F452355

General Info

Members Datasets Scaffolds Average Seq Length
481 226 962 96

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100790774|Ga0070690_1007907742
Length 99
Sequence MTSIDRLYRIAAAPLISEKGTDDSSSRNTYHFRVPLDANKVEIRQAVEKLFKVKVAEVRTMNLEGKLRRRGKFAGYRSDWKKAYVKLKPGQKSPEYADI

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
149 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
153 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
156 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
157 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
166 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
167 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
168 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
182 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
183 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.47
Metatranscriptomes 3.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.62
Rhizosphere 98.13
Stem 0
Stem Tuber 0
Unclassified 17.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100790774 3300005330 Bacteria 735
2 Ga0058863_11773782 3300004799 Bacteria 1461
3 Ga0070658_10034348 3300005327 Bacteria 4080
4 Ga0070658_10087950 3300005327 Bacteria 2558
5 Ga0070683_100011876 3300005329 Bacteria 7549
6 Ga0070683_100127827 3300005329 Bacteria 2403
7 Ga0070683_100140694 3300005329 Bacteria 2286
8 Ga0070690_100355530 3300005330 Bacteria 1064
9 Ga0070690_101045586 3300005330 Unclassified 645
10 Ga0070670_101280382 3300005331 Unclassified 671
11 Ga0068869_100032062 3300005334 Bacteria 3700
12 Ga0070666_10335211 3300005335 Bacteria 1081
13 Ga0070666_10611444 3300005335 Bacteria 796
14 Ga0070680_100003385 3300005336 Bacteria 11897
15 Ga0070680_101971883 3300005336 Unclassified 506
16 Ga0070682_100229280 3300005337 Bacteria 1327
17 Ga0070682_101890528 3300005337 Bacteria 523
18 Ga0068868_100732432 3300005338 Bacteria 887
19 Ga0068868_100740222 3300005338 Bacteria 882
20 Ga0070660_100603597 3300005339 Bacteria 918
21 Ga0070660_100828818 3300005339 Bacteria 779
22 Ga0070689_100145757 3300005340 Bacteria 1907
23 Ga0070689_101993010 3300005340 Unclassified 531
24 Ga0070661_100095351 3300005344 Bacteria 2207
25 Ga0070661_100171910 3300005344 Bacteria 1646
26 Ga0070692_10429462 3300005345 Unclassified 841
27 Ga0070673_100224680 3300005364 Bacteria 1627
28 Ga0070659_100040328 3300005366 Bacteria 3647
29 Ga0070659_100461056 3300005366 Bacteria 1079
30 Ga0070667_100112886 3300005367 Bacteria 2358
31 Ga0070667_101990900 3300005367 Bacteria 547
32 Ga0070709_10601432 3300005434 Bacteria 847
33 Ga0070709_11420961 3300005434 Unclassified 562
34 Ga0070714_100226935 3300005435 Bacteria 1719
35 Ga0070714_100242744 3300005435 Bacteria 1663
36 Ga0070713_100319766 3300005436 Bacteria 1433
37 Ga0070713_101714319 3300005436 Bacteria 610
38 Ga0070711_100248899 3300005439 Bacteria 1393
39 Ga0070711_100467606 3300005439 Bacteria 1035
40 Ga0070711_101282670 3300005439 Unclassified 635
41 Ga0070663_101937936 3300005455 Bacteria 530
42 Ga0070678_100909430 3300005456 Unclassified 805
43 Ga0070678_101130244 3300005456 Bacteria 724
44 Ga0070662_100110487 3300005457 Bacteria 2094
45 Ga0070681_10279937 3300005458 Bacteria 1579
46 Ga0070681_11312271 3300005458 Unclassified 647
47 Ga0068867_100164843 3300005459 Bacteria 1750
48 Ga0068867_100511163 3300005459 Bacteria 1034
49 Ga0068867_100798068 3300005459 Unclassified 842
50 Ga0070685_11487597 3300005466 Unclassified 521
51 Ga0070679_100306968 3300005530 Unclassified 1537
52 Ga0070679_100796808 3300005530 Bacteria 888
53 Ga0070684_100043376 3300005535 Bacteria 3883
54 Ga0070684_100084550 3300005535 Bacteria 2813
55 Ga0070684_100382373 3300005535 Bacteria 1297
56 Ga0070684_100910473 3300005535 Unclassified 824
57 Ga0070684_101296137 3300005535 Bacteria 686
58 Ga0068853_100133809 3300005539 Bacteria 2221
59 Ga0068853_100849546 3300005539 Bacteria 875
60 Ga0068853_101023187 3300005539 Bacteria 796
61 Ga0070672_100454817 3300005543 Bacteria 1103
62 Ga0070672_100603484 3300005543 Bacteria 956
63 Ga0070686_100378425 3300005544 Bacteria 1071
64 Ga0070696_100637017 3300005546 Bacteria 863
65 Ga0070696_101785997 3300005546 Bacteria 531
66 Ga0070665_100019426 3300005548 Bacteria 6819
67 Ga0070665_100193238 3300005548 Bacteria 2036
68 Ga0070665_100489396 3300005548 Bacteria 1241
69 Ga0068855_100019267 3300005563 Bacteria 8202
70 Ga0068855_100067695 3300005563 Bacteria 4159
71 Ga0068855_100099913 3300005563 Bacteria 3341
72 Ga0068855_100135549 3300005563 Bacteria 2809
73 Ga0068855_100274061 3300005563 Bacteria 1875
74 Ga0068855_100336135 3300005563 Bacteria 1666
75 Ga0068855_101494025 3300005563 Bacteria 694
