F452189

General Info

Members Datasets Scaffolds Average Seq Length
480 263 960 76

Family's Representative Sequence

Representative Sequence 3300005840|Ga0068870_10196094|Ga0068870_101960941
Length 78
Sequence MYGVLAALQVIICVVLVFLVLLHSGKDTGLSGAFGIGGAGSGPFGGGSLVERNLNRWTIGFAIAFGVNTIILLKAPWN

Samples

Sample ID Description Type Environment
1 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
107 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
159 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
185 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
186 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
187 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
188 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
191 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
192 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
220 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
221 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
222 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
223 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
231 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
260 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.21
Rhizosphere 83.33
Stem 0
Stem Tuber 0
Unclassified 7.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068870_10196094 3300005840 Bacteria 1221
2 JGI24737J22298_10140139 3300001990 Bacteria 714
3 JGI24743J22301_10027992 3300001991 Bacteria 1102
4 JGI24735J21928_10214732 3300002067 Bacteria 558
5 JGI24749J21850_1079901 3300002076 Bacteria 513
6 JGI24742J22300_10066799 3300002244 Bacteria 666
7 Ga0070676_10297876 3300005328 Bacteria 1092
8 Ga0070676_11545474 3300005328 Bacteria 512
9 Ga0070683_100130467 3300005329 Bacteria 2378
10 Ga0070683_102303491 3300005329 Bacteria 517
11 Ga0070690_100561732 3300005330 Bacteria 862
12 Ga0070670_101825823 3300005331 Bacteria 560
13 Ga0068869_100948713 3300005334 Bacteria 747
14 Ga0070682_100065802 3300005337 Bacteria 2304
15 Ga0070682_101145067 3300005337 Bacteria 654
16 Ga0070689_100354324 3300005340 Bacteria 1232
17 Ga0070689_101815977 3300005340 Bacteria 556
18 Ga0070691_11080529 3300005341 Bacteria 505
19 Ga0070687_100229917 3300005343 Bacteria 1141
20 Ga0070661_100457688 3300005344 Bacteria 1016
21 Ga0070692_10112702 3300005345 Bacteria 1506
22 Ga0070668_100564912 3300005347 Bacteria 992
23 Ga0070668_101434812 3300005347 Bacteria 630
24 Ga0070671_100863497 3300005355 Bacteria 790
25 Ga0070674_100255772 3300005356 Bacteria 1377
26 Ga0070674_100480096 3300005356 Bacteria 1031
27 Ga0070674_101647468 3300005356 Bacteria 579
28 Ga0070673_100055818 3300005364 Bacteria 3113
29 Ga0070673_100748028 3300005364 Bacteria 900
30 Ga0070688_100591843 3300005365 Bacteria 848
31 Ga0070659_101605937 3300005366 Bacteria 581
32 Ga0070667_101222157 3300005367 Bacteria 703
33 Ga0070703_10341124 3300005406 Bacteria 637
34 Ga0070709_10270770 3300005434 Bacteria 1231
35 Ga0070714_101125359 3300005435 Bacteria 765
36 Ga0070713_100279449 3300005436 Bacteria 1531
37 Ga0070710_10098894 3300005437 Bacteria 1734
38 Ga0070701_10246893 3300005438 Unclassified 1076
39 Ga0070711_100035326 3300005439 Bacteria 3341
40 Ga0070711_100051631 3300005439 Bacteria 2825
41 Ga0070711_100379462 3300005439 Bacteria 1143
42 Ga0070700_100147216 3300005441 Bacteria 1607
43 Ga0070694_101109374 3300005444 Bacteria 660
44 Ga0070663_100556328 3300005455 Bacteria 959
45 Ga0070678_100792869 3300005456 Bacteria 860
46 Ga0070678_100946299 3300005456 Bacteria 789
47 Ga0070662_100591302 3300005457 Bacteria 933
48 Ga0070662_101678239 3300005457 Bacteria 549
49 Ga0070681_11486375 3300005458 Unclassified 602
50 Ga0068867_100316804 3300005459 Bacteria 1291
51 Ga0068867_100987762 3300005459 Bacteria 762
52 Ga0070685_10642776 3300005466 Bacteria 768
53 Ga0070679_100598670 3300005530 Bacteria 1046
54 Ga0070679_100707996 3300005530 Bacteria 950
55 Ga0070684_100722971 3300005535 Bacteria 929
56 Ga0070684_101013016 3300005535 Bacteria 779
57 Ga0070684_101259887 3300005535 Bacteria 696
58 Ga0070697_101119616 3300005536 Bacteria 701
59 Ga0068853_100342778 3300005539 Bacteria 1389
60 Ga0070672_100906270 3300005543 Bacteria 779
61 Ga0070686_100134683 3300005544 Bacteria 1713
62 Ga0070695_101582396 3300005545 Bacteria 547
63 Ga0070696_102027163 3300005546 Bacteria 500
64 Ga0070693_100325815 3300005547 Bacteria 1044
65 Ga0070693_100683238 3300005547 Bacteria 750
66 Ga0070693_101572988 3300005547 Bacteria 516
67 Ga0070704_100321009 3300005549 Bacteria 1297
68 Ga0070704_100696102 3300005549 Bacteria 901
69 Ga0070704_101500995 3300005549 Bacteria 620
