F452153

General Info

Members Datasets Scaffolds Average Seq Length
480 261 960 324

Family's Representative Sequence

Representative Sequence 3300003911|JGI25405J52794_10007480|JGI25405J52794_100074802
Length 350
Sequence MIPFDYVRADDVVGAVAAVADDPDAVFLAGGTNLVDHMKLGIATPNLVVDISHLPLDQIVQLPDGTVRIGAIVRNSDLAAHLLIRQRYPVLSQALLAGASGQLRNLATTAGNLLQRTRCVYFQDVSMPCNKRDPGSGCSAREGYTRYHAILGASAGCLAVHPSDMAVAMAALDASVIVTGRTGERRIRLKDLHRLPGDTPDRDTILTHGELITAVDLPPLSFSQHSAYRKVRDRASYAFALISVAAALDLSDRRDAAGSPTIRDVRIAFGGVAHKPWRAITAENFLRGATASVENFRKAAAVELAHAEALNDNAFKVTMVRNTAASLLADLTRRQVEDVGGELAGQEQKP

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
182 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
183 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
215 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
239 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
240 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
241 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
242 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
243 2582580736 Prauserella sp. Am3 Isolate Unclassified
244 2643221692 Nocardia sp. Root136 Isolate Unclassified
245 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
246 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
247 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
248 2808606448 Streptomyces sp. 193411 Isolate Unclassified
249 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
250 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
251 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
252 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
253 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
254 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
255 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
256 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
257 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
258 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
259 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
260 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
261 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.17
Metatranscriptomes 1.46
Isolates 4.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0.21
Rhizoplane 6.25
Rhizosphere 86.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10007480 3300003911 Bacteria 2015
2 JGI24751J29686_10008110 3300002459 Bacteria 2147
3 Ga0070658_10251905 3300005327 Bacteria 1498
4 Ga0070683_100035745 3300005329 Bacteria 4542
5 Ga0070690_100015832 3300005330 Bacteria 4506
6 Ga0070690_100143320 3300005330 Bacteria 1623
7 Ga0070670_100028405 3300005331 Bacteria 4814
8 Ga0070670_100032708 3300005331 Bacteria 4480
9 Ga0068869_100000963 3300005334 Bacteria 16738
10 Ga0068869_100029454 3300005334 Bacteria 3847
11 Ga0068869_100312339 3300005334 Bacteria 1272
12 Ga0070680_100002686 3300005336 Bacteria 13185
13 Ga0070680_100008205 3300005336 Bacteria 7982
14 Ga0070680_100035555 3300005336 Bacteria 4022
15 Ga0070680_100064111 3300005336 Bacteria 3011
16 Ga0070682_100025951 3300005337 Bacteria 3501
17 Ga0068868_100004547 3300005338 Bacteria 9740
18 Ga0068868_100030021 3300005338 Bacteria 4167
19 Ga0068868_100065030 3300005338 Bacteria 2896
20 Ga0070660_100025204 3300005339 Bacteria 4419
21 Ga0070660_100125734 3300005339 Bacteria 2049
22 Ga0070691_10002799 3300005341 Bacteria 7783
23 Ga0070691_10171302 3300005341 Bacteria 1125
24 Ga0070687_100027040 3300005343 Bacteria 2767
25 Ga0070661_100004119 3300005344 Bacteria 10026
26 Ga0070692_10004639 3300005345 Bacteria 5758
27 Ga0070668_100415792 3300005347 Bacteria 1151
28 Ga0070675_100029283 3300005354 Bacteria 4440
29 Ga0070671_100002153 3300005355 Bacteria 15213
30 Ga0070671_100122751 3300005355 Bacteria 2186
31 Ga0070674_100279076 3300005356 Bacteria 1323
32 Ga0070673_100271482 3300005364 Bacteria 1485
33 Ga0070688_100010385 3300005365 Bacteria 5133
34 Ga0070659_100042772 3300005366 Bacteria 3542
35 Ga0070659_100046888 3300005366 Bacteria 3388
36 Ga0070659_100294441 3300005366 Bacteria 1352
37 Ga0070667_100450804 3300005367 Bacteria 1176
38 Ga0070714_100005489 3300005435 Bacteria 9679
39 Ga0070711_100155074 3300005439 Bacteria 1731
40 Ga0070711_100289647 3300005439 Bacteria 1298
41 Ga0070705_100057961 3300005440 Bacteria 2287
42 Ga0070705_100078690 3300005440 Bacteria 2017
43 Ga0070700_100050953 3300005441 Bacteria 2575
44 Ga0070694_100052906 3300005444 Bacteria 2746
45 Ga0070708_100006207 3300005445 Bacteria 9504
46 Ga0070708_100112376 3300005445 Bacteria 2505
47 Ga0070663_100000983 3300005455 Bacteria 15482
48 Ga0070663_100115836 3300005455 Bacteria 2019
49 Ga0070663_100357661 3300005455 Bacteria 1184
50 Ga0070678_100012710 3300005456 Bacteria 5247
51 Ga0070662_100011140 3300005457 Bacteria 5923
52 Ga0070662_100216707 3300005457 Bacteria 1525
53 Ga0070681_10006611 3300005458 Bacteria 11288
54 Ga0070681_10031498 3300005458 Bacteria 5324
55 Ga0070681_10133026 3300005458 Bacteria 2419
56 Ga0070681_10225641 3300005458 Bacteria 1788
57 Ga0070685_10004995 3300005466 Bacteria 6716
58 Ga0070685_10032210 3300005466 Bacteria 2935
59 Ga0070706_100000800 3300005467 Bacteria 34980
60 Ga0070706_100002879 3300005467 Bacteria 17145