76 Ga0070664_100221341 3300005564 Bacteria 1693
77 Ga0070664_100408912 3300005564 Bacteria 1242
78 Ga0070664_101985845 3300005564 Bacteria 552
79 Ga0070664_102370850 3300005564 Unclassified 503
80 Ga0068857_100373758 3300005577 Bacteria 1322
81 Ga0068857_102349277 3300005577 Unclassified 523
82 Ga0068854_100081038 3300005578 Bacteria 2396
83 Ga0068854_100448867 3300005578 Bacteria 1077
84 Ga0068854_101230312 3300005578 Unclassified 672
85 Ga0068856_100018870 3300005614 Bacteria 6688
86 Ga0068856_100074498 3300005614 Bacteria 3361
87 Ga0068856_100173262 3300005614 Bacteria 2170
88 Ga0068856_100583850 3300005614 Bacteria 1139
89 Ga0068856_102005051 3300005614 Bacteria 589
90 Ga0070702_100140027 3300005615 Bacteria 1540
91 Ga0068852_100024674 3300005616 Bacteria 4863
92 Ga0068852_100054705 3300005616 Bacteria 3441
93 Ga0068852_100520927 3300005616 Unclassified 1186
94 Ga0068852_100559762 3300005616 Bacteria 1144
95 Ga0068852_101066371 3300005616 Bacteria 828
96 Ga0068852_101595218 3300005616 Unclassified 675
97 Ga0068852_102197503 3300005616 Unclassified 573
98 Ga0068859_100528142 3300005617 Bacteria 1275
99 Ga0068864_101664988 3300005618 Unclassified 642
100 Ga0068866_10105529 3300005718 Unclassified 1562
101 Ga0068866_11119813 3300005718 Bacteria 565
102 Ga0068866_11326093 3300005718 Bacteria 524
103 Ga0068861_101882474 3300005719 Unclassified 595
104 Ga0068851_10018984 3300005834 Bacteria 3320
105 Ga0068851_10197446 3300005834 Bacteria 1121
106 Ga0068863_100294776 3300005841 Bacteria 1572
107 Ga0068863_100752387 3300005841 Bacteria 970
108 Ga0068863_101103759 3300005841 Bacteria 798
109 Ga0068858_100065255 3300005842 Bacteria 3368
110 Ga0068858_100107555 3300005842 Bacteria 2603
111 Ga0068858_100518938 3300005842 Bacteria 1152
112 Ga0068860_100377752 3300005843 Bacteria 1398
113 Ga0068860_100615283 3300005843 Bacteria 1092
114 Ga0070717_10008895 3300006028 Bacteria 7523
115 Ga0070717_10415563 3300006028 Bacteria 1210
116 Ga0070715_11004026 3300006163 Unclassified 520
117 Ga0097621_100084015 3300006237 Bacteria 2654
118 Ga0097621_100400621 3300006237 Bacteria 1228
119 Ga0097621_101347968 3300006237 Bacteria 675
120 Ga0068871_100321617 3300006358 Bacteria 1362
121 Ga0068871_100443827 3300006358 Bacteria 1162
122 Ga0068871_100587733 3300006358 Bacteria 1012
123 Ga0075430_100062426 3300006846 Bacteria 3130
124 Ga0075430_101565249 3300006846 Unclassified 541
125 Ga0075431_100269551 3300006847 Bacteria 1726
126 Ga0075429_100843529 3300006880 Bacteria 802
127 Ga0075429_101284120 3300006880 Unclassified 638
128 Ga0068865_100083824 3300006881 Bacteria 2295
129 Ga0068865_100444614 3300006881 Bacteria 1070
130 Ga0068865_101229805 3300006881 Bacteria 664
131 Ga0097620_100528128 3300006931 Bacteria 1275
132 Ga0105244_10158474 3300009036 Bacteria 1082
133 Ga0105240_10032555 3300009093 Bacteria 6750
134 Ga0105240_10050651 3300009093 Bacteria 5233
135 Ga0105240_10146366 3300009093 Bacteria 2818
136 Ga0105240_10158948 3300009093 Bacteria 2686
137 Ga0105240_10356892 3300009093 Bacteria 1657
138 Ga0111539_10435561 3300009094 Bacteria 1527
139 Ga0111539_10953621 3300009094 Bacteria 997
140 Ga0111539_12245224 3300009094 Unclassified 633
141 Ga0105245_10035188 3300009098 Bacteria 4445
142 Ga0105245_10438605 3300009098 Bacteria 1312
143 Ga0105247_10766052 3300009101 Bacteria 733
144 Ga0105247_11211634 3300009101 Bacteria 602
145 Ga0114129_10281931 3300009147 Bacteria 2220
146 Ga0105243_10340774 3300009148 Bacteria 1373
147 Ga0105241_10019071 3300009174 Bacteria 5058
148 Ga0105241_10033499 3300009174 Bacteria 3856
149 Ga0105241_10102535 3300009174 Bacteria 2277
150 Ga0105241_10269414 3300009174 Bacteria 1450
151 Ga0105241_10455233 3300009174 Bacteria 1133
152 Ga0105241_10680473 3300009174 Bacteria 937
153 Ga0105241_11114745 3300009174 Bacteria 744
154 Ga0105242_10169196 3300009176 Bacteria 1919
155 Ga0105242_10828011 3300009176 Bacteria 919
156 Ga0105242_10878270 3300009176 Bacteria 895
157 Ga0105248_10140985 3300009177 Bacteria 2719
158 Ga0105248_10145379 3300009177 Bacteria 2675
159 Ga0105248_10245059 3300009177 Bacteria 2017
160 Ga0105248_10395810 3300009177 Bacteria 1555
161 Ga0105248_11049092 3300009177 Bacteria 921
162 Ga0105248_11759136 3300009177 Bacteria 703
163 Ga0105248_11770371 3300009177 Unclassified 700
164 Ga0105237_10120724 3300009545 Bacteria 2615
165 Ga0105237_10322306 3300009545 Bacteria 1549
166 Ga0105237_10355666 3300009545 Bacteria 1469
167 Ga0105237_10950360 3300009545 Bacteria 866
168 Ga0105237_11426848 3300009545 Bacteria 699
169 Ga0105237_11478090 3300009545 Unclassified 686
170 Ga0105237_12740522 3300009545 Bacteria 504
171 Ga0105238_10010551 3300009551 Bacteria 9278