70 Ga0070664_100091833 3300005564 Bacteria 2628
71 Ga0070664_100230327 3300005564 Bacteria 1661
72 Ga0068857_100556368 3300005577 Bacteria 1081
73 Ga0068857_101047168 3300005577 Bacteria 786
74 Ga0068854_100671531 3300005578 Bacteria 891
75 Ga0068854_100774782 3300005578 Bacteria 834
76 Ga0068854_101523104 3300005578 Bacteria 608
77 Ga0068854_101693273 3300005578 Bacteria 578
78 Ga0068856_100130977 3300005614 Bacteria 2512
79 Ga0068856_100390133 3300005614 Bacteria 1412
80 Ga0070702_100117823 3300005615 Bacteria 1657
81 Ga0070702_100917665 3300005615 Bacteria 687
82 Ga0070702_100993983 3300005615 Bacteria 664
83 Ga0068852_100034734 3300005616 Bacteria 4198
84 Ga0068859_100099237 3300005617 Bacteria 2967
85 Ga0068864_100200828 3300005618 Bacteria 1831
86 Ga0068864_100363039 3300005618 Bacteria 1369
87 Ga0068866_10239375 3300005718 Bacteria 1104
88 Ga0068861_100079034 3300005719 Bacteria 2571
89 Ga0068861_100400009 3300005719 Bacteria 1218
90 Ga0068861_100654363 3300005719 Unclassified 971
91 Ga0068861_101113247 3300005719 Bacteria 759
92 Ga0068863_101624839 3300005841 Bacteria 656
93 Ga0068858_101232885 3300005842 Bacteria 735
94 Ga0068860_100300465 3300005843 Bacteria 1572
95 Ga0068862_100329047 3300005844 Bacteria 1412
96 Ga0081455_10498824 3300005937 Bacteria 818
97 Ga0081540_1001988 3300005983 Bacteria 17057
98 Ga0081540_1070284 3300005983 Bacteria 1622
99 Ga0070717_11708115 3300006028 Bacteria 570
100 Ga0075432_10115550 3300006058 Bacteria 1004
101 Ga0070715_10244411 3300006163 Bacteria 935
102 Ga0070715_10895677 3300006163 Bacteria 546
103 Ga0070712_100019193 3300006175 Bacteria 4455
104 Ga0070712_100046527 3300006175 Bacteria 2999
105 Ga0070712_100055270 3300006175 Bacteria 2779
106 Ga0097621_100456544 3300006237 Bacteria 1152
107 Ga0068871_100140018 3300006358 Bacteria 2057
108 Ga0068871_101287959 3300006358 Unclassified 687
109 Ga0075431_100135772 3300006847 Bacteria 2536
110 Ga0075431_100422804 3300006847 Bacteria 1331
111 Ga0075431_101616293 3300006847 Bacteria 606
112 Ga0075434_101710498 3300006871 Bacteria 637
113 Ga0068865_100110609 3300006881 Bacteria 2026
114 Ga0068865_100842334 3300006881 Bacteria 794
115 Ga0068865_100854201 3300006881 Unclassified 789
116 Ga0068865_101285952 3300006881 Bacteria 650
117 Ga0075436_100467411 3300006914 Bacteria 920
118 Ga0097620_100099236 3300006931 Bacteria 2967
119 Ga0075435_101598474 3300007076 Bacteria 572
120 Ga0105251_10394061 3300009011 Bacteria 636
121 Ga0105240_10012405 3300009093 Bacteria 11765
122 Ga0111539_10262576 3300009094 Bacteria 2010
123 Ga0111539_10331281 3300009094 Bacteria 1772
124 Ga0111539_12053880 3300009094 Bacteria 663
125 Ga0105245_10487298 3300009098 Bacteria 1247
126 Ga0105245_11544902 3300009098 Bacteria 715
127 Ga0105245_11792979 3300009098 Bacteria 666
128 Ga0105247_10020272 3300009101 Bacteria 3998
129 Ga0114129_12095321 3300009147 Bacteria 682
130 Ga0114129_12160747 3300009147 Bacteria 670
131 Ga0114129_12612234 3300009147 Bacteria 602
132 Ga0105243_10301640 3300009148 Bacteria 1452
133 Ga0105243_11152733 3300009148 Unclassified 786
134 Ga0105243_11258093 3300009148 Bacteria 755
135 Ga0105243_12052481 3300009148 Bacteria 607
136 Ga0105241_10496483 3300009174 Bacteria 1087
137 Ga0105241_12603760 3300009174 Bacteria 508
138 Ga0105242_11016495 3300009176 Bacteria 838
139 Ga0105242_12078654 3300009176 Bacteria 611
140 Ga0105242_13143634 3300009176 Unclassified 512
141 Ga0105248_10298008 3300009177 Bacteria 1816
142 Ga0105238_11268374 3300009551 Bacteria 762
143 Ga0105238_12938479 3300009551 Unclassified 512
144 Ga0105249_10071793 3300009553 Bacteria 3199
145 Ga0105249_11108428 3300009553 Bacteria 862
146 Ga0105249_11607765 3300009553 Unclassified 722
147 Ga0105239_10073421 3300010375 Bacteria 3761
148 Ga0105239_12062356 3300010375 Unclassified 662
149 Ga0105246_10303520 3300011119 Bacteria 1290
150 Ga0105246_10872778 3300011119 Bacteria 804
151 Ga0157342_1027770 3300012507 Bacteria 696
152 Ga0157373_10663732 3300013100 Bacteria 762
153 Ga0157371_10493392 3300013102 Bacteria 904
154 Ga0157369_12092003 3300013105 Bacteria 574
155 Ga0157378_10600118 3300013297 Bacteria 1112
156 Ga0157378_10675338 3300013297 Bacteria 1051
157 Ga0163162_10396921 3300013306 Bacteria 1512
158 Ga0163162_11106933 3300013306 Unclassified 898
159 Ga0163162_12805420 3300013306 Bacteria 561
160 Ga0157372_10287985 3300013307 Bacteria 1910
161 Ga0157372_10327474 3300013307 Bacteria 1784
162 Ga0157372_10480266 3300013307 Bacteria 1449
163 Ga0157372_10955633 3300013307 Bacteria 993
164 Ga0157372_11003096 3300013307 Bacteria 967
165 Ga0157375_11268147 3300013308 Bacteria 866