61 Ga0070706_100445106 3300005467 Bacteria 1206
62 Ga0070698_100030739 3300005471 Bacteria 5568
63 Ga0070698_100219884 3300005471 Bacteria 1833
64 Ga0070698_100381135 3300005471 Bacteria 1343
65 Ga0070698_100416077 3300005471 Bacteria 1278
66 Ga0070698_100421397 3300005471 Bacteria 1269
67 Ga0070698_100497828 3300005471 Bacteria 1156
68 Ga0070699_100000077 3300005518 Bacteria 94042
69 Ga0070699_100168643 3300005518 Bacteria 1939
70 Ga0070679_100000050 3300005530 Bacteria 88045
71 Ga0070679_100004335 3300005530 Bacteria 13104
72 Ga0070679_100032190 3300005530 Bacteria 5185
73 Ga0070679_100048232 3300005530 Bacteria 4244
74 Ga0070697_100075653 3300005536 Bacteria 2768
75 Ga0070697_100192286 3300005536 Bacteria 1732
76 Ga0068853_100011602 3300005539 Bacteria 7162
77 Ga0068853_100047364 3300005539 Bacteria 3689
78 Ga0068853_100129135 3300005539 Bacteria 2261
79 Ga0070672_100102935 3300005543 Bacteria 2318
80 Ga0070672_100134475 3300005543 Bacteria 2035
81 Ga0070686_100016190 3300005544 Bacteria 4335
82 Ga0070696_100031280 3300005546 Bacteria 3646
83 Ga0070693_100002110 3300005547 Bacteria 9099
84 Ga0070665_100402673 3300005548 Bacteria 1376
85 Ga0070704_100135772 3300005549 Bacteria 1913
86 Ga0070704_100274473 3300005549 Bacteria 1394
87 Ga0068857_100227526 3300005577 Bacteria 1705
88 Ga0068854_100126678 3300005578 Bacteria 1946
89 Ga0068854_100203085 3300005578 Bacteria 1559
90 Ga0068856_100278492 3300005614 Bacteria 1689
91 Ga0070702_100003054 3300005615 Bacteria 7405
92 Ga0070702_100011234 3300005615 Bacteria 4447
93 Ga0070702_100174815 3300005615 Bacteria 1400
94 Ga0068852_100004317 3300005616 Bacteria 10033
95 Ga0068852_100036178 3300005616 Bacteria 4128
96 Ga0068852_100067564 3300005616 Bacteria 3125
97 Ga0068859_100004199 3300005617 Bacteria 14704
98 Ga0068859_100073166 3300005617 Bacteria 3465
99 Ga0068859_100077257 3300005617 Bacteria 3371
100 Ga0068859_100143692 3300005617 Bacteria 2460
101 Ga0068864_100013534 3300005618 Bacteria 6763
102 Ga0068864_100024080 3300005618 Bacteria 5118
103 Ga0068864_100043006 3300005618 Bacteria 3867
104 Ga0068864_100047246 3300005618 Bacteria 3696
105 Ga0068866_10044815 3300005718 Bacteria 2215
106 Ga0068861_100019182 3300005719 Bacteria 4885
107 Ga0068870_10003007 3300005840 Bacteria 7106
108 Ga0068863_100007539 3300005841 Bacteria 10642
109 Ga0068863_100026078 3300005841 Bacteria 5577
110 Ga0068863_100160063 3300005841 Bacteria 2157
111 Ga0068863_100266505 3300005841 Bacteria 1657
112 Ga0068858_100038230 3300005842 Bacteria 4451
113 Ga0068860_100349460 3300005843 Bacteria 1455
114 Ga0081455_10000056 3300005937 Bacteria 120354
115 Ga0081455_10001678 3300005937 Bacteria 26857
116 Ga0081455_10037937 3300005937 Bacteria 4270
117 Ga0081455_10038597 3300005937 Bacteria 4228
118 Ga0081455_10204920 3300005937 Bacteria 1474
119 Ga0081539_10000705 3300005985 Bacteria 66932
120 Ga0070717_10030702 3300006028 Bacteria 4317
121 Ga0070717_10075995 3300006028 Bacteria 2810
122 Ga0070717_10250248 3300006028 Bacteria 1565
123 Ga0075432_10025453 3300006058 Bacteria 2030
124 Ga0070715_10019398 3300006163 Bacteria 2608
125 Ga0070716_100151773 3300006173 Bacteria 1491
126 Ga0097621_100009019 3300006237 Bacteria 7222
127 Ga0097621_100036709 3300006237 Bacteria 3921
128 Ga0097621_100047233 3300006237 Bacteria 3488
129 Ga0068871_100057939 3300006358 Bacteria 3153
130 Ga0075428_100254759 3300006844 Bacteria 1891
131 Ga0075433_10000219 3300006852 Bacteria 32497
132 Ga0075433_10029193 3300006852 Bacteria 4696
133 Ga0075434_100004571 3300006871 Bacteria 12500
134 Ga0075434_100535621 3300006871 Bacteria 1191
135 Ga0075429_100261915 3300006880 Bacteria 1514
136 Ga0068865_100015305 3300006881 Bacteria 4890
137 Ga0068865_100068891 3300006881 Bacteria 2502
138 Ga0075436_100037040 3300006914 Bacteria 3368
139 Ga0097620_100004199 3300006931 Bacteria 14704
140 Ga0097620_100073167 3300006931 Bacteria 3465
141 Ga0097620_100077251 3300006931 Bacteria 3371
142 Ga0097620_100143690 3300006931 Bacteria 2460
143 Ga0075435_100247651 3300007076 Bacteria 1517
144 Ga0105240_10303563 3300009093 Bacteria 1825
145 Ga0111539_10186836 3300009094 Bacteria 2420
146 Ga0105245_10007683 3300009098 Bacteria 9443
147 Ga0105245_10116427 3300009098 Bacteria 2492
148 Ga0114129_10059991 3300009147 Bacteria 5318
149 Ga0114129_10118250 3300009147 Bacteria 3651
150 Ga0114129_10238133 3300009147 Bacteria 2448
151 Ga0105243_10006719 3300009148 Bacteria 8874
152 Ga0105243_10076778 3300009148 Bacteria 2715
153 Ga0105243_10214387 3300009148 Bacteria 1697
154 Ga0105241_10000827 3300009174 Bacteria 23488
155 Ga0105241_10019923 3300009174 Bacteria 4951
156 Ga0105242_10014494 3300009176 Bacteria 6107
157 Ga0105242_10036956 3300009176 Bacteria 3921
158 Ga0105242_10084958 3300009176 Bacteria 2653
159 Ga0105242_10092421 3300009176 Bacteria 2549
160 Ga0105242_10171631 3300009176 Bacteria 1906
161 Ga0105248_10050679 3300009177 Bacteria 4657
162 Ga0105237_10001432 3300009545 Bacteria 31551
163 Ga0105238_10054281 3300009551 Bacteria 4024
164 Ga0105238_10061027 3300009551 Bacteria 3774
165 Ga0105238_10144560 3300009551 Bacteria 2355
166 Ga0105238_10617925 3300009551 Bacteria 1092
167 Ga0105249_10028727 3300009553 Bacteria 5019