172 Ga0105238_10182410 3300009551 Bacteria 2076
173 Ga0105238_10246915 3300009551 Bacteria 1763
174 Ga0105238_10553536 3300009551 Bacteria 1155
175 Ga0105238_11411165 3300009551 Unclassified 724
176 Ga0105238_12859825 3300009551 Unclassified 519
177 Ga0105249_10127289 3300009553 Bacteria 2427
178 Ga0105249_10898846 3300009553 Unclassified 952
179 Ga0105239_10018959 3300010375 Bacteria 7604
180 Ga0105239_10353252 3300010375 Bacteria 1660
181 Ga0105239_12116984 3300010375 Unclassified 654
182 Ga0105239_12424120 3300010375 Bacteria 611
183 Ga0105239_13625040 3300010375 Bacteria 502
184 Ga0105246_10059101 3300011119 Bacteria 2658
185 Ga0105246_10179461 3300011119 Bacteria 1629
186 Ga0105246_12099341 3300011119 Unclassified 547
187 Ga0157373_10151724 3300013100 Bacteria 1630
188 Ga0157373_10318742 3300013100 Bacteria 1106
189 Ga0157373_10444366 3300013100 Bacteria 933
190 Ga0157373_10539172 3300013100 Bacteria 845
191 Ga0157373_10581839 3300013100 Bacteria 814
192 Ga0157371_11641652 3300013102 Unclassified 504
193 Ga0157370_10006622 3300013104 Bacteria 12731
194 Ga0157370_10008076 3300013104 Bacteria 11391
195 Ga0157370_10192208 3300013104 Bacteria 1895
196 Ga0157369_10004351 3300013105 Bacteria 16713
197 Ga0157369_10008438 3300013105 Bacteria 11818
198 Ga0157369_10069033 3300013105 Bacteria 3797
199 Ga0157369_10073830 3300013105 Bacteria 3659
200 Ga0157369_10099938 3300013105 Bacteria 3092
201 Ga0157369_10512462 3300013105 Bacteria 1241
202 Ga0157369_10934338 3300013105 Bacteria 889
203 Ga0157374_10285686 3300013296 Bacteria 1629
204 Ga0157374_11234446 3300013296 Unclassified 769
205 Ga0157374_12227279 3300013296 Unclassified 575
206 Ga0157374_12722134 3300013296 Bacteria 522
207 Ga0157378_10162304 3300013297 Bacteria 2090
208 Ga0157378_10511865 3300013297 Bacteria 1201
209 Ga0163162_11160875 3300013306 Bacteria 876
210 Ga0163162_11604353 3300013306 Bacteria 742
211 Ga0163162_12271444 3300013306 Unclassified 623
212 Ga0163162_12325036 3300013306 Unclassified 616
213 Ga0157372_10000424 3300013307 Bacteria 46469
214 Ga0157372_10092295 3300013307 Bacteria 3444
215 Ga0157372_10124099 3300013307 Bacteria 2968
216 Ga0157372_10136299 3300013307 Bacteria 2827
217 Ga0157372_10492494 3300013307 Bacteria 1429
218 Ga0157372_10552252 3300013307 Bacteria 1343
219 Ga0157372_10848801 3300013307 Bacteria 1060
220 Ga0157375_10165732 3300013308 Bacteria 2354
221 Ga0157375_11245580 3300013308 Bacteria 873
222 Ga0157375_11551984 3300013308 Bacteria 782
223 Ga0163163_10093659 3300014325 Bacteria 3021
224 Ga0163163_10142252 3300014325 Bacteria 2441
225 Ga0163163_11321162 3300014325 Bacteria 783
226 Ga0163163_11729153 3300014325 Unclassified 686
227 Ga0182008_10061089 3300014497 Bacteria 1857
228 Ga0157376_10913440 3300014969 Unclassified 897
229 Ga0163161_10407674 3300017792 Bacteria 1091
230 Ga0197907_10629253 3300020069 Bacteria 691
231 Ga0197907_11426004 3300020069 Bacteria 1347
232 Ga0197907_11511092 3300020069 Unclassified 718
233 Ga0206352_10081231 3300020078 Bacteria 979
234 Ga0206352_10629975 3300020078 Bacteria 1125
235 Ga0206350_10722182 3300020080 Bacteria 869
236 Ga0206354_10031333 3300020081 Unclassified 544
237 Ga0213873_10148009 3300021358 Unclassified 705
238 Ga0213876_10445947 3300021384 Unclassified 688
239 Ga0224712_10203988 3300022467 Bacteria 899
240 Ga0207656_10021069 3300025321 Bacteria 2599
241 Ga0207656_10136248 3300025321 Bacteria 1154
242 Ga0207642_10077223 3300025899 Unclassified 1606
243 Ga0207710_10154007 3300025900 Bacteria 1116
244 Ga0207680_11265087 3300025903 Unclassified 525
245 Ga0207647_10510618 3300025904 Unclassified 669
246 Ga0207685_10592033 3300025905 Bacteria 594
247 Ga0207699_10115363 3300025906 Bacteria 1728
248 Ga0207699_10701868 3300025906 Bacteria 741
249 Ga0207645_10500873 3300025907 Bacteria 822
250 Ga0207645_10735376 3300025907 Bacteria 671
251 Ga0207705_10110797 3300025909 Bacteria 2028
252 Ga0207705_10247022 3300025909 Bacteria 1360
253 Ga0207705_10532240 3300025909 Bacteria 913
254 Ga0207654_10001818 3300025911 Bacteria 11074
255 Ga0207654_10016146 3300025911 Bacteria 3884
256 Ga0207654_10023979 3300025911 Bacteria 3275
257 Ga0207654_10314553 3300025911 Bacteria 1069
258 Ga0207654_10989430 3300025911 Bacteria 611
259 Ga0207707_10560064 3300025912 Bacteria 970
260 Ga0207695_10000379 3300025913 Bacteria 101331
261 Ga0207695_10003215 3300025913 Bacteria 23264
262 Ga0207695_10113892 3300025913 Bacteria 2680
263 Ga0207695_10274140 3300025913 Bacteria 1582
264 Ga0207671_10000503 3300025914 Bacteria 53115
265 Ga0207671_10186363 3300025914 Bacteria 1617
266 Ga0207671_10633766 3300025914 Bacteria 851