166 Ga0157375_13085850 3300013308 Unclassified 556
167 Ga0163163_10453823 3300014325 Bacteria 1342
168 Ga0163163_10477585 3300014325 Bacteria 1307
169 Ga0157380_10419671 3300014326 Bacteria 1276
170 Ga0157377_10044480 3300014745 Bacteria 2476
171 Ga0157377_10920666 3300014745 Unclassified 655
172 Ga0157377_11327864 3300014745 Bacteria 563
173 Ga0157379_10904260 3300014968 Bacteria 837
174 Ga0163161_10532388 3300017792 Bacteria 961
175 Ga0206353_10031304 3300020082 Bacteria 1082
176 Ga0206353_11535077 3300020082 Bacteria 735
177 Ga0213873_10077241 3300021358 Bacteria 927
178 Ga0213873_10100591 3300021358 Bacteria 831
179 Ga0213874_10116851 3300021377 Bacteria 902
180 Ga0213874_10235916 3300021377 Bacteria 669
181 Ga0213876_10008534 3300021384 Bacteria 5547
182 Ga0213876_10034036 3300021384 Bacteria 2686
183 Ga0213876_10159530 3300021384 Bacteria 1200
184 Ga0213876_10595486 3300021384 Bacteria 588
185 Ga0213875_10209209 3300021388 Bacteria 918
186 Ga0213875_10634976 3300021388 Bacteria 517
187 Ga0207653_10094459 3300025885 Bacteria 1051
188 Ga0207642_10013276 3300025899 Bacteria 3002
189 Ga0207688_10007710 3300025901 Bacteria 5864
190 Ga0207688_10590344 3300025901 Bacteria 699
191 Ga0207647_10035366 3300025904 Bacteria 3183
192 Ga0207699_10063290 3300025906 Bacteria 2234
193 Ga0207645_10673244 3300025907 Bacteria 703
194 Ga0207643_10027138 3300025908 Bacteria 3173
195 Ga0207654_10668097 3300025911 Bacteria 745
196 Ga0207695_10013638 3300025913 Bacteria 9678
197 Ga0207671_10106211 3300025914 Bacteria 2131
198 Ga0207693_10002269 3300025915 Bacteria 16727
199 Ga0207693_10079139 3300025915 Bacteria 2572
200 Ga0207693_10173625 3300025915 Bacteria 1696
201 Ga0207693_10256791 3300025915 Bacteria 1371
202 Ga0207693_11066496 3300025915 Bacteria 615
203 Ga0207663_10209931 3300025916 Bacteria 1410
204 Ga0207663_10398159 3300025916 Bacteria 1052
205 Ga0207663_10457682 3300025916 Bacteria 985
206 Ga0207649_10319280 3300025920 Bacteria 1141
207 Ga0207649_10500666 3300025920 Bacteria 924
208 Ga0207652_10291754 3300025921 Bacteria 1472
209 Ga0207650_10456147 3300025925 Bacteria 1064
210 Ga0207650_11671640 3300025925 Bacteria 540
211 Ga0207659_10095483 3300025926 Bacteria 2230
212 Ga0207687_10128013 3300025927 Bacteria 1910
213 Ga0207687_10925078 3300025927 Bacteria 747
214 Ga0207687_11603790 3300025927 Bacteria 558
215 Ga0207700_10090546 3300025928 Bacteria 2414
216 Ga0207700_10936231 3300025928 Bacteria 775
217 Ga0207664_10032296 3300025929 Bacteria 4010
218 Ga0207664_10579557 3300025929 Bacteria 1007
219 Ga0207644_10057920 3300025931 Bacteria 2799
220 Ga0207690_10112849 3300025932 Bacteria 1961
221 Ga0207690_10374194 3300025932 Bacteria 1131
222 Ga0207690_10642381 3300025932 Bacteria 869
223 Ga0207706_10366666 3300025933 Bacteria 1251
224 Ga0207706_10589078 3300025933 Bacteria 956
225 Ga0207706_10665980 3300025933 Bacteria 891
226 Ga0207706_11042738 3300025933 Bacteria 685
227 Ga0207706_11547416 3300025933 Unclassified 539
228 Ga0207686_11338521 3300025934 Bacteria 588
229 Ga0207709_10146031 3300025935 Bacteria 1632
230 Ga0207709_10219485 3300025935 Unclassified 1370
231 Ga0207670_10347644 3300025936 Bacteria 1173
232 Ga0207669_10295076 3300025937 Bacteria 1229
233 Ga0207669_10607226 3300025937 Bacteria 890
234 Ga0207704_11414087 3300025938 Bacteria 596
235 Ga0207691_10334644 3300025940 Bacteria 1297
236 Ga0207679_10425595 3300025945 Bacteria 1173
237 Ga0207679_11012641 3300025945 Bacteria 761
238 Ga0207651_10532716 3300025960 Bacteria 1019
239 Ga0207651_11405578 3300025960 Bacteria 628
240 Ga0207712_11752743 3300025961 Bacteria 557
241 Ga0207668_10170089 3300025972 Bacteria 1708
242 Ga0207668_10328107 3300025972 Bacteria 1272
243 Ga0207640_10698860 3300025981 Bacteria 869
244 Ga0207640_10861910 3300025981 Bacteria 789
245 Ga0207703_11217050 3300026035 Bacteria 724
246 Ga0207678_10075448 3300026067 Bacteria 2888
247 Ga0207678_10156963 3300026067 Bacteria 1943
248 Ga0207708_10006538 3300026075 Bacteria 8624
249 Ga0207702_10166417 3300026078 Bacteria 2018
250 Ga0207641_11651523 3300026088 Bacteria 643
251 Ga0207648_11982853 3300026089 Bacteria 543
252 Ga0207676_10548157 3300026095 Bacteria 1104
253 Ga0207674_10047035 3300026116 Bacteria 4426
254 Ga0207675_100058469 3300026118 Bacteria 3597
255 Ga0207675_100249665 3300026118 Bacteria 1717
256 Ga0207675_100414589 3300026118 Bacteria 1329
257 Ga0207683_10030104 3300026121 Bacteria 4702
258 Ga0207683_10319985 3300026121 Bacteria 1421
259 Ga0207698_10447935 3300026142 Bacteria 1245
260 Ga0207698_10739014 3300026142 Bacteria 982
261 Ga0207428_10162654 3300027907 Bacteria 1694
262 Ga0268266_10353813 3300028379 Bacteria 1381
