_10331634 Ga0207649_103316341 319
431 3300025921 Ga0207652_10118673 Ga0207652_101186732 319
432 3300025923 Ga0207681_10012369 Ga0207681_100123692 319
433 3300025924 Ga0207694_10005534 Ga0207694_1000553411 319
434 3300025927 Ga0207687_10000316 Ga0207687_1000031618 319
435 3300025929 Ga0207664_10036629 Ga0207664_100366292 319
436 3300025932 Ga0207690_10014886 Ga0207690_100148862 319
437 3300025934 Ga0207686_10001161 Ga0207686_100011615 319
438 3300025935 Ga0207709_10000187 Ga0207709_1000018750 319
439 3300025937 Ga0207669_10038279 Ga0207669_100382792 319
440 3300025938 Ga0207704_10000006 Ga0207704_1000000682 319
441 3300025938 Ga0207704_10436103 Ga0207704_104361031 319
442 3300025939 Ga0207665_10112182 Ga0207665_101121821 319
443 3300025942 Ga0207689_10002159 Ga0207689_100021599 319
444 3300025945 Ga0207679_10075851 Ga0207679_100758512 319
445 3300025949 Ga0207667_10000038 Ga0207667_10000038152 319
446 3300025949 Ga0207667_10000525 Ga0207667_1000052563 319
447 3300025960 Ga0207651_10000001 Ga0207651_10000001192 319
448 3300025961 Ga0207712_10006935 Ga0207712_100069356 319
449 3300025981 Ga0207640_10001904 Ga0207640_100019047 319
450 3300025981 Ga0207640_10028144 Ga0207640_100281442 319
451 3300026023 Ga0207677_10000016 Ga0207677_1000001690 319
452 3300026035 Ga0207703_10025102 Ga0207703_100251024 319
453 3300026041 Ga0207639_10191705 Ga0207639_101917052 319
454 3300026067 Ga0207678_10002851 Ga0207678_100028517 319
455 3300026078 Ga0207702_10000447 Ga0207702_100004474 319
456 3300026078 Ga0207702_10023208 Ga0207702_100232081 319
457 3300026089 Ga0207648_10000042 Ga0207648_1000004250 319
458 3300026089 Ga0207648_10057292 Ga0207648_100572922 319
459 3300026116 Ga0207674_10001906 Ga0207674_1000190619 319
460 3300026116 Ga0207674_10215621 Ga0207674_102156212 319
461 3300026118 Ga0207675_100043571 Ga0207675_1000435715 319
462 3300026142 Ga0207698_10098916 Ga0207698_100989162 319
463 3300031235 Ga0265330_10012699 Ga0265330_100126991 319
464 3300031901 Ga0307406_10108276 Ga0307406_101082763 319
465 3300031901 Ga0307406_10134431 Ga0307406_101344311 319
466 3300031903 Ga0307407_10090473 Ga0307407_100904733 319
467 3300032002 Ga0307416_100059825 Ga0307416_1000598252 319
468 3300032004 Ga0307414_10002005 Ga0307414_100020053 319
469 3300032004 Ga0307414_10090727 Ga0307414_100907272 319
470 3300032005 Ga0307411_10003770 Ga0307411_100037705 319
471 3300032126 Ga0307415_100012691 Ga0307415_1000126912 319
472 3300037471 Ga0395905_0032393 Ga0395905_0032393_1574_2533 319
473 3300046476 Ga0495662_0110848 Ga0495662_0110848_271_1278 319
474 3300046533 Ga0495640_0213547 Ga0495640_0213547_185_1192 319
475 3300046664 Ga0495659_0011624 Ga0495659_0011624_1286_2293 319
476 3300048905 Ga0496102_0093685 Ga0496102_0093685_1393_2400 319
477 3300048906 Ga0496103_0247426 Ga0496103_0247426_61_1068 319
478 3300048916 Ga0496113_0169859 Ga0496113_0169859_630_1637 319
479 3300048922 Ga0496119_0020412 Ga0496119_0020412_1900_2868 319
480 3300050511 nmdc:mga08y16_64741_c1 nmdc:mga08y16_64741_c1_2827_3804 319
481 3300053122 Ga0500608_012256 Ga0500608_012256_1105_2073 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

233

305

0.86

PF20434

BD-FAE

BD-FAE

230

295

0.86

PF01738

DLH

Dienelactone hydrolase family

147

360

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q3k-assembly1.cif.gz_B crystal structure of mgs-m1, an alpha/beta hydrolase enzyme from a medee basin deep-sea metagenome library 0.7673 83 315
1w76-assembly1.cif.gz_A orthorhombic form of torpedo californica acetylcholinesterase (ache) complexed with bis-acting galanthamine derivative 0.758 81 235
3hxk-assembly1.cif.gz_A crystal structure of a sugar hydrolase (yeeb) from lactococcus lactis, northeast structural genomics consortium target kr108 0.75 83 312
7dwc-assembly4.cif.gz_D bacteroides thetaiotaomicron vpi5482 btaxe1 0.7488 84 311
8gs3-assembly1.cif.gz_B cryo-em structure of human neuroligin 3 0.7387 83 240
ID Description Score Start End Superfamily
af_A0A1D6EGD3_55_198_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8021 99 219 3.40.50.1820
4q3kA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7682 83 315 3.40.50.1820
3hxkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7489 83 312 3.40.50.1820
af_Q21266_11_550_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7487 84 236 3.40.50.1820
af_Q9UT29_165_337_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7426 85 250 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2T5UBH4-F1-model_v4 Acetyl esterase/lipase 0.9616 30 317 GO:0016787
AF-V4PKI7-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.961 40 319 GO:0016787
AF-F6ICZ9-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9581 29 319 GO:0016787
AF-V4PKI7-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9577 40 319 GO:0016787
AF-A0A437JFY0-F1-model_v4 Alpha/beta hydrolase 0.954 30 319 GO:0016787

Feature Viewer

pLDDT pTM Quality
83.19 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map