267 Ga0207671_10776696 3300025914 Bacteria 760
268 Ga0207671_11338872 3300025914 Unclassified 557
269 Ga0207663_10042911 3300025916 Bacteria 2766
270 Ga0207663_10389117 3300025916 Bacteria 1064
271 Ga0207663_11166765 3300025916 Unclassified 620
272 Ga0207660_10009654 3300025917 Bacteria 6246
273 Ga0207662_10949465 3300025918 Unclassified 610
274 Ga0207657_10171546 3300025919 Bacteria 1757
275 Ga0207657_10494097 3300025919 Bacteria 959
276 Ga0207657_10641450 3300025919 Bacteria 827
277 Ga0207649_10007836 3300025920 Bacteria 5812
278 Ga0207649_10168565 3300025920 Bacteria 1523
279 Ga0207652_10176277 3300025921 Bacteria 1920
280 Ga0207652_11308553 3300025921 Bacteria 627
281 Ga0207694_10001290 3300025924 Bacteria 21610
282 Ga0207694_10126612 3300025924 Bacteria 2044
283 Ga0207694_10205170 3300025924 Bacteria 1605
284 Ga0207687_10005635 3300025927 Bacteria 8282
285 Ga0207687_10178613 3300025927 Bacteria 1643
286 Ga0207700_10163874 3300025928 Bacteria 1848
287 Ga0207700_11637077 3300025928 Bacteria 569
288 Ga0207700_11637542 3300025928 Unclassified 569
289 Ga0207664_10132452 3300025929 Bacteria 2100
290 Ga0207664_10132724 3300025929 Bacteria 2098
291 Ga0207644_10159342 3300025931 Bacteria 1753
292 Ga0207690_10128235 3300025932 Bacteria 1853
293 Ga0207690_10539238 3300025932 Bacteria 947
294 Ga0207686_10514957 3300025934 Bacteria 930
295 Ga0207686_10942265 3300025934 Bacteria 698
296 Ga0207709_10350679 3300025935 Bacteria 1114
297 Ga0207670_10189237 3300025936 Bacteria 1556
298 Ga0207670_11308966 3300025936 Bacteria 614
299 Ga0207670_11443091 3300025936 Unclassified 585
300 Ga0207669_10439020 3300025937 Bacteria 1032
301 Ga0207704_10063299 3300025938 Bacteria 2305
302 Ga0207704_10446793 3300025938 Bacteria 1031
303 Ga0207704_11369377 3300025938 Unclassified 606
304 Ga0207691_11502131 3300025940 Unclassified 551
305 Ga0207711_10049984 3300025941 Bacteria 3580
306 Ga0207711_10100024 3300025941 Bacteria 2564
307 Ga0207711_10341013 3300025941 Bacteria 1387
308 Ga0207711_10432313 3300025941 Bacteria 1225
309 Ga0207711_10520705 3300025941 Bacteria 1109
310 Ga0207711_11283789 3300025941 Unclassified 674
311 Ga0207661_10204260 3300025944 Bacteria 1738
312 Ga0207661_10342388 3300025944 Bacteria 1347
313 Ga0207679_10131379 3300025945 Bacteria 2009
314 Ga0207679_10183582 3300025945 Bacteria 1733
315 Ga0207679_11081303 3300025945 Bacteria 736
316 Ga0207679_11640738 3300025945 Bacteria 589
317 Ga0207667_10006951 3300025949 Bacteria 13678
318 Ga0207667_10008805 3300025949 Bacteria 11950
319 Ga0207667_10044956 3300025949 Bacteria 4678
320 Ga0207667_10075240 3300025949 Bacteria 3507
321 Ga0207667_10158603 3300025949 Bacteria 2328
322 Ga0207667_10258025 3300025949 Bacteria 1783
323 Ga0207667_10516793 3300025949 Bacteria 1210
324 Ga0207667_11855631 3300025949 Unclassified 566
325 Ga0207651_10072464 3300025960 Bacteria 2446
326 Ga0207651_10438639 3300025960 Bacteria 1118
327 Ga0207640_10592570 3300025981 Bacteria 937
328 Ga0207640_10759592 3300025981 Bacteria 837
329 Ga0207640_11240273 3300025981 Unclassified 664
330 Ga0207658_11900063 3300025986 Unclassified 542
331 Ga0207677_10522312 3300026023 Bacteria 1030
332 Ga0207703_10121825 3300026035 Bacteria 2240
333 Ga0207703_10293427 3300026035 Bacteria 1481
334 Ga0207703_10344238 3300026035 Bacteria 1371
335 Ga0207639_10000868 3300026041 Bacteria 20542
336 Ga0207639_10241593 3300026041 Bacteria 1570
337 Ga0207639_10528640 3300026041 Bacteria 1081
338 Ga0207708_11809269 3300026075 Bacteria 536
339 Ga0207702_10001589 3300026078 Bacteria 22475
340 Ga0207702_10073915 3300026078 Bacteria 2940
341 Ga0207702_10244880 3300026078 Bacteria 1681
342 Ga0207702_12041154 3300026078 Bacteria 563
343 Ga0207641_10912562 3300026088 Bacteria 873
344 Ga0207648_10111966 3300026089 Bacteria 2396
345 Ga0207648_10165067 3300026089 Bacteria 1957
346 Ga0207676_10162211 3300026095 Bacteria 1938
347 Ga0207676_10710020 3300026095 Bacteria 975
348 Ga0207676_12352181 3300026095 Unclassified 530
349 Ga0207676_12543447 3300026095 Bacteria 508
350 Ga0207674_10097677 3300026116 Bacteria 2921
351 Ga0207674_10125804 3300026116 Bacteria 2529
352 Ga0207675_100467402 3300026118 Bacteria 1252
353 Ga0207683_10438507 3300026121 Bacteria 1204
354 Ga0207698_10000039 3300026142 Bacteria 101073
355 Ga0207698_10000059 3300026142 Bacteria 76632
356 Ga0207698_10069757 3300026142 Bacteria 2781
357 Ga0207698_10085167 3300026142 Bacteria 2565
358 Ga0207698_11854078 3300026142 Bacteria 618
359 Ga0268266_11265523 3300028379 Unclassified 713
360 Ga0268264_10567935 3300028381 Unclassified 1115
361 Ga0268264_10943841 3300028381 Bacteria 867
362 Ga0265336_10066187 3300028666 Unclassified 1081