263 Ga0268265_11267198 3300028380 Bacteria 736
264 Ga0268264_10374960 3300028381 Bacteria 1361
265 Ga0265322_10131931 3300028654 Bacteria 712
266 Ga0307515_10898091 3300028794 Bacteria 517
267 Ga0265338_10044213 3300028800 Bacteria 4116
268 Ga0265327_10114629 3300031251 Bacteria 1283
269 Ga0265316_10368386 3300031344 Bacteria 1038
270 Ga0307408_101021522 3300031548 Bacteria 763
271 Ga0265342_10592469 3300031712 Unclassified 560
272 Ga0307405_11154718 3300031731 Bacteria 668
273 Ga0307410_12097099 3300031852 Bacteria 505
274 Ga0307406_10075428 3300031901 Bacteria 2225
275 Ga0307407_10609600 3300031903 Bacteria 814
276 Ga0307409_101542240 3300031995 Bacteria 692
277 Ga0307409_101735901 3300031995 Unclassified 653
278 Ga0307409_102408317 3300031995 Bacteria 555
279 Ga0307416_102289371 3300032002 Bacteria 641
280 Ga0307415_101478467 3300032126 Bacteria 649
281 Ga0373953_0046801 3300035117 Bacteria 1738
282 Ga0373943_0010913 3300035170 Bacteria 4081
283 Ga0373931_0347640 3300035691 Bacteria 928
284 Ga0373933_0003365 3300035724 Bacteria 8914
285 Ga0373947_0339618 3300035725 Unclassified 1006
286 Ga0373937_0466326 3300036401 Unclassified 1199
287 Ga0373925_1002878 3300037068 Bacteria 688
288 Ga0436364_0103816 3300037853 Bacteria 712
289 Ga0436364_0146960 3300037853 Bacteria 2033
290 Ga0436364_0392484 3300037853 Bacteria 1005
291 Ga0436364_0873317 3300037853 Bacteria 764
292 Ga0436364_1008429 3300037853 Unclassified 502
293 Ga0395901_1271071 3300038443 Bacteria 699
294 Ga0395901_1500438 3300038443 Bacteria 630
295 Ga0436365_0418544 3300039437 Bacteria 5953
296 Ga0436365_0422364 3300039437 Bacteria 1505
297 Ga0436365_0754860 3300039437 Unclassified 550
298 Ga0436365_0868561 3300039437 Bacteria 8615
299 Ga0436365_1250941 3300039437 Bacteria 1615
300 Ga0436365_1265189 3300039437 Bacteria 1168
301 Ga0436365_1545633 3300039437 Bacteria 706
302 Ga0436365_1899658 3300039437 Bacteria 831
303 Ga0436360_0052374 3300039438 Bacteria 676
304 Ga0436360_1066756 3300039438 Bacteria 570
305 Ga0436363_0213040 3300039450 Bacteria 573
306 Ga0436363_0549010 3300039450 Bacteria 610
307 Ga0436363_0952216 3300039450 Bacteria 1387
308 Ga0436363_1032035 3300039450 Bacteria 630
309 Ga0436363_1135356 3300039450 Bacteria 1663
310 Ga0436363_1239826 3300039450 Bacteria 1028
311 Ga0436363_1395434 3300039450 Bacteria 5020
312 Ga0436363_1615242 3300039450 Unclassified 828
313 Ga0436363_1625394 3300039450 Bacteria 504
314 Ga0436362_0297625 3300039453 Bacteria 624
315 Ga0436362_0311837 3300039453 Bacteria 760
316 Ga0436362_0438606 3300039453 Bacteria 874
317 Ga0436362_1089181 3300039453 Bacteria 588
318 Ga0436362_1131964 3300039453 Bacteria 909
319 Ga0436362_1165460 3300039453 Bacteria 921
320 Ga0451802_0077522 3300041460 Bacteria 504
321 Ga0466965_0139625 3300044683 Bacteria 1261
322 Ga0466965_0433582 3300044683 Bacteria 730
323 Ga0466966_0033296 3300044684 Bacteria 3337
324 Ga0466966_0137747 3300044684 Bacteria 1492
325 Ga0466961_0172552 3300044693 Bacteria 1345
326 Ga0466961_0378409 3300044693 Bacteria 860
327 Ga0466961_0523806 3300044693 Bacteria 715
328 Ga0466961_0972487 3300044693 Bacteria 505
329 Ga0466963_0002226 3300044694 Bacteria 10745
330 Ga0466963_0003218 3300044694 Bacteria 9293
331 Ga0466963_0003564 3300044694 Bacteria 8940
332 Ga0466963_0037868 3300044694 Bacteria 3152
333 Ga0466963_0063552 3300044694 Bacteria 2471
334 Ga0466963_0214116 3300044694 Bacteria 1349
335 Ga0466963_1150628 3300044694 Bacteria 545
336 Ga0466963_1224311 3300044694 Bacteria 527
337 Ga0466964_0106256 3300044706 Unclassified 1245
338 Ga0466964_0807338 3300044706 Unclassified 531
339 Ga0466971_0081674 3300044719 Bacteria 1475
340 Ga0466971_0182006 3300044719 Bacteria 988
341 Ga0466971_0204305 3300044719 Bacteria 933
342 Ga0466968_0249150 3300044735 Bacteria 843
343 Ga0466970_0015853 3300044765 Bacteria 3880
344 Ga0466957_0023159 3300044842 Bacteria 3669
345 Ga0466957_0049032 3300044842 Bacteria 2567
346 Ga0466957_0173005 3300044842 Unclassified 1407
347 Ga0466957_0272815 3300044842 Unclassified 1130
348 Ga0466957_0455903 3300044842 Unclassified 882
349 Ga0466960_0013788 3300044901 Bacteria 3443
350 Ga0466960_0014687 3300044901 Bacteria 3360
351 Ga0466960_0960011 3300044901 Bacteria 524
352 Ga0466959_0140881 3300045049 Bacteria 1704
353 Ga0466958_0003678 3300045836 Bacteria 8003
354 Ga0466958_0008838 3300045836 Bacteria 5598
355 Ga0466958_0010653 3300045836 Bacteria 5156
356 Ga0466958_0105081 3300045836 Bacteria 1759
357 Ga0466958_0303219 3300045836 Unclassified 1026
358 Ga0466958_0388670 3300045836 Unclassified 900
359 Ga0466967_0003618 3300045976 Bacteria 10151