168 Ga0105249_10371448 3300009553 Bacteria 1454
169 Ga0105239_10151109 3300010375 Bacteria 2591
170 Ga0105239_10160270 3300010375 Bacteria 2513
171 Ga0105239_10202685 3300010375 Bacteria 2223
172 Ga0157373_10207770 3300013100 Bacteria 1380
173 Ga0157371_10030467 3300013102 Bacteria 3892
174 Ga0157371_10088599 3300013102 Bacteria 2191
175 Ga0157371_10097640 3300013102 Bacteria 2082
176 Ga0157370_10058696 3300013104 Bacteria 3657
177 Ga0157370_10132038 3300013104 Bacteria 2329
178 Ga0157369_10020244 3300013105 Bacteria 7438
179 Ga0157374_10003951 3300013296 Bacteria 12468
180 Ga0157374_10132612 3300013296 Bacteria 2412
181 Ga0157378_10053059 3300013297 Bacteria 3609
182 Ga0157378_10274262 3300013297 Bacteria 1623
183 Ga0163162_10067664 3300013306 Bacteria 3622
184 Ga0163162_10096453 3300013306 Bacteria 3045
185 Ga0163162_10290379 3300013306 Bacteria 1767
186 Ga0157372_10031973 3300013307 Bacteria 5766
187 Ga0157372_10333684 3300013307 Bacteria 1766
188 Ga0157372_10342844 3300013307 Bacteria 1740
189 Ga0157375_10043721 3300013308 Bacteria 4347
190 Ga0157375_10189448 3300013308 Bacteria 2211
191 Ga0157375_10383315 3300013308 Bacteria 1572
192 Ga0157375_10542171 3300013308 Bacteria 1325
193 Ga0163163_10030425 3300014325 Bacteria 5203
194 Ga0163163_10038369 3300014325 Bacteria 4669
195 Ga0157380_10463689 3300014326 Bacteria 1220
196 Ga0157377_10002850 3300014745 Bacteria 7718
197 Ga0157377_10041492 3300014745 Bacteria 2553
198 Ga0157379_10120045 3300014968 Bacteria 2364
199 Ga0157376_10113353 3300014969 Bacteria 2391
200 Ga0157376_10221185 3300014969 Bacteria 1753
201 Ga0163161_10088331 3300017792 Bacteria 2291
202 Ga0206356_10588165 3300020070 Bacteria 3886
203 Ga0206351_10533477 3300020077 Bacteria 2319
204 Ga0206354_10905663 3300020081 Bacteria 4226
205 Ga0206353_10115261 3300020082 Bacteria 4174
206 Ga0206353_11847428 3300020082 Bacteria 3878
207 Ga0213875_10025649 3300021388 Bacteria 2807
208 Ga0224712_10004163 3300022467 Bacteria 3870
209 Ga0224712_10004353 3300022467 Bacteria 3809
210 Ga0207656_10081943 3300025321 Bacteria 1451
211 Ga0207682_10007800 3300025893 Bacteria 4251
212 Ga0207688_10015314 3300025901 Bacteria 4159
213 Ga0207688_10067384 3300025901 Bacteria 2025
214 Ga0207647_10097595 3300025904 Bacteria 1747
215 Ga0207643_10000212 3300025908 Bacteria 40664
216 Ga0207643_10029930 3300025908 Bacteria 3029
217 Ga0207643_10033431 3300025908 Bacteria 2877
218 Ga0207705_10000204 3300025909 Bacteria 59946
219 Ga0207705_10007317 3300025909 Bacteria 8118
220 Ga0207705_10122472 3300025909 Bacteria 1931
221 Ga0207684_10000853 3300025910 Bacteria 34981
222 Ga0207684_10014490 3300025910 Bacteria 6797
223 Ga0207684_10017953 3300025910 Bacteria 6062
224 Ga0207684_10227696 3300025910 Bacteria 1608
225 Ga0207654_10002037 3300025911 Bacteria 10370
226 Ga0207654_10018428 3300025911 Bacteria 3663
227 Ga0207707_10003359 3300025912 Bacteria 14212
228 Ga0207707_10091136 3300025912 Bacteria 2664
229 Ga0207707_10128288 3300025912 Bacteria 2218
230 Ga0207707_10172016 3300025912 Bacteria 1893
231 Ga0207707_10218432 3300025912 Bacteria 1659
232 Ga0207695_10003764 3300025913 Bacteria 21055
233 Ga0207671_10012448 3300025914 Bacteria 6835
234 Ga0207660_10001896 3300025917 Bacteria 13928
235 Ga0207660_10008574 3300025917 Bacteria 6616
236 Ga0207660_10058869 3300025917 Bacteria 2756
237 Ga0207660_10096121 3300025917 Bacteria 2205
238 Ga0207660_10203693 3300025917 Bacteria 1546
239 Ga0207660_10342412 3300025917 Bacteria 1197
240 Ga0207662_10029334 3300025918 Bacteria 3187
241 Ga0207657_10002093 3300025919 Bacteria 21592
242 Ga0207657_10015941 3300025919 Bacteria 7260
243 Ga0207649_10002657 3300025920 Bacteria 9919
244 Ga0207649_10013211 3300025920 Bacteria 4608
245 Ga0207652_10002937 3300025921 Bacteria 14267
246 Ga0207652_10003857 3300025921 Bacteria 12283
247 Ga0207652_10007661 3300025921 Bacteria 8686
248 Ga0207652_10188749 3300025921 Bacteria 1853
249 Ga0207646_10037657 3300025922 Bacteria 4360
250 Ga0207646_10226383 3300025922 Bacteria 1689
251 Ga0207681_10179088 3300025923 Bacteria 1613
252 Ga0207694_10051489 3300025924 Bacteria 3191
253 Ga0207650_10002506 3300025925 Bacteria 12752
254 Ga0207650_10010382 3300025925 Bacteria 6385
255 Ga0207650_10086254 3300025925 Bacteria 2390
256 Ga0207659_10002764 3300025926 Bacteria 10459
257 Ga0207659_10011658 3300025926 Bacteria 5561
258 Ga0207687_10021985 3300025927 Bacteria 4241
259 Ga0207687_10038878 3300025927 Bacteria 3254
260 Ga0207664_10291797 3300025929 Bacteria 1433
261 Ga0207644_10002815 3300025931 Bacteria 11211
262 Ga0207644_10112743 3300025931 Bacteria 2058
263 Ga0207690_10016842 3300025932 Bacteria 4454
264 Ga0207690_10033173 3300025932 Bacteria 3318
265 Ga0207690_10064749 3300025932 Bacteria 2497
266 Ga0207690_10225613 3300025932 Bacteria 1436
267 Ga0207706_10024371 3300025933 Bacteria 5424
268 Ga0207706_10141818 3300025933 Bacteria 2114
269 Ga0207706_10209598 3300025933 Bacteria 1708
270 Ga0207709_10009526 3300025935 Bacteria 5344
271 Ga0207670_10086248 3300025936 Bacteria 2208
272 Ga0207704_10005947 3300025938 Bacteria 5656
273 Ga0207665_10010098 3300025939 Bacteria 6199
274 Ga0207665_10053412 3300025939 Bacteria 2724
275 Ga0207665_10349125 3300025939 Bacteria 1116