363 Ga0265338_10026446 3300028800 Bacteria 5851
364 Ga0265324_10005069 3300029957 Bacteria 5768
365 Ga0265770_1067326 3300030878 Bacteria 677
366 Ga0265760_10165140 3300031090 Bacteria 733
367 Ga0265332_10024511 3300031238 Bacteria 2654
368 Ga0265328_10127802 3300031239 Bacteria 950
369 Ga0265320_10009193 3300031240 Bacteria 5978
370 Ga0265325_10023327 3300031241 Bacteria 3379
371 Ga0265325_10217872 3300031241 Bacteria 874
372 Ga0265329_10025218 3300031242 Bacteria 1969
373 Ga0265340_10019656 3300031247 Bacteria 3477
374 Ga0265339_10024306 3300031249 Bacteria 3493
375 Ga0265331_10001121 3300031250 Bacteria 20536
376 Ga0265331_10059193 3300031250 Bacteria 1812
377 Ga0265331_10323112 3300031250 Bacteria 691
378 Ga0265316_10045658 3300031344 Bacteria 3476
379 Ga0265316_10088121 3300031344 Bacteria 2370
380 Ga0265316_10264301 3300031344 Bacteria 1261
381 Ga0265316_10327281 3300031344 Bacteria 1112
382 Ga0265316_10348099 3300031344 Bacteria 1073
383 Ga0265316_10393610 3300031344 Unclassified 998
384 Ga0265316_10949812 3300031344 Unclassified 599
385 Ga0265314_10037033 3300031711 Bacteria 3538
386 Ga0265314_10183632 3300031711 Bacteria 1251
387 Ga0265342_10193629 3300031712 Bacteria 1108
388 Ga0265342_10336475 3300031712 Bacteria 788
389 Ga0307412_11766458 3300031911 Bacteria 568
390 Ga0307416_102604910 3300032002 Unclassified 603
391 Ga0316053_107793 3300032120 Unclassified 715
392 Ga0316583_10238438 3300032133 Bacteria 630
393 Ga0373953_0039547 3300035117 Bacteria 1869
394 Ga0373954_0004404 3300035118 Bacteria 6055
395 Ga0373954_0032814 3300035118 Bacteria 2401
396 Ga0373957_0348173 3300035120 Unclassified 632
397 Ga0373946_0256260 3300035171 Unclassified 855
398 Ga0373955_0034008 3300035172 Bacteria 2688
399 Ga0373955_0102378 3300035172 Bacteria 1646
400 Ga0373927_0063287 3300035695 Bacteria 2393
401 Ga0373933_0107041 3300035724 Bacteria 1740
402 Ga0373933_0323120 3300035724 Unclassified 1001
403 Ga0373933_0498201 3300035724 Bacteria 798
404 Ga0373947_0681495 3300035725 Bacteria 701
405 Ga0373937_0018076 3300036401 Bacteria 6288
406 Ga0373937_0390865 3300036401 Bacteria 1319
407 Ga0373937_0868369 3300036401 Bacteria 851
408 Ga0265778_002900 3300036457 Bacteria 1697
409 Ga0265778_011645 3300036457 Bacteria 1016
410 Ga0373925_0100983 3300037068 Bacteria 2218
411 Ga0373925_0652358 3300037068 Unclassified 867
412 Ga0373925_0795072 3300037068 Bacteria 780
413 Ga0373925_1042202 3300037068 Bacteria 673
414 Ga0395900_0566214 3300037418 Bacteria 1079
415 Ga0395898_0117406 3300037466 Bacteria 2549
416 Ga0436364_1078028 3300037853 Unclassified 547
417 Ga0436365_0408821 3300039437 Bacteria 1282
418 Ga0436365_1191518 3300039437 Bacteria 3046
419 Ga0436360_0261959 3300039438 Bacteria 1358
420 Ga0436363_0439753 3300039450 Bacteria 1118
421 Ga0436363_1703451 3300039450 Unclassified 533
422 Ga0436362_0001488 3300039453 Bacteria 1332
423 Ga0451577_0173522 3300042876 Bacteria 1943
424 Ga0451577_1684531 3300042876 Bacteria 558
425 Ga0453683_1042374 3300044673 Bacteria 544
426 Ga0453683_1223051 3300044673 Unclassified 503
427 Ga0466966_0565567 3300044684 Bacteria 684
428 Ga0466963_0003181 3300044694 Bacteria 9324
429 Ga0453684_0195532 3300044712 Bacteria 2362
430 Ga0453684_1049584 3300044712 Bacteria 864
431 Ga0466971_0174310 3300044719 Bacteria 1010
432 Ga0466971_0203686 3300044719 Bacteria 934
433 Ga0466957_0476619 3300044842 Bacteria 863
434 Ga0466959_0680363 3300045049 Bacteria 690
435 Ga0466958_0456218 3300045836 Bacteria 828
436 Ga0466967_0048703 3300045976 Bacteria 3702
437 Ga0466967_0220020 3300045976 Bacteria 1804
438 Ga0466967_0652124 3300045976 Bacteria 1041
439 Ga0466967_1113497 3300045976 Bacteria 787
440 Ga0495653_0843228 3300046463 Bacteria 549
441 Ga0495580_0069834 3300046472 Bacteria 2454
442 Ga0495580_0552097 3300046472 Bacteria 765
443 Ga0495580_0562032 3300046472 Unclassified 757
444 Ga0495664_0577150 3300046477 Bacteria 669
445 Ga0495608_0352040 3300046511 Bacteria 906
446 Ga0495628_0489551 3300046516 Bacteria 889
447 Ga0495652_0147554 3300046529 Bacteria 1842
448 Ga0495640_0846172 3300046533 Unclassified 544
449 Ga0495667_0560841 3300046559 Unclassified 713
450 Ga0495623_0229833 3300046679 Bacteria 1053
451 Ga0495669_0416619 3300046684 Unclassified 651
452 Ga0495600_0404426 3300046809 Bacteria 849
453 Ga0495581_0120249 3300047315 Bacteria 1528
454 Ga0495604_0302389 3300047317 Bacteria 1074
455 Ga0495674_0147668 3300047319 Bacteria 1973
456 Ga0495674_1223168 3300047319 Bacteria 567
457 Ga0495680_0871283 3300047322 Unclassified 584
458 Ga0495675_0039213 3300047444 Bacteria 3017
459 Ga0495684_0089557 3300047471 Bacteria 2331
460 Ga0495684_0152542 3300047471 Bacteria 1727