360 Ga0466967_0103448 3300045976 Bacteria 2606
361 Ga0466967_0235395 3300045976 Bacteria 1745
362 Ga0466967_0727561 3300045976 Bacteria 983
363 Ga0466967_1217478 3300045976 Bacteria 750
364 Ga0466967_1315180 3300045976 Bacteria 720
365 Ga0466967_2490656 3300045976 Bacteria 512
366 Ga0495592_0088274 3300046454 Bacteria 2229
367 Ga0495629_0767248 3300046459 Bacteria 637
368 Ga0495641_0225302 3300046461 Bacteria 841
369 Ga0495651_0055131 3300046462 Bacteria 3055
370 Ga0495651_0749364 3300046462 Unclassified 606
371 Ga0495653_0016674 3300046463 Bacteria 5978
372 Ga0495582_0615699 3300046473 Bacteria 628
373 Ga0495605_0484000 3300046474 Bacteria 507
374 Ga0495594_0759916 3300046499 Bacteria 547
375 Ga0495607_0407277 3300046501 Bacteria 618
376 Ga0495608_0003493 3300046511 Bacteria 11263
377 Ga0495608_0938053 3300046511 Bacteria 505
378 Ga0495618_0076258 3300046514 Bacteria 2136
379 Ga0495628_0049541 3300046516 Bacteria 3326
380 Ga0495652_0169286 3300046529 Bacteria 1688
381 Ga0495665_0342619 3300046531 Unclassified 762
382 Ga0495640_0030285 3300046533 Bacteria 3876
383 Ga0495586_0844193 3300046535 Bacteria 528
384 Ga0495587_0103061 3300046536 Bacteria 1643
385 Ga0495667_0005278 3300046559 Bacteria 8738
386 Ga0495634_0025385 3300046642 Bacteria 4147
387 Ga0495634_0088478 3300046642 Bacteria 2014
388 Ga0495635_0040665 3300046663 Bacteria 3213
389 Ga0495588_0468317 3300046674 Bacteria 661
390 Ga0495657_0005165 3300046675 Bacteria 10340
391 Ga0495657_0269424 3300046675 Bacteria 1021
392 Ga0495657_0357260 3300046675 Unclassified 864
393 Ga0495657_0617255 3300046675 Bacteria 627
394 Ga0495599_0287645 3300046678 Bacteria 994
395 Ga0495623_0063549 3300046679 Bacteria 2311
396 Ga0495646_0016185 3300046680 Bacteria 4734
397 Ga0495646_0289841 3300046680 Unclassified 868
398 Ga0495613_0394949 3300046689 Bacteria 944
399 Ga0495600_0035153 3300046809 Bacteria 3253
400 Ga0495600_0578321 3300046809 Bacteria 684
401 Ga0495581_0175729 3300047315 Bacteria 1252
402 Ga0495604_0001077 3300047317 Bacteria 22633
403 Ga0495604_0061163 3300047317 Bacteria 2881
404 Ga0495674_0055234 3300047319 Bacteria 3484
405 Ga0495674_0076306 3300047319 Bacteria 2883
406 Ga0495674_0388832 3300047319 Bacteria 1128
407 Ga0495680_0003217 3300047322 Bacteria 16231
408 Ga0495684_0506352 3300047471 Bacteria 829
409 Ga0495593_0112135 3300047673 Bacteria 1392
410 Ga0495602_0104204 3300048088 Bacteria 2321
411 Ga0495602_0972222 3300048088 Bacteria 561
412 Ga0496100_0107907 3300048903 Bacteria 1929
413 Ga0496100_0395378 3300048903 Bacteria 1052
414 Ga0496100_0590892 3300048903 Bacteria 861
415 Ga0496101_0269725 3300048904 Bacteria 1328
416 Ga0496101_0582737 3300048904 Bacteria 884
417 Ga0496101_0739820 3300048904 Bacteria 776
418 Ga0496101_0858585 3300048904 Bacteria 715
419 Ga0496102_0262650 3300048905 Bacteria 1628
420 Ga0496102_0458383 3300048905 Bacteria 1196
421 Ga0496102_0623513 3300048905 Bacteria 1001
422 Ga0496102_0955871 3300048905 Bacteria 778
423 Ga0496103_0021331 3300048906 Bacteria 3896
424 Ga0496104_0000001 3300048907 Bacteria 711867
425 Ga0496104_0045791 3300048907 Bacteria 4116
426 Ga0496104_0051441 3300048907 Bacteria 3888
427 Ga0496105_0167188 3300048908 Bacteria 1804
428 Ga0496105_0375344 3300048908 Bacteria 1132
429 Ga0496105_0603810 3300048908 Bacteria 851
430 Ga0496106_0116166 3300048909 Bacteria 2087
431 Ga0496106_0163086 3300048909 Bacteria 1763
432 Ga0496106_0298104 3300048909 Bacteria 1292
433 Ga0496106_0681876 3300048909 Bacteria 820
434 Ga0496106_1311805 3300048909 Bacteria 562
435 Ga0496106_1330227 3300048909 Bacteria 557
436 Ga0496107_0093363 3300048910 Bacteria 2200
437 Ga0496107_0475461 3300048910 Bacteria 927
438 Ga0496108_0235466 3300048911 Bacteria 1592
439 Ga0496108_0582750 3300048911 Bacteria 975
440 Ga0496109_0638563 3300048912 Bacteria 1001
441 Ga0496109_0643726 3300048912 Bacteria 997
442 Ga0496109_0821734 3300048912 Bacteria 867
443 Ga0496110_0000039 3300048913 Bacteria 63169
444 Ga0496110_0018790 3300048913 Bacteria 5803
445 Ga0496110_0114631 3300048913 Bacteria 2425
446 Ga0496110_1327769 3300048913 Bacteria 628
447 Ga0496111_0000066 3300048914 Bacteria 42994
448 Ga0496111_0705731 3300048914 Bacteria 733
449 Ga0496112_0038018 3300048915 Bacteria 4699
450 Ga0496112_0206476 3300048915 Bacteria 1922
451 Ga0496113_0042359 3300048916 Bacteria 3364
452 Ga0496113_0059097 3300048916 Bacteria 2887
453 Ga0496113_0273442 3300048916 Bacteria 1350
454 Ga0496114_0230669 3300048917 Bacteria 1626
455 Ga0496114_0495173 3300048917 Bacteria 1081
456 Ga0496114_0887700 3300048917 Bacteria 772
457 Ga0496115_0157325 3300048918 Bacteria 1877
458 Ga0496115_0215327 3300048918 Bacteria 1586