276 Ga0207691_10074791 3300025940 Bacteria 3055
277 Ga0207691_10141704 3300025940 Bacteria 2118
278 Ga0207711_10364320 3300025941 Bacteria 1339
279 Ga0207689_10001662 3300025942 Bacteria 21092
280 Ga0207689_10008301 3300025942 Bacteria 9049
281 Ga0207689_10075673 3300025942 Bacteria 2767
282 Ga0207689_10141696 3300025942 Bacteria 1980
283 Ga0207689_10190997 3300025942 Bacteria 1690
284 Ga0207661_10022600 3300025944 Bacteria 4739
285 Ga0207661_10051390 3300025944 Bacteria 3289
286 Ga0207661_10198256 3300025944 Bacteria 1764
287 Ga0207679_10011657 3300025945 Bacteria 5704
288 Ga0207679_10229946 3300025945 Bacteria 1565
289 Ga0207667_10003233 3300025949 Bacteria 20105
290 Ga0207667_10117471 3300025949 Bacteria 2741
291 Ga0207667_10168626 3300025949 Bacteria 2250
292 Ga0207651_10108803 3300025960 Bacteria 2075
293 Ga0207712_10053082 3300025961 Bacteria 2842
294 Ga0207712_10089327 3300025961 Bacteria 2265
295 Ga0207712_10091398 3300025961 Bacteria 2242
296 Ga0207712_10460097 3300025961 Bacteria 1081
297 Ga0207668_10123762 3300025972 Bacteria 1963
298 Ga0207640_10012417 3300025981 Bacteria 4849
299 Ga0207640_10159747 3300025981 Bacteria 1666
300 Ga0207658_10025072 3300025986 Bacteria 4174
301 Ga0207658_10107333 3300025986 Bacteria 2200
302 Ga0207677_10002520 3300026023 Bacteria 9601
303 Ga0207677_10053972 3300026023 Bacteria 2739
304 Ga0207677_10132391 3300026023 Bacteria 1896
305 Ga0207703_10015438 3300026035 Bacteria 5955
306 Ga0207639_10001127 3300026041 Bacteria 18161
307 Ga0207639_10053982 3300026041 Bacteria 3069
308 Ga0207678_10000739 3300026067 Bacteria 29956
309 Ga0207678_10007804 3300026067 Bacteria 9449
310 Ga0207678_10098998 3300026067 Bacteria 2491
311 Ga0207678_10113385 3300026067 Bacteria 2313
312 Ga0207708_10010187 3300026075 Bacteria 6980
313 Ga0207708_10021880 3300026075 Bacteria 4825
314 Ga0207708_10355234 3300026075 Bacteria 1203
315 Ga0207702_10001434 3300026078 Bacteria 23737
316 Ga0207702_10026204 3300026078 Bacteria 4840
317 Ga0207641_10008649 3300026088 Bacteria 8405
318 Ga0207641_10490711 3300026088 Bacteria 1191
319 Ga0207676_10000741 3300026095 Bacteria 25559
320 Ga0207676_10011179 3300026095 Bacteria 6408
321 Ga0207676_10033302 3300026095 Bacteria 3892
322 Ga0207676_10054217 3300026095 Bacteria 3141
323 Ga0207674_10082228 3300026116 Bacteria 3222
324 Ga0207674_10385145 3300026116 Bacteria 1356
325 Ga0207674_10389531 3300026116 Bacteria 1347
326 Ga0207675_100011631 3300026118 Bacteria 8229
327 Ga0207675_100019398 3300026118 Bacteria 6344
328 Ga0207675_100029776 3300026118 Bacteria 5083
329 Ga0207675_100036821 3300026118 Bacteria 4564
330 Ga0207675_100192031 3300026118 Bacteria 1959
331 Ga0207683_10002380 3300026121 Bacteria 16424
332 Ga0207683_10056600 3300026121 Bacteria 3441
333 Ga0207683_10313367 3300026121 Bacteria 1437
334 Ga0207698_10001770 3300026142 Bacteria 12601
335 Ga0207698_10079401 3300026142 Bacteria 2639
336 Ga0207698_10082781 3300026142 Bacteria 2595
337 Ga0207698_10089536 3300026142 Bacteria 2513
338 Ga0207698_10313382 3300026142 Bacteria 1466
339 Ga0207698_10610745 3300026142 Bacteria 1076
340 Ga0207428_10004351 3300027907 Bacteria 13528
341 Ga0268266_10579751 3300028379 Bacteria 1076
342 Ga0268265_10227342 3300028380 Bacteria 1637
343 Ga0268265_10379545 3300028380 Bacteria 1300
344 Ga0268264_10133652 3300028381 Bacteria 2203
345 Ga0268264_10228411 3300028381 Bacteria 1717
346 Ga0307515_10000287 3300028794 Bacteria 123976
347 Ga0307412_10002306 3300031911 Bacteria 10562
348 Ga0307416_100196856 3300032002 Bacteria 1907
349 Ga0373956_0034772 3300035119 Bacteria 2220
350 Ga0373931_0011816 3300035691 Bacteria 4221
351 Ga0373933_0004719 3300035724 Bacteria 7457
352 Ga0373937_0358398 3300036401 Bacteria 1382
353 Ga0373925_0000066 3300037068 Bacteria 114044
354 Ga0395899_0008484 3300037312 Bacteria 7917
355 Ga0395900_0096986 3300037418 Bacteria 3029
356 Ga0395900_0126443 3300037418 Bacteria 2622
357 Ga0395900_0273136 3300037418 Bacteria 1684
358 Ga0395898_0035838 3300037466 Bacteria 4931
359 Ga0395905_0016045 3300037471 Bacteria 7120
360 Ga0436364_0322517 3300037853 Bacteria 14825
361 Ga0395901_0081194 3300038443 Bacteria 3387
362 Ga0395901_0234897 3300038443 Bacteria 1913
363 Ga0395901_0468889 3300038443 Bacteria 1286
364 Ga0436365_1726517 3300039437 Bacteria 1134
365 Ga0436362_0972396 3300039453 Bacteria 2014
366 Ga0451793_0650333 3300041452 Bacteria 1293
367 Ga0439459_0009378 3300042438 Bacteria 1692
368 Ga0466972_0005982 3300044658 Bacteria 6110
369 Ga0466963_0004972 3300044694 Bacteria 7756
370 Ga0466963_0011429 3300044694 Bacteria 5407
371 Ga0466964_0057513 3300044706 Bacteria 1610
372 Ga0466971_0052883 3300044719 Bacteria 1830
373 Ga0466970_0072603 3300044765 Bacteria 1851
374 Ga0466957_0001131 3300044842 Bacteria 13823
375 Ga0466960_0049202 3300044901 Bacteria 2028
376 Ga0466958_0032943 3300045836 Bacteria 3085
377 Ga0466967_0068308 3300045976 Bacteria 3173
378 Ga0466967_0069288 3300045976 Bacteria 3152
379 Ga0466967_0296218 3300045976 Bacteria 1555
380 Ga0495651_0107294 3300046462 Bacteria 2069
381 Ga0495651_0130062 3300046462 Bacteria 1839
382 Ga0495667_0122771 3300046559 Bacteria 1677
383 Ga0495625_0058719 3300046660 Bacteria 2732