461 Ga0495684_0969131 3300047471 Unclassified 543
462 Ga0495602_0307814 3300048088 Bacteria 1157
463 Ga0496102_0341167 3300048905 Bacteria 1411
464 Ga0496104_1484708 3300048907 Bacteria 581
465 Ga0496106_0942327 3300048909 Bacteria 681
466 Ga0501070_0020844 3300049586 Bacteria 5499
467 Ga0501072_0941625 3300049588 Bacteria 674
468 nmdc:mga05p37_1553080_c1 3300050507 Unclassified 655
469 nmdc:mga09592_1166991_c1 3300050508 Unclassified 638
470 nmdc:mga0qj67_1304805_c1 3300050509 Unclassified 562
471 nmdc:mga0qj67_132733_c1 3300050509 Bacteria 2017
472 nmdc:mga06r32_10773_c1 3300050510 Bacteria 8236
473 nmdc:mga08y16_1620439_c1 3300050511 Bacteria 604
474 nmdc:mga08y16_571405_c1 3300050511 Bacteria 1142
475 nmdc:mga08y16_847088_c1 3300050511 Bacteria 904
476 Ga0495595_0118603 3300053084 Bacteria 1288
477 Ga0495619_0318175 3300053085 Bacteria 1077
478 Ga0495619_0960435 3300053085 Unclassified 573
479 Ga0587086_020241 3300059507 Bacteria 902
480 Ga0587075_012377 3300059644 Bacteria 1158
481 Ga0587114_122396 3300059655 Unclassified 528
482 Ga0070690_100790774
483 Ga0058863_11773782
484 Ga0070658_10034348
485 Ga0070658_10087950
486 Ga0070683_100011876
487 Ga0070683_100127827
488 Ga0070683_100140694
489 Ga0070690_100355530
490 Ga0070690_101045586
491 Ga0070670_101280382
492 Ga0068869_100032062
493 Ga0070666_10335211
494 Ga0070666_10611444
495 Ga0070680_100003385
496 Ga0070680_101971883
497 Ga0070682_100229280
498 Ga0070682_101890528
499 Ga0068868_100732432
500 Ga0068868_100740222
501 Ga0070660_100603597
502 Ga0070660_100828818
503 Ga0070689_100145757
504 Ga0070689_101993010
505 Ga0070661_100095351
506 Ga0070661_100171910
507 Ga0070692_10429462
508 Ga0070673_100224680
509 Ga0070659_100040328
510 Ga0070659_100461056
511 Ga0070667_100112886
512 Ga0070667_101990900
513 Ga0070709_10601432
514 Ga0070709_11420961
515 Ga0070714_100226935
516 Ga0070714_100242744
517 Ga0070713_100319766
518 Ga0070713_101714319
519 Ga0070711_100248899
520 Ga0070711_100467606
521 Ga0070711_101282670
522 Ga0070663_101937936
523 Ga0070678_100909430
524 Ga0070678_101130244
525 Ga0070662_100110487
526 Ga0070681_10279937
527 Ga0070681_11312271
528 Ga0068867_100164843
529 Ga0068867_100511163
530 Ga0068867_100798068
531 Ga0070685_11487597
532 Ga0070679_100306968
533 Ga0070679_100796808
534 Ga0070684_100043376
535 Ga0070684_100084550
536 Ga0070684_100382373
537 Ga0070684_100910473
538 Ga0070684_101296137
539 Ga0068853_100133809
540 Ga0068853_100849546
541 Ga0068853_101023187
542 Ga0070672_100454817
543 Ga0070672_100603484
544 Ga0070686_100378425
545 Ga0070696_100637017
546 Ga0070696_101785997
547 Ga0070665_100019426
548 Ga0070665_100193238
549 Ga0070665_100489396
550 Ga0068855_100019267
551 Ga0068855_100067695
552 Ga0068855_100099913
553 Ga0068855_100135549
554 Ga0068855_100274061
555 Ga0068855_100336135
556 Ga0068855_101494025
557 Ga0070664_100221341
558 Ga0070664_100408912
559 Ga0070664_101985845
560 Ga0070664_102370850
561 Ga0068857_100373758
562 Ga0068857_102349277
563 Ga0068854_100081038
564 Ga0068854_100448867
565 Ga0068854_101230312
566 Ga0068856_100018870
567 Ga0068856_100074498
568 Ga0068856_100173262
569 Ga0068856_100583850
570 Ga0068856_102005051
571 Ga0070702_100140027
572 Ga0068852_100024674
573 Ga0068852_100054705
574 Ga0068852_100520927
575 Ga0068852_100559762
576 Ga0068852_101066371
577 Ga0068852_101595218
578 Ga0068852_102197503
579 Ga0068859_100528142
580 Ga0068864_101664988
581 Ga0068866_10105529
582 Ga0068866_11119813
583 Ga0068866_11326093
584 Ga0068861_101882474
585 Ga0068851_10018984
586 Ga0068851_10197446
587 Ga0068863_100294776
588 Ga0068863_100752387
589 Ga0068863_101103759
590 Ga0068858_100065255
591 Ga0068858_100107555
592 Ga0068858_100518938
593 Ga0068860_100377752
594 Ga0068860_100615283
595 Ga0070717_10008895
596 Ga0070717_10415563
597 Ga0070715_11004026
598 Ga0097621_100084015
599 Ga0097621_100400621
600 Ga0097621_101347968
601 Ga0068871_100321617
602 Ga0068871_100443827
603 Ga0068871_100587733
604 Ga0075430_100062426
605 Ga0075430_101565249
606 Ga0075431_100269551
607 Ga0075429_100843529
608 Ga0075429_101284120
609 Ga0068865_100083824
610 Ga0068865_100444614
611 Ga0068865_101229805
612 Ga0097620_100528128
613 Ga0105244_10158474
614 Ga0105240_10032555
615 Ga0105240_10050651
616 Ga0105240_10146366
617 Ga0105240_10158948
618 Ga0105240_10356892
619 Ga0111539_10435561
620 Ga0111539_10953621
621 Ga0111539_12245224
622 Ga0105245_10035188
623 Ga0105245_10438605
624 Ga0105247_10766052
625 Ga0105247_11211634
626 Ga0114129_10281931
627 Ga0105243_10340774
628 Ga0105241_10019071
629 Ga0105241_10033499
630 Ga0105241_10102535
631 Ga0105241_10269414
632 Ga0105241_10455233
633 Ga0105241_10680473