459 Ga0496115_1385691 3300048918 Bacteria 520
460 Ga0501040_1412882 3300049576 Unclassified 505
461 Ga0501046_1029117 3300049580 Bacteria 571
462 Ga0501067_0217653 3300049583 Bacteria 1063
463 Ga0501067_0855976 3300049583 Bacteria 513
464 Ga0501069_0870935 3300049585 Unclassified 547
465 Ga0501072_1022331 3300049588 Bacteria 644
466 Ga0501073_1163928 3300049589 Bacteria 530
467 nmdc:mga0qj67_569491_c1 3300050509 Bacteria 908
468 nmdc:mga08y16_153986_c1 3300050511 Bacteria 2389
469 nmdc:mga0rr50_1416670_c1 3300050513 Bacteria 588
470 nmdc:mga0rr50_181758_c1 3300050513 Bacteria 1719
471 Ga0495601_0035077 3300053077 Bacteria 3131
472 Ga0495655_0025833 3300053083 Bacteria 1378
473 Ga0495655_0144361 3300053083 Bacteria 743
474 Ga0495595_0002234 3300053084 Bacteria 7529
475 Ga0495619_0009166 3300053085 Bacteria 6250
476 Ga0495619_0715611 3300053085 Bacteria 680
477 Ga0501082_0569589 3300060353 Bacteria 991
478 Ga0466962_0088122 3300061719 Unclassified 1486
479 Ga0466962_0178407 3300061719 Bacteria 1035
480 Ga0466962_0211937 3300061719 Unclassified 948
481 Ga0068870_10196094
482 JGI24737J22298_10140139
483 JGI24743J22301_10027992
484 JGI24735J21928_10214732
485 JGI24749J21850_1079901
486 JGI24742J22300_10066799
487 Ga0070676_10297876
488 Ga0070676_11545474
489 Ga0070683_100130467
490 Ga0070683_102303491
491 Ga0070690_100561732
492 Ga0070670_101825823
493 Ga0068869_100948713
494 Ga0070682_100065802
495 Ga0070682_101145067
496 Ga0070689_100354324
497 Ga0070689_101815977
498 Ga0070691_11080529
499 Ga0070687_100229917
500 Ga0070661_100457688
501 Ga0070692_10112702
502 Ga0070668_100564912
503 Ga0070668_101434812
504 Ga0070671_100863497
505 Ga0070674_100255772
506 Ga0070674_100480096
507 Ga0070674_101647468
508 Ga0070673_100055818
509 Ga0070673_100748028
510 Ga0070688_100591843
511 Ga0070659_101605937
512 Ga0070667_101222157
513 Ga0070703_10341124
514 Ga0070709_10270770
515 Ga0070714_101125359
516 Ga0070713_100279449
517 Ga0070710_10098894
518 Ga0070701_10246893
519 Ga0070711_100035326
520 Ga0070711_100051631
521 Ga0070711_100379462
522 Ga0070700_100147216
523 Ga0070694_101109374
524 Ga0070663_100556328
525 Ga0070678_100792869
526 Ga0070678_100946299
527 Ga0070662_100591302
528 Ga0070662_101678239
529 Ga0070681_11486375
530 Ga0068867_100316804
531 Ga0068867_100987762
532 Ga0070685_10642776
533 Ga0070679_100598670
534 Ga0070679_100707996
535 Ga0070684_100722971
536 Ga0070684_101013016
537 Ga0070684_101259887
538 Ga0070697_101119616
539 Ga0068853_100342778
540 Ga0070672_100906270
541 Ga0070686_100134683
542 Ga0070695_101582396
543 Ga0070696_102027163
544 Ga0070693_100325815
545 Ga0070693_100683238
546 Ga0070693_101572988
547 Ga0070704_100321009
548 Ga0070704_100696102
549 Ga0070704_101500995
550 Ga0070664_100091833
551 Ga0070664_100230327
552 Ga0068857_100556368
553 Ga0068857_101047168
554 Ga0068854_100671531
555 Ga0068854_100774782
556 Ga0068854_101523104
557 Ga0068854_101693273
558 Ga0068856_100130977
559 Ga0068856_100390133
560 Ga0070702_100117823
561 Ga0070702_100917665
562 Ga0070702_100993983
563 Ga0068852_100034734
564 Ga0068859_100099237
565 Ga0068864_100200828
566 Ga0068864_100363039
567 Ga0068866_10239375
568 Ga0068861_100079034
569 Ga0068861_100400009
570 Ga0068861_100654363
571 Ga0068861_101113247
572 Ga0068863_101624839
573 Ga0068858_101232885
574 Ga0068860_100300465
575 Ga0068862_100329047
576 Ga0081455_10498824
577 Ga0081540_1001988
578 Ga0081540_1070284
579 Ga0070717_11708115
580 Ga0075432_10115550
581 Ga0070715_10244411
582 Ga0070715_10895677
583 Ga0070712_100019193
584 Ga0070712_100046527
585 Ga0070712_100055270
586 Ga0097621_100456544
587 Ga0068871_100140018
588 Ga0068871_101287959
589 Ga0075431_100135772
590 Ga0075431_100422804
591 Ga0075431_101616293
592 Ga0075434_101710498
593 Ga0068865_100110609
594 Ga0068865_100842334
595 Ga0068865_100854201
596 Ga0068865_101285952
597 Ga0075436_100467411
598 Ga0097620_100099236
599 Ga0075435_101598474
600 Ga0105251_10394061
601 Ga0105240_10012405
602 Ga0111539_10262576
603 Ga0111539_10331281
604 Ga0111539_12053880
605 Ga0105245_10487298
606 Ga0105245_11544902
607 Ga0105245_11792979
608 Ga0105247_10020272
609 Ga0114129_12095321
610 Ga0114129_12160747
611 Ga0114129_12612234
612 Ga0105243_10301640
613 Ga0105243_11152733
614 Ga0105243_11258093
615 Ga0105243_12052481
616 Ga0105241_10496483
617 Ga0105241_12603760
618 Ga0105242_11016495
619 Ga0105242_12078654
620 Ga0105242_13143634
621 Ga0105248_10298008
622 Ga0105238_11268374
623 Ga0105238_12938479
624 Ga0105249_10071793
625 Ga0105249_11108428
626 Ga0105249_11607765
627 Ga0105239_10073421
628 Ga0105239_12062356