384 Ga0495602_0012313 3300048088 Bacteria 8803
385 Ga0496100_0038824 3300048903 Bacteria 3020
386 Ga0496100_0057757 3300048903 Bacteria 2543
387 Ga0496100_0113957 3300048903 Bacteria 1883
388 Ga0496102_0050080 3300048905 Bacteria 3802
389 Ga0496102_0100567 3300048905 Bacteria 2685
390 Ga0496104_0055612 3300048907 Bacteria 3742
391 Ga0496104_0056227 3300048907 Bacteria 3720
392 Ga0496104_0066619 3300048907 Bacteria 3419
393 Ga0496104_0069078 3300048907 Bacteria 3358
394 Ga0496105_0018898 3300048908 Bacteria 5550
395 Ga0496105_0028717 3300048908 Bacteria 4551
396 Ga0496106_0001728 3300048909 Bacteria 16302
397 Ga0496106_0021125 3300048909 Bacteria 4833
398 Ga0496107_0031427 3300048910 Bacteria 3789
399 Ga0496107_0056454 3300048910 Bacteria 2837
400 Ga0496108_0003184 3300048911 Bacteria 13211
401 Ga0496108_0090538 3300048911 Bacteria 2600
402 Ga0496108_0261617 3300048911 Bacteria 1506
403 Ga0496108_0406039 3300048911 Bacteria 1190
404 Ga0496108_0457767 3300048911 Bacteria 1114
405 Ga0496109_0004884 3300048912 Bacteria 11196
406 Ga0496109_0285177 3300048912 Bacteria 1556
407 Ga0496110_0002092 3300048913 Bacteria 14877
408 Ga0496110_0021163 3300048913 Bacteria 5499
409 Ga0496111_0009945 3300048914 Bacteria 6361
410 Ga0496111_0162732 3300048914 Bacteria 1657
411 Ga0496112_0043108 3300048915 Bacteria 4416
412 Ga0496113_0037986 3300048916 Bacteria 3537
413 Ga0496114_0028390 3300048917 Bacteria 4591
414 Ga0496116_0000256 3300048919 Bacteria 93252
415 Ga0496117_0009288 3300048920 Bacteria 9186
416 Ga0496118_0021522 3300048921 Bacteria 5671
417 Ga0496121_0018202 3300048924 Bacteria 7100
418 Ga0496122_0004148 3300048925 Bacteria 18288
419 Ga0496123_0000943 3300048926 Bacteria 45337
420 Ga0496124_0003244 3300048927 Bacteria 20087
421 Ga0496124_0025616 3300048927 Bacteria 5340
422 Ga0496124_0030523 3300048927 Bacteria 4783
423 Ga0496124_0082546 3300048927 Bacteria 2638
424 Ga0496124_0283674 3300048927 Bacteria 1206
425 Ga0496125_0031165 3300048928 Bacteria 4756
426 Ga0496126_0000863 3300048929 Bacteria 53292
427 Ga0496126_0006741 3300048929 Bacteria 12749
428 Ga0501031_0005373 3300049568 Bacteria 8343
429 Ga0501032_0001726 3300049569 Bacteria 17305
430 Ga0501033_0016981 3300049570 Bacteria 5502
431 Ga0501034_0116239 3300049571 Bacteria 2663
432 Ga0501036_0005384 3300049572 Bacteria 10367
433 Ga0501037_0004719 3300049573 Bacteria 9906
434 Ga0501037_0111914 3300049573 Bacteria 1966
435 Ga0501042_0049616 3300049578 Bacteria 2994
436 Ga0501046_0005059 3300049580 Bacteria 11820
437 Ga0501047_0006104 3300049581 Bacteria 11324
438 Ga0501047_0066564 3300049581 Bacteria 3472
439 Ga0501048_0002527 3300049582 Bacteria 13984
440 Ga0501069_0053416 3300049585 Bacteria 2250
441 Ga0501035_0007295 3300049822 Bacteria 10344
442 Ga0501044_0244338 3300049823 Bacteria 1738
443 nmdc:mga05p37_227301_c1 3300050507 Bacteria 2249
444 nmdc:mga05p37_332240_c1 3300050507 Bacteria 1795
445 nmdc:mga05p37_7421_c1 3300050507 Bacteria 12935
446 nmdc:mga08y16_381998_c1 3300050511 Bacteria 1444
447 nmdc:mga08y16_49233_c1 3300050511 Bacteria 4411
448 nmdc:mga0n895_174773_c1 3300050512 Bacteria 2179
449 nmdc:mga0n895_496434_c1 3300050512 Bacteria 1230
450 nmdc:mga0n895_58136_c1 3300050512 Bacteria 3813
451 nmdc:mga0rr50_204711_c1 3300050513 Bacteria 1623
452 nmdc:mga0rr50_3467_c1 3300050513 Bacteria 9082
453 nmdc:mga08x19_679_c1 3300050514 Bacteria 21822
454 nmdc:mga0a205_136353_c1 3300050515 Bacteria 2355
455 nmdc:mga0a205_76449_c1 3300050515 Bacteria 3236
456 Ga0500573_0000536 3300053140 Bacteria 16587
457 Ga0500573_0020746 3300053140 Bacteria 3763
458 Ga0590071_017879 3300059421 Bacteria 1667
459 Ga0466962_0086302 3300061719 Bacteria 1503
460 2547409423 2547132111 Bacteria 8013147
461 2558906635 2558860112 Bacteria 9931328
462 2583151033 2582580736 Bacteria 5325865
463 2644517675 2643221692 Bacteria 7282860
464 2784592388 2784132148 Bacteria 8627943
465 2791913397 2791354901 Bacteria 8322202
466 2804848787 2802429296 Bacteria 7227771
467 2809236017 2808606448 Bacteria 8656184
468 2816503868 2816332139 Bacteria 9138787
469 2875391994 2875391855 Bacteria 7600475
470 2877677149 2877676314 Bacteria 9512378
471 2899369069 2899359706 Bacteria 10940472
472 2912728817 2912723979 Bacteria 8557534
473 2917737423 2917736166 Bacteria 9690793
474 2990089251 2990088156 Bacteria 6657676
475 2997601814 2997600082 Bacteria 9896405
476 8004025024 8004021418 Bacteria 4313954
477 8023629053 8023623736 Bacteria 8593882
478 8025417406 8025413630 Bacteria 7014048
479 8049297677 8049293176 Bacteria 6128433
480 8056063555 8056060235 Bacteria 7259403
481 JGI25405J52794_10007480
482 JGI24751J29686_10008110
483 Ga0070658_10251905
484 Ga0070683_100035745
485 Ga0070690_100015832
486 Ga0070690_100143320
487 Ga0070670_100028405
488 Ga0070670_100032708
489 Ga0068869_100000963
490 Ga0068869_100029454
491 Ga0068869_100312339
492 Ga0070680_100002686
493 Ga0070680_100008205
494 Ga0070680_100035555
495 Ga0070680_100064111
496 Ga0070682_100025951
497 Ga0068868_100004547
498 Ga0068868_100030021
499 Ga0068868_100065030
500 Ga0070660_100025204
501 Ga0070660_100125734
502 Ga0070691_10002799
503 Ga0070691_10171302
504 Ga0070687_100027040
505 Ga0070661_100004119