634 Ga0105241_11114745
635 Ga0105242_10169196
636 Ga0105242_10828011
637 Ga0105242_10878270
638 Ga0105248_10140985
639 Ga0105248_10145379
640 Ga0105248_10245059
641 Ga0105248_10395810
642 Ga0105248_11049092
643 Ga0105248_11759136
644 Ga0105248_11770371
645 Ga0105237_10120724
646 Ga0105237_10322306
647 Ga0105237_10355666
648 Ga0105237_10950360
649 Ga0105237_11426848
650 Ga0105237_11478090
651 Ga0105237_12740522
652 Ga0105238_10010551
653 Ga0105238_10182410
654 Ga0105238_10246915
655 Ga0105238_10553536
656 Ga0105238_11411165
657 Ga0105238_12859825
658 Ga0105249_10127289
659 Ga0105249_10898846
660 Ga0105239_10018959
661 Ga0105239_10353252
662 Ga0105239_12116984
663 Ga0105239_12424120
664 Ga0105239_13625040
665 Ga0105246_10059101
666 Ga0105246_10179461
667 Ga0105246_12099341
668 Ga0157373_10151724
669 Ga0157373_10318742
670 Ga0157373_10444366
671 Ga0157373_10539172
672 Ga0157373_10581839
673 Ga0157371_11641652
674 Ga0157370_10006622
675 Ga0157370_10008076
676 Ga0157370_10192208
677 Ga0157369_10004351
678 Ga0157369_10008438
679 Ga0157369_10069033
680 Ga0157369_10073830
681 Ga0157369_10099938
682 Ga0157369_10512462
683 Ga0157369_10934338
684 Ga0157374_10285686
685 Ga0157374_11234446
686 Ga0157374_12227279
687 Ga0157374_12722134
688 Ga0157378_10162304
689 Ga0157378_10511865
690 Ga0163162_11160875
691 Ga0163162_11604353
692 Ga0163162_12271444
693 Ga0163162_12325036
694 Ga0157372_10000424
695 Ga0157372_10092295
696 Ga0157372_10124099
697 Ga0157372_10136299
698 Ga0157372_10492494
699 Ga0157372_10552252
700 Ga0157372_10848801
701 Ga0157375_10165732
702 Ga0157375_11245580
703 Ga0157375_11551984
704 Ga0163163_10093659
705 Ga0163163_10142252
706 Ga0163163_11321162
707 Ga0163163_11729153
708 Ga0182008_10061089
709 Ga0157376_10913440
710 Ga0163161_10407674
711 Ga0197907_10629253
712 Ga0197907_11426004
713 Ga0197907_11511092
714 Ga0206352_10081231
715 Ga0206352_10629975
716 Ga0206350_10722182
717 Ga0206354_10031333
718 Ga0213873_10148009
719 Ga0213876_10445947
720 Ga0224712_10203988
721 Ga0207656_10021069
722 Ga0207656_10136248
723 Ga0207642_10077223
724 Ga0207710_10154007
725 Ga0207680_11265087
726 Ga0207647_10510618
727 Ga0207685_10592033
728 Ga0207699_10115363
729 Ga0207699_10701868
730 Ga0207645_10500873
731 Ga0207645_10735376
732 Ga0207705_10110797
733 Ga0207705_10247022
734 Ga0207705_10532240
735 Ga0207654_10001818
736 Ga0207654_10016146
737 Ga0207654_10023979
738 Ga0207654_10314553
739 Ga0207654_10989430
740 Ga0207707_10560064
741 Ga0207695_10000379
742 Ga0207695_10003215
743 Ga0207695_10113892
744 Ga0207695_10274140
745 Ga0207671_10000503
746 Ga0207671_10186363
747 Ga0207671_10633766
748 Ga0207671_10776696
749 Ga0207671_11338872
750 Ga0207663_10042911
751 Ga0207663_10389117
752 Ga0207663_11166765
753 Ga0207660_10009654
754 Ga0207662_10949465
755 Ga0207657_10171546
756 Ga0207657_10494097
757 Ga0207657_10641450
758 Ga0207649_10007836
759 Ga0207649_10168565
760 Ga0207652_10176277
761 Ga0207652_11308553
762 Ga0207694_10001290
763 Ga0207694_10126612
764 Ga0207694_10205170
765 Ga0207687_10005635
766 Ga0207687_10178613
767 Ga0207700_10163874
768 Ga0207700_11637077
769 Ga0207700_11637542
770 Ga0207664_10132452
771 Ga0207664_10132724
772 Ga0207644_10159342
773 Ga0207690_10128235
774 Ga0207690_10539238
775 Ga0207686_10514957
776 Ga0207686_10942265
777 Ga0207709_10350679
778 Ga0207670_10189237
779 Ga0207670_11308966
780 Ga0207670_11443091
781 Ga0207669_10439020
782 Ga0207704_10063299
783 Ga0207704_10446793
784 Ga0207704_11369377
785 Ga0207691_11502131
786 Ga0207711_10049984
787 Ga0207711_10100024
788 Ga0207711_10341013
789 Ga0207711_10432313
790 Ga0207711_10520705
791 Ga0207711_11283789
792 Ga0207661_10204260
793 Ga0207661_10342388
794 Ga0207679_10131379
795 Ga0207679_10183582
796 Ga0207679_11081303
797 Ga0207679_11640738
798 Ga0207667_10006951
799 Ga0207667_10008805
800 Ga0207667_10044956
801 Ga0207667_10075240
802 Ga0207667_10158603
803 Ga0207667_10258025
804 Ga0207667_10516793
805 Ga0207667_11855631
806 Ga0207651_10072464
807 Ga0207651_10438639
808 Ga0207640_10592570
809 Ga0207640_10759592
810 Ga0207640_11240273
811 Ga0207658_11900063
812 Ga0207677_10522312
813 Ga0207703_10121825
814 Ga0207703_10293427
815 Ga0207703_10344238
816 Ga0207639_10000868
817 Ga0207639_10241593
818 Ga0207639_10528640
819 Ga0207708_11809269
820 Ga0207702_10001589
821 Ga0207702_10073915
822 Ga0207702_10244880
823 Ga0207702_12041154
824 Ga0207641_10912562
825 Ga0207648_10111966
826 Ga0207648_10165067
827 Ga0207676_10162211
828 Ga0207676_10710020
829 Ga0207676_12352181
830 Ga0207676_12543447
831 Ga0207674_10097677
832 Ga0207674_10125804
833 Ga0207675_100467402
834 Ga0207683_10438507