629 Ga0105246_10303520
630 Ga0105246_10872778
631 Ga0157342_1027770
632 Ga0157373_10663732
633 Ga0157371_10493392
634 Ga0157369_12092003
635 Ga0157378_10600118
636 Ga0157378_10675338
637 Ga0163162_10396921
638 Ga0163162_11106933
639 Ga0163162_12805420
640 Ga0157372_10287985
641 Ga0157372_10327474
642 Ga0157372_10480266
643 Ga0157372_10955633
644 Ga0157372_11003096
645 Ga0157375_11268147
646 Ga0157375_13085850
647 Ga0163163_10453823
648 Ga0163163_10477585
649 Ga0157380_10419671
650 Ga0157377_10044480
651 Ga0157377_10920666
652 Ga0157377_11327864
653 Ga0157379_10904260
654 Ga0163161_10532388
655 Ga0206353_10031304
656 Ga0206353_11535077
657 Ga0213873_10077241
658 Ga0213873_10100591
659 Ga0213874_10116851
660 Ga0213874_10235916
661 Ga0213876_10008534
662 Ga0213876_10034036
663 Ga0213876_10159530
664 Ga0213876_10595486
665 Ga0213875_10209209
666 Ga0213875_10634976
667 Ga0207653_10094459
668 Ga0207642_10013276
669 Ga0207688_10007710
670 Ga0207688_10590344
671 Ga0207647_10035366
672 Ga0207699_10063290
673 Ga0207645_10673244
674 Ga0207643_10027138
675 Ga0207654_10668097
676 Ga0207695_10013638
677 Ga0207671_10106211
678 Ga0207693_10002269
679 Ga0207693_10079139
680 Ga0207693_10173625
681 Ga0207693_10256791
682 Ga0207693_11066496
683 Ga0207663_10209931
684 Ga0207663_10398159
685 Ga0207663_10457682
686 Ga0207649_10319280
687 Ga0207649_10500666
688 Ga0207652_10291754
689 Ga0207650_10456147
690 Ga0207650_11671640
691 Ga0207659_10095483
692 Ga0207687_10128013
693 Ga0207687_10925078
694 Ga0207687_11603790
695 Ga0207700_10090546
696 Ga0207700_10936231
697 Ga0207664_10032296
698 Ga0207664_10579557
699 Ga0207644_10057920
700 Ga0207690_10112849
701 Ga0207690_10374194
702 Ga0207690_10642381
703 Ga0207706_10366666
704 Ga0207706_10589078
705 Ga0207706_10665980
706 Ga0207706_11042738
707 Ga0207706_11547416
708 Ga0207686_11338521
709 Ga0207709_10146031
710 Ga0207709_10219485
711 Ga0207670_10347644
712 Ga0207669_10295076
713 Ga0207669_10607226
714 Ga0207704_11414087
715 Ga0207691_10334644
716 Ga0207679_10425595
717 Ga0207679_11012641
718 Ga0207651_10532716
719 Ga0207651_11405578
720 Ga0207712_11752743
721 Ga0207668_10170089
722 Ga0207668_10328107
723 Ga0207640_10698860
724 Ga0207640_10861910
725 Ga0207703_11217050
726 Ga0207678_10075448
727 Ga0207678_10156963
728 Ga0207708_10006538
729 Ga0207702_10166417
730 Ga0207641_11651523
731 Ga0207648_11982853
732 Ga0207676_10548157
733 Ga0207674_10047035
734 Ga0207675_100058469
735 Ga0207675_100249665
736 Ga0207675_100414589
737 Ga0207683_10030104
738 Ga0207683_10319985
739 Ga0207698_10447935
740 Ga0207698_10739014
741 Ga0207428_10162654
742 Ga0268266_10353813
743 Ga0268265_11267198
744 Ga0268264_10374960
745 Ga0265322_10131931
746 Ga0307515_10898091
747 Ga0265338_10044213
748 Ga0265327_10114629
749 Ga0265316_10368386
750 Ga0307408_101021522
751 Ga0265342_10592469
752 Ga0307405_11154718
753 Ga0307410_12097099
754 Ga0307406_10075428
755 Ga0307407_10609600
756 Ga0307409_101542240
757 Ga0307409_101735901
758 Ga0307409_102408317
759 Ga0307416_102289371
760 Ga0307415_101478467
761 Ga0373953_0046801
762 Ga0373943_0010913
763 Ga0373931_0347640
764 Ga0373933_0003365
765 Ga0373947_0339618
766 Ga0373937_0466326
767 Ga0373925_1002878
768 Ga0436364_0103816
769 Ga0436364_0146960
770 Ga0436364_0392484
771 Ga0436364_0873317
772 Ga0436364_1008429
773 Ga0395901_1271071
774 Ga0395901_1500438
775 Ga0436365_0418544
776 Ga0436365_0422364
777 Ga0436365_0754860
778 Ga0436365_0868561
779 Ga0436365_1250941
780 Ga0436365_1265189
781 Ga0436365_1545633
782 Ga0436365_1899658
783 Ga0436360_0052374
784 Ga0436360_1066756
785 Ga0436363_0213040
786 Ga0436363_0549010
787 Ga0436363_0952216
788 Ga0436363_1032035
789 Ga0436363_1135356
790 Ga0436363_1239826
791 Ga0436363_1395434
792 Ga0436363_1615242
793 Ga0436363_1625394
794 Ga0436362_0297625
795 Ga0436362_0311837
796 Ga0436362_0438606
797 Ga0436362_1089181
798 Ga0436362_1131964
799 Ga0436362_1165460
800 Ga0451802_0077522
801 Ga0466965_0139625
802 Ga0466965_0433582
803 Ga0466966_0033296
804 Ga0466966_0137747
805 Ga0466961_0172552
806 Ga0466961_0378409
807 Ga0466961_0523806
808 Ga0466961_0972487
809 Ga0466963_0002226
810 Ga0466963_0003218
811 Ga0466963_0003564
812 Ga0466963_0037868
813 Ga0466963_0063552
814 Ga0466963_0214116
815 Ga0466963_1150628
816 Ga0466963_1224311
817 Ga0466964_0106256
818 Ga0466964_0807338
819 Ga0466971_0081674
820 Ga0466971_0182006
821 Ga0466971_0204305
822 Ga0466968_0249150
823 Ga0466970_0015853
824 Ga0466957_0023159
825 Ga0466957_0049032
826 Ga0466957_0173005
827 Ga0466957_0272815
828 Ga0466957_0455903
829 Ga0466960_0013788
830 Ga0466960_0014687
831 Ga0466960_0960011