506 Ga0070692_10004639
507 Ga0070668_100415792
508 Ga0070675_100029283
509 Ga0070671_100002153
510 Ga0070671_100122751
511 Ga0070674_100279076
512 Ga0070673_100271482
513 Ga0070688_100010385
514 Ga0070659_100042772
515 Ga0070659_100046888
516 Ga0070659_100294441
517 Ga0070667_100450804
518 Ga0070714_100005489
519 Ga0070711_100155074
520 Ga0070711_100289647
521 Ga0070705_100057961
522 Ga0070705_100078690
523 Ga0070700_100050953
524 Ga0070694_100052906
525 Ga0070708_100006207
526 Ga0070708_100112376
527 Ga0070663_100000983
528 Ga0070663_100115836
529 Ga0070663_100357661
530 Ga0070678_100012710
531 Ga0070662_100011140
532 Ga0070662_100216707
533 Ga0070681_10006611
534 Ga0070681_10031498
535 Ga0070681_10133026
536 Ga0070681_10225641
537 Ga0070685_10004995
538 Ga0070685_10032210
539 Ga0070706_100000800
540 Ga0070706_100002879
541 Ga0070706_100445106
542 Ga0070698_100030739
543 Ga0070698_100219884
544 Ga0070698_100381135
545 Ga0070698_100416077
546 Ga0070698_100421397
547 Ga0070698_100497828
548 Ga0070699_100000077
549 Ga0070699_100168643
550 Ga0070679_100000050
551 Ga0070679_100004335
552 Ga0070679_100032190
553 Ga0070679_100048232
554 Ga0070697_100075653
555 Ga0070697_100192286
556 Ga0068853_100011602
557 Ga0068853_100047364
558 Ga0068853_100129135
559 Ga0070672_100102935
560 Ga0070672_100134475
561 Ga0070686_100016190
562 Ga0070696_100031280
563 Ga0070693_100002110
564 Ga0070665_100402673
565 Ga0070704_100135772
566 Ga0070704_100274473
567 Ga0068857_100227526
568 Ga0068854_100126678
569 Ga0068854_100203085
570 Ga0068856_100278492
571 Ga0070702_100003054
572 Ga0070702_100011234
573 Ga0070702_100174815
574 Ga0068852_100004317
575 Ga0068852_100036178
576 Ga0068852_100067564
577 Ga0068859_100004199
578 Ga0068859_100073166
579 Ga0068859_100077257
580 Ga0068859_100143692
581 Ga0068864_100013534
582 Ga0068864_100024080
583 Ga0068864_100043006
584 Ga0068864_100047246
585 Ga0068866_10044815
586 Ga0068861_100019182
587 Ga0068870_10003007
588 Ga0068863_100007539
589 Ga0068863_100026078
590 Ga0068863_100160063
591 Ga0068863_100266505
592 Ga0068858_100038230
593 Ga0068860_100349460
594 Ga0081455_10000056
595 Ga0081455_10001678
596 Ga0081455_10037937
597 Ga0081455_10038597
598 Ga0081455_10204920
599 Ga0081539_10000705
600 Ga0070717_10030702
601 Ga0070717_10075995
602 Ga0070717_10250248
603 Ga0075432_10025453
604 Ga0070715_10019398
605 Ga0070716_100151773
606 Ga0097621_100009019
607 Ga0097621_100036709
608 Ga0097621_100047233
609 Ga0068871_100057939
610 Ga0075428_100254759
611 Ga0075433_10000219
612 Ga0075433_10029193
613 Ga0075434_100004571
614 Ga0075434_100535621
615 Ga0075429_100261915
616 Ga0068865_100015305
617 Ga0068865_100068891
618 Ga0075436_100037040
619 Ga0097620_100004199
620 Ga0097620_100073167
621 Ga0097620_100077251
622 Ga0097620_100143690
623 Ga0075435_100247651
624 Ga0105240_10303563
625 Ga0111539_10186836
626 Ga0105245_10007683
627 Ga0105245_10116427
628 Ga0114129_10059991
629 Ga0114129_10118250
630 Ga0114129_10238133
631 Ga0105243_10006719
632 Ga0105243_10076778
633 Ga0105243_10214387
634 Ga0105241_10000827
635 Ga0105241_10019923
636 Ga0105242_10014494
637 Ga0105242_10036956
638 Ga0105242_10084958
639 Ga0105242_10092421
640 Ga0105242_10171631
641 Ga0105248_10050679
642 Ga0105237_10001432
643 Ga0105238_10054281
644 Ga0105238_10061027
645 Ga0105238_10144560
646 Ga0105238_10617925
647 Ga0105249_10028727
648 Ga0105249_10371448
649 Ga0105239_10151109
650 Ga0105239_10160270
651 Ga0105239_10202685
652 Ga0157373_10207770
653 Ga0157371_10030467
654 Ga0157371_10088599
655 Ga0157371_10097640
656 Ga0157370_10058696
657 Ga0157370_10132038
658 Ga0157369_10020244
659 Ga0157374_10003951
660 Ga0157374_10132612
661 Ga0157378_10053059
662 Ga0157378_10274262
663 Ga0163162_10067664
664 Ga0163162_10096453
665 Ga0163162_10290379
666 Ga0157372_10031973
667 Ga0157372_10333684
668 Ga0157372_10342844
669 Ga0157375_10043721
670 Ga0157375_10189448
671 Ga0157375_10383315
672 Ga0157375_10542171
673 Ga0163163_10030425
674 Ga0163163_10038369
675 Ga0157380_10463689
676 Ga0157377_10002850
677 Ga0157377_10041492
678 Ga0157379_10120045
679 Ga0157376_10113353
680 Ga0157376_10221185
681 Ga0163161_10088331
682 Ga0206356_10588165
683 Ga0206351_10533477
684 Ga0206354_10905663
685 Ga0206353_10115261
686 Ga0206353_11847428
687 Ga0213875_10025649
688 Ga0224712_10004163
689 Ga0224712_10004353
690 Ga0207656_10081943
691 Ga0207682_10007800
692 Ga0207688_10015314
693 Ga0207688_10067384
694 Ga0207647_10097595
695 Ga0207643_10000212
696 Ga0207643_10029930
697 Ga0207643_10033431
698 Ga0207705_10000204
699 Ga0207705_10007317
700 Ga0207705_10122472
701 Ga0207684_10000853
702 Ga0207684_10014490
703 Ga0207684_10017953
704 Ga0207684_10227696
705 Ga0207654_10002037
706 Ga0207654_10018428
707 Ga0207707_10003359
708 Ga0207707_10091136
709 Ga0207707_10128288
710 Ga0207707_10172016
711 Ga0207707_10218432
712 Ga0207695_10003764
713 Ga0207671_10012448
714 Ga0207660_10001896
715 Ga0207660_10008574
716 Ga0207660_10058869
717 Ga0207660_10096121
718 Ga0207660_10203693
719 Ga0207660_10342412
720 Ga0207662_10029334
721 Ga0207657_10002093
722 Ga0207657_10015941
723 Ga0207649_10002657
724 Ga0207649_10013211
725 Ga0207652_10002937
726 Ga0207652_10003857