835 Ga0207698_10000039
836 Ga0207698_10000059
837 Ga0207698_10069757
838 Ga0207698_10085167
839 Ga0207698_11854078
840 Ga0268266_11265523
841 Ga0268264_10567935
842 Ga0268264_10943841
843 Ga0265336_10066187
844 Ga0265338_10026446
845 Ga0265324_10005069
846 Ga0265770_1067326
847 Ga0265760_10165140
848 Ga0265332_10024511
849 Ga0265328_10127802
850 Ga0265320_10009193
851 Ga0265325_10023327
852 Ga0265325_10217872
853 Ga0265329_10025218
854 Ga0265340_10019656
855 Ga0265339_10024306
856 Ga0265331_10001121
857 Ga0265331_10059193
858 Ga0265331_10323112
859 Ga0265316_10045658
860 Ga0265316_10088121
861 Ga0265316_10264301
862 Ga0265316_10327281
863 Ga0265316_10348099
864 Ga0265316_10393610
865 Ga0265316_10949812
866 Ga0265314_10037033
867 Ga0265314_10183632
868 Ga0265342_10193629
869 Ga0265342_10336475
870 Ga0307412_11766458
871 Ga0307416_102604910
872 Ga0316053_107793
873 Ga0316583_10238438
874 Ga0373953_0039547
875 Ga0373954_0004404
876 Ga0373954_0032814
877 Ga0373957_0348173
878 Ga0373946_0256260
879 Ga0373955_0034008
880 Ga0373955_0102378
881 Ga0373927_0063287
882 Ga0373933_0107041
883 Ga0373933_0323120
884 Ga0373933_0498201
885 Ga0373947_0681495
886 Ga0373937_0018076
887 Ga0373937_0390865
888 Ga0373937_0868369
889 Ga0265778_002900
890 Ga0265778_011645
891 Ga0373925_0100983
892 Ga0373925_0652358
893 Ga0373925_0795072
894 Ga0373925_1042202
895 Ga0395900_0566214
896 Ga0395898_0117406
897 Ga0436364_1078028
898 Ga0436365_0408821
899 Ga0436365_1191518
900 Ga0436360_0261959
901 Ga0436363_0439753
902 Ga0436363_1703451
903 Ga0436362_0001488
904 Ga0451577_0173522
905 Ga0451577_1684531
906 Ga0453683_1042374
907 Ga0453683_1223051
908 Ga0466966_0565567
909 Ga0466963_0003181
910 Ga0453684_0195532
911 Ga0453684_1049584
912 Ga0466971_0174310
913 Ga0466971_0203686
914 Ga0466957_0476619
915 Ga0466959_0680363
916 Ga0466958_0456218
917 Ga0466967_0048703
918 Ga0466967_0220020
919 Ga0466967_0652124
920 Ga0466967_1113497
921 Ga0495653_0843228
922 Ga0495580_0069834
923 Ga0495580_0552097
924 Ga0495580_0562032
925 Ga0495664_0577150
926 Ga0495608_0352040
927 Ga0495628_0489551
928 Ga0495652_0147554
929 Ga0495640_0846172
930 Ga0495667_0560841
931 Ga0495623_0229833
932 Ga0495669_0416619
933 Ga0495600_0404426
934 Ga0495581_0120249
935 Ga0495604_0302389
936 Ga0495674_0147668
937 Ga0495674_1223168
938 Ga0495680_0871283
939 Ga0495675_0039213
940 Ga0495684_0089557
941 Ga0495684_0152542
942 Ga0495684_0969131
943 Ga0495602_0307814
944 Ga0496102_0341167
945 Ga0496104_1484708
946 Ga0496106_0942327
947 Ga0501070_0020844
948 Ga0501072_0941625
949 nmdc:mga05p37_1553080_c1
950 nmdc:mga09592_1166991_c1
951 nmdc:mga0qj67_1304805_c1
952 nmdc:mga0qj67_132733_c1
953 nmdc:mga06r32_10773_c1
954 nmdc:mga08y16_1620439_c1
955 nmdc:mga08y16_571405_c1
956 nmdc:mga08y16_847088_c1
957 Ga0495595_0118603
958 Ga0495619_0318175
959 Ga0495619_0960435
960 Ga0587086_020241
961 Ga0587075_012377
962 Ga0587114_122396

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

9

95

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v8p-assembly4.cif.gz_GR t.thermophila 60s ribosomal subunit in complex with initiation factor 6. 0.9138 1 89
6zu5-assembly1.cif.gz_LX0 structure of the paranosema locustae ribosome in complex with lso2 0.9131 3 86
6fu8-assembly1.cif.gz_C ul23 beta hairpin loop deletion of e.coli ribosome 0.9072 3 88
7r72-assembly1.cif.gz_X state e1 nucleolar 60s ribosome biogenesis intermediate - spb4 local model 0.9063 3 87
8b2l-assembly1.cif.gz_k3 cryo-em structure of the plant 80s ribosome 0.906 1 87
ID Description Score Start End Superfamily
af_D3ZFK7_36_158_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9343 1 87 3.30.70.330
4a1aR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9141 1 89 3.30.70.330
6fu8C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9072 3 88 3.30.70.330
1w2bR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.903 5 89 3.30.70.330
af_E9AG68_26_145_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.902 3 87 3.30.70.330
ID Description Score Start End GO Terms
AF-L2GX17-F1-model_v4 50S ribosomal protein L23 0.9222 3 86 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A497EJ14-F1-model_v4 Large ribosomal subunit protein uL23 0.9131 1 87 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A4W2IFM3-F1-model_v4 Large ribosomal subunit protein uL23 N-terminal domain-containing protein 0.9122 1 84 GO:0003735
GO:0006412
GO:0019843
GO:0044391
AF-A0A667HP71-F1-model_v4 Ribosomal protein L23/L25 N-terminal domain-containing protein 0.9118 1 84 GO:0003735
GO:0006412
GO:0044391
AF-A6R098-F1-model_v4 Ribosomal protein L23a 0.9104 1 88 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map