832 Ga0466959_0140881
833 Ga0466958_0003678
834 Ga0466958_0008838
835 Ga0466958_0010653
836 Ga0466958_0105081
837 Ga0466958_0303219
838 Ga0466958_0388670
839 Ga0466967_0003618
840 Ga0466967_0103448
841 Ga0466967_0235395
842 Ga0466967_0727561
843 Ga0466967_1217478
844 Ga0466967_1315180
845 Ga0466967_2490656
846 Ga0495592_0088274
847 Ga0495629_0767248
848 Ga0495641_0225302
849 Ga0495651_0055131
850 Ga0495651_0749364
851 Ga0495653_0016674
852 Ga0495582_0615699
853 Ga0495605_0484000
854 Ga0495594_0759916
855 Ga0495607_0407277
856 Ga0495608_0003493
857 Ga0495608_0938053
858 Ga0495618_0076258
859 Ga0495628_0049541
860 Ga0495652_0169286
861 Ga0495665_0342619
862 Ga0495640_0030285
863 Ga0495586_0844193
864 Ga0495587_0103061
865 Ga0495667_0005278
866 Ga0495634_0025385
867 Ga0495634_0088478
868 Ga0495635_0040665
869 Ga0495588_0468317
870 Ga0495657_0005165
871 Ga0495657_0269424
872 Ga0495657_0357260
873 Ga0495657_0617255
874 Ga0495599_0287645
875 Ga0495623_0063549
876 Ga0495646_0016185
877 Ga0495646_0289841
878 Ga0495613_0394949
879 Ga0495600_0035153
880 Ga0495600_0578321
881 Ga0495581_0175729
882 Ga0495604_0001077
883 Ga0495604_0061163
884 Ga0495674_0055234
885 Ga0495674_0076306
886 Ga0495674_0388832
887 Ga0495680_0003217
888 Ga0495684_0506352
889 Ga0495593_0112135
890 Ga0495602_0104204
891 Ga0495602_0972222
892 Ga0496100_0107907
893 Ga0496100_0395378
894 Ga0496100_0590892
895 Ga0496101_0269725
896 Ga0496101_0582737
897 Ga0496101_0739820
898 Ga0496101_0858585
899 Ga0496102_0262650
900 Ga0496102_0458383
901 Ga0496102_0623513
902 Ga0496102_0955871
903 Ga0496103_0021331
904 Ga0496104_0000001
905 Ga0496104_0045791
906 Ga0496104_0051441
907 Ga0496105_0167188
908 Ga0496105_0375344
909 Ga0496105_0603810
910 Ga0496106_0116166
911 Ga0496106_0163086
912 Ga0496106_0298104
913 Ga0496106_0681876
914 Ga0496106_1311805
915 Ga0496106_1330227
916 Ga0496107_0093363
917 Ga0496107_0475461
918 Ga0496108_0235466
919 Ga0496108_0582750
920 Ga0496109_0638563
921 Ga0496109_0643726
922 Ga0496109_0821734
923 Ga0496110_0000039
924 Ga0496110_0018790
925 Ga0496110_0114631
926 Ga0496110_1327769
927 Ga0496111_0000066
928 Ga0496111_0705731
929 Ga0496112_0038018
930 Ga0496112_0206476
931 Ga0496113_0042359
932 Ga0496113_0059097
933 Ga0496113_0273442
934 Ga0496114_0230669
935 Ga0496114_0495173
936 Ga0496114_0887700
937 Ga0496115_0157325
938 Ga0496115_0215327
939 Ga0496115_1385691
940 Ga0501040_1412882
941 Ga0501046_1029117
942 Ga0501067_0217653
943 Ga0501067_0855976
944 Ga0501069_0870935
945 Ga0501072_1022331
946 Ga0501073_1163928
947 nmdc:mga0qj67_569491_c1
948 nmdc:mga08y16_153986_c1
949 nmdc:mga0rr50_1416670_c1
950 nmdc:mga0rr50_181758_c1
951 Ga0495601_0035077
952 Ga0495655_0025833
953 Ga0495655_0144361
954 Ga0495595_0002234
955 Ga0495619_0009166
956 Ga0495619_0715611
957 Ga0501082_0569589
958 Ga0466962_0088122
959 Ga0466962_0178407
960 Ga0466962_0211937

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03840

SecG

Preprotein translocase SecG subunit

4

74

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ymi-assembly1.cif.gz_Z psii-pcb dimer of acaryochloris marina 0.7056 1 74
5aww-assembly1.cif.gz_G precise resting state of thermus thermophilus secyeg 0.6798 4 75
7ymi-assembly1.cif.gz_Z psii-pcb dimer of acaryochloris marina 0.6751 1 74
5nco-assembly1.cif.gz_j quaternary complex between srp, sr, and secyeg bound to the translating ribosome 0.6724 1 71
5ch4-assembly1.cif.gz_G peptide-bound state of thermus thermophilus secyeg 0.6656 1 75
ID Description Score Start End Superfamily
af_A0A1D6Q0W3_14_135_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5575 12 73 1.25.40.10
af_P25109_250_354_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.4663 6 77 1.20.58.390
af_A0A1D6Q0W3_14_135_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4487 12 73 1.25.40.10
af_P25109_250_354_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.435 6 77 1.20.58.390
af_A0A0R0IAE0_44_263_1.25.40.20 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Ankyrin repeat-containing domain 0.3708 6 76 1.25.40.20
ID Description Score Start End GO Terms
AF-A0A7W0A6E5-F1-model_v4 Protein-export membrane protein SecG 0.8602 1 73 GO:0005886
GO:0009306
GO:0015450
AF-A0A7W0A6E5-F1-model_v4 Protein-export membrane protein SecG 0.8396 1 73 GO:0005886
GO:0009306
GO:0015450
AF-A0A431LLI8-F1-model_v4 Protein-export membrane protein SecG 0.7332 2 71 GO:0005886
GO:0009306
GO:0015450
AF-A0A7V9M7E2-F1-model_v4 Protein-export membrane protein SecG 0.7123 1 73 GO:0005886
GO:0009306
GO:0015450
AF-A0A7V9M7E2-F1-model_v4 Protein-export membrane protein SecG 0.6945 1 73 GO:0005886
GO:0009306
GO:0015450

Map