727 Ga0207652_10007661
728 Ga0207652_10188749
729 Ga0207646_10037657
730 Ga0207646_10226383
731 Ga0207681_10179088
732 Ga0207694_10051489
733 Ga0207650_10002506
734 Ga0207650_10010382
735 Ga0207650_10086254
736 Ga0207659_10002764
737 Ga0207659_10011658
738 Ga0207687_10021985
739 Ga0207687_10038878
740 Ga0207664_10291797
741 Ga0207644_10002815
742 Ga0207644_10112743
743 Ga0207690_10016842
744 Ga0207690_10033173
745 Ga0207690_10064749
746 Ga0207690_10225613
747 Ga0207706_10024371
748 Ga0207706_10141818
749 Ga0207706_10209598
750 Ga0207709_10009526
751 Ga0207670_10086248
752 Ga0207704_10005947
753 Ga0207665_10010098
754 Ga0207665_10053412
755 Ga0207665_10349125
756 Ga0207691_10074791
757 Ga0207691_10141704
758 Ga0207711_10364320
759 Ga0207689_10001662
760 Ga0207689_10008301
761 Ga0207689_10075673
762 Ga0207689_10141696
763 Ga0207689_10190997
764 Ga0207661_10022600
765 Ga0207661_10051390
766 Ga0207661_10198256
767 Ga0207679_10011657
768 Ga0207679_10229946
769 Ga0207667_10003233
770 Ga0207667_10117471
771 Ga0207667_10168626
772 Ga0207651_10108803
773 Ga0207712_10053082
774 Ga0207712_10089327
775 Ga0207712_10091398
776 Ga0207712_10460097
777 Ga0207668_10123762
778 Ga0207640_10012417
779 Ga0207640_10159747
780 Ga0207658_10025072
781 Ga0207658_10107333
782 Ga0207677_10002520
783 Ga0207677_10053972
784 Ga0207677_10132391
785 Ga0207703_10015438
786 Ga0207639_10001127
787 Ga0207639_10053982
788 Ga0207678_10000739
789 Ga0207678_10007804
790 Ga0207678_10098998
791 Ga0207678_10113385
792 Ga0207708_10010187
793 Ga0207708_10021880
794 Ga0207708_10355234
795 Ga0207702_10001434
796 Ga0207702_10026204
797 Ga0207641_10008649
798 Ga0207641_10490711
799 Ga0207676_10000741
800 Ga0207676_10011179
801 Ga0207676_10033302
802 Ga0207676_10054217
803 Ga0207674_10082228
804 Ga0207674_10385145
805 Ga0207674_10389531
806 Ga0207675_100011631
807 Ga0207675_100019398
808 Ga0207675_100029776
809 Ga0207675_100036821
810 Ga0207675_100192031
811 Ga0207683_10002380
812 Ga0207683_10056600
813 Ga0207683_10313367
814 Ga0207698_10001770
815 Ga0207698_10079401
816 Ga0207698_10082781
817 Ga0207698_10089536
818 Ga0207698_10313382
819 Ga0207698_10610745
820 Ga0207428_10004351
821 Ga0268266_10579751
822 Ga0268265_10227342
823 Ga0268265_10379545
824 Ga0268264_10133652
825 Ga0268264_10228411
826 Ga0307515_10000287
827 Ga0307412_10002306
828 Ga0307416_100196856
829 Ga0373956_0034772
830 Ga0373931_0011816
831 Ga0373933_0004719
832 Ga0373937_0358398
833 Ga0373925_0000066
834 Ga0395899_0008484
835 Ga0395900_0096986
836 Ga0395900_0126443
837 Ga0395900_0273136
838 Ga0395898_0035838
839 Ga0395905_0016045
840 Ga0436364_0322517
841 Ga0395901_0081194
842 Ga0395901_0234897
843 Ga0395901_0468889
844 Ga0436365_1726517
845 Ga0436362_0972396
846 Ga0451793_0650333
847 Ga0439459_0009378
848 Ga0466972_0005982
849 Ga0466963_0004972
850 Ga0466963_0011429
851 Ga0466964_0057513
852 Ga0466971_0052883
853 Ga0466970_0072603
854 Ga0466957_0001131
855 Ga0466960_0049202
856 Ga0466958_0032943
857 Ga0466967_0068308
858 Ga0466967_0069288
859 Ga0466967_0296218
860 Ga0495651_0107294
861 Ga0495651_0130062
862 Ga0495667_0122771
863 Ga0495625_0058719
864 Ga0495602_0012313
865 Ga0496100_0038824
866 Ga0496100_0057757
867 Ga0496100_0113957
868 Ga0496102_0050080
869 Ga0496102_0100567
870 Ga0496104_0055612
871 Ga0496104_0056227
872 Ga0496104_0066619
873 Ga0496104_0069078
874 Ga0496105_0018898
875 Ga0496105_0028717
876 Ga0496106_0001728
877 Ga0496106_0021125
878 Ga0496107_0031427
879 Ga0496107_0056454
880 Ga0496108_0003184
881 Ga0496108_0090538
882 Ga0496108_0261617
883 Ga0496108_0406039
884 Ga0496108_0457767
885 Ga0496109_0004884
886 Ga0496109_0285177
887 Ga0496110_0002092
888 Ga0496110_0021163
889 Ga0496111_0009945
890 Ga0496111_0162732
891 Ga0496112_0043108
892 Ga0496113_0037986
893 Ga0496114_0028390
894 Ga0496116_0000256
895 Ga0496117_0009288
896 Ga0496118_0021522
897 Ga0496121_0018202
898 Ga0496122_0004148
899 Ga0496123_0000943
900 Ga0496124_0003244
901 Ga0496124_0025616
902 Ga0496124_0030523
903 Ga0496124_0082546
904 Ga0496124_0283674
905 Ga0496125_0031165
906 Ga0496126_0000863
907 Ga0496126_0006741
908 Ga0501031_0005373
909 Ga0501032_0001726
910 Ga0501033_0016981
911 Ga0501034_0116239
912 Ga0501036_0005384
913 Ga0501037_0004719
914 Ga0501037_0111914
915 Ga0501042_0049616
916 Ga0501046_0005059
917 Ga0501047_0006104
918 Ga0501047_0066564
919 Ga0501048_0002527
920 Ga0501069_0053416
921 Ga0501035_0007295
922 Ga0501044_0244338
923 nmdc:mga05p37_227301_c1
924 nmdc:mga05p37_332240_c1
925 nmdc:mga05p37_7421_c1
926 nmdc:mga08y16_381998_c1
927 nmdc:mga08y16_49233_c1
928 nmdc:mga0n895_174773_c1
929 nmdc:mga0n895_496434_c1
930 nmdc:mga0n895_58136_c1
931 nmdc:mga0rr50_204711_c1
932 nmdc:mga0rr50_3467_c1
933 nmdc:mga08x19_679_c1
934 nmdc:mga0a205_136353_c1
935 nmdc:mga0a205_76449_c1
936 Ga0500573_0000536
937 Ga0500573_0020746
938 Ga0590071_017879
939 Ga0466962_0086302
940 2547409423
941 2558906635
942 2583151033
943 2644517675
944 2784592388
945 2791913397
946 2804848787
947 2809236017
948 2816503868
949 2875391994
950 2877677149
951 2899369069
952 2912728817
953 2917737423
954 2990089251
955 2997601814
956 8004025024
957 8023629053
958 8025417406
959 8049297677
960 8056063555

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

2

220

0.98

PF03450

CO_deh_flav_C

CO dehydrogenase flavoprotein C-terminal domain

226

335

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y6q-assembly1.cif.gz_B crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.9615 1 325
5g5h-assembly1.cif.gz_B escherichia coli periplasmic aldehyde oxidase r440h mutant 0.9494 1 324
5y6q-assembly1.cif.gz_B crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.9473 1 325
5g5h-assembly1.cif.gz_B escherichia coli periplasmic aldehyde oxidase r440h mutant 0.9435 1 324
1t3q-assembly1.cif.gz_F crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 0.8978 4 329
ID Description Score Start End Superfamily
1t3qF01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.946 4 53 3.30.43.10
af_P77324_1_53_3.30.43.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9424 1 52 3.30.43.10
1ffuF01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9404 3 51 3.30.43.10
5y6qB02 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.9286 223 325 3.30.390.50
af_Q46800_181_289_3.30.390.50 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.917 227 325 3.30.390.50
ID Description Score Start End GO Terms
AF-F3FVU5-F1-model_v4 Molybdopterin dehydrogenase, FAD-binding:CO dehydrogenase 0.995 69 170 GO:0016491
GO:0050660
AF-A0A4Y7U4H7-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.993 83 216 GO:0016491
GO:0071949
AF-A0A4Q3WXA7-F1-model_v4 deleted 0.9923 87 326
AF-A0A6G3WI98-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9914 99 214 GO:0016491
GO:0071949
AF-A0A6F8Y475-F1-model_v4 Molybdopterin dehydrogenase FAD-binding domain-containing protein 0.99 117 219 GO:0016491
GO:0050660

Map