F451971

General Info

Members Datasets Scaffolds Average Seq Length
478 376 956 183

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2888378607|2888378742
Length 216
Sequence ANAAISLQIRAHEPIFSGVRQNARSDLKGAVLMPLTPEVLTANSQVVARLGSLDISFTPDDESWFTIDGIEGPRQVGSDGSGGAFVLLPSQNVLYVSSEGRAGIIAGTFEAFIQLVVVRPYWLDILKFSAGGDLAEMRRAADALEATLDDEDEVNEAREQIRKGLDLPEPDDPVGALYEAVAASDAIVRTTDGSPFTTLFNRFSIDNNPMLRNAAA

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
37 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
57 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
58 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
59 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
65 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
96 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
97 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
98 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
109 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
110 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
111 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
132 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
138 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
151 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
168 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
198 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
201 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
202 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
203 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
204 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
205 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
206 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
207 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
210 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
211 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
212 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
213 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
214 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
215 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
216 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
217 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
218 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
219 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
220 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
221 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
222 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
223 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
224 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
227 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
228 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
229 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
230 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
231 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
232 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
233 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
234 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
235 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
236 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
237 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
238 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
239 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
240 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
241 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
242 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
243 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
244 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
245 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
246 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
247 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
248 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
249 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
250 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
251 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
252 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
253 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
254 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
255 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
256 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
257 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
258 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
259 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
260 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
261 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
262 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
263 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
264 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
265 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
266 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
267 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
268 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
269 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
270 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
271 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
272 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
273 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
274 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
275 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
276 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
277 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
278 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
279 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
280 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
281 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
282 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
283 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
284 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
285 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
286 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
287 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
288 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
289 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
290 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
291 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
292 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
293 2922368715
294 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
295 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
296 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
297 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
298 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
299 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
300 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
301 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
302 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
303 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
304 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
305 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
306 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
307 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
308 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
309 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
310 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
311 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
312 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
313 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
314 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
315 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
316 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
317 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
318 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
319 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
320 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
321 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
322 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
323 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
324 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
325 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
326 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
327 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
328 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
329 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
330 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
331 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
332 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
333 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
334 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
335 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
336 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
337 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
338 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
339 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
340 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
341 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
342 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
343 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
344 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
345 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
346 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
347 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
348 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
349 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
350 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
351 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
352 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
353 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
354 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
355 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
356 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
357 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
358 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
359 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
360 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
361 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
362 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
363 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
364 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
365 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
366 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
367 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
368 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
369 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
370 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
371 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
372 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
373 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
374 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
375 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
376 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 70.44
Metatranscriptomes 0
Isolates 29.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.04
Nodule 24.9
Rhizoplane 5.02
Rhizosphere 39.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000729 3300003215 Bacteria 20162
2 JGI25153J46596_10002323 3300003215 Bacteria 11045
3 rootH1_10008525 3300003323 Bacteria 1391
4 JGI25160J50197_1000623 3300003354 Bacteria 19836
5 JGI25160J50197_1001838 3300003354 Bacteria 10191
6 Ga0055531_10002783 3300003794 Bacteria 11485
7 Ga0065165_1001117 3300005262 Bacteria 31706
8 Ga0065165_1003342 3300005262 Bacteria 11415
9 Ga0070660_100408339 3300005339 Bacteria 1123
10 Ga0070660_101053725 3300005339 Bacteria 688
11 Ga0070669_100506626 3300005353 Bacteria 1002
12 Ga0070671_100040642 3300005355 Bacteria 3863
13 Ga0070673_100954735 3300005364 Bacteria 797
14 Ga0070659_100306369 3300005366 Bacteria 1325
15 Ga0070711_100410002 3300005439 Bacteria 1102
16 Ga0070663_100047035 3300005455 Bacteria 3055
17 Ga0070663_100124738 3300005455 Bacteria 1949
18 Ga0070678_100164729 3300005456 Bacteria 1800
19 Ga0070662_100093092 3300005457 Bacteria 2267
20 Ga0070662_100341640 3300005457 Bacteria 1225
21 Ga0068867_100225017 3300005459 Bacteria 1514
22 Ga0070684_101180684 3300005535 Bacteria 720
23 Ga0068853_100901902 3300005539 Bacteria 849
24 Ga0070665_100016137 3300005548 Bacteria 7495
25 Ga0070665_100723062 3300005548 Bacteria 1009
26 Ga0070665_101298299 3300005548 Bacteria 738
27 Ga0068855_100911957 3300005563 Bacteria 928
28 Ga0068855_101058120 3300005563 Bacteria 850
29 Ga0068857_100377614 3300005577 Bacteria 1316
30 Ga0068854_100122693 3300005578 Bacteria 1975
31 Ga0068856_100357289 3300005614 Bacteria 1479
32 Ga0068856_101201179 3300005614 Bacteria 775
33 Ga0068852_100050037 3300005616 Bacteria 3578
34 Ga0068852_100188898 3300005616 Bacteria 1942
35 Ga0068863_100374069 3300005841 Bacteria 1390
36 Ga0068860_100858161 3300005843 Bacteria 923
37 Ga0081540_1009713 3300005983 Bacteria 6602
38 Ga0070717_10744578 3300006028 Bacteria 891
39 Ga0075365_10054817 3300006038 Bacteria 2645
40 Ga0075365_10056862 3300006038 Bacteria 2601
41 Ga0075368_10071204 3300006042 Bacteria 1404
42 Ga0075362_10012683 3300006177 Bacteria 3355
43 Ga0075367_10079989 3300006178 Bacteria 1976
44 Ga0075367_10209607 3300006178 Bacteria 1218
45 Ga0075367_10410818 3300006178 Bacteria 856
46 Ga0075369_10056161 3300006186 Bacteria 1711
47 Ga0075366_10046501 3300006195 Bacteria 2571
48 Ga0075366_10436777 3300006195 Bacteria 807
49 Ga0075370_10037231 3300006353 Bacteria 2735
50 Ga0075370_10086625 3300006353 Bacteria 1804
51 Ga0068865_100427000 3300006881 Bacteria 1091
52 Ga0099825_1034943 3300006941 Bacteria 1833
53 Ga0099823_1025375 3300006944 Bacteria 5307
54 Ga0105240_10001242 3300009093 Bacteria 44196
55 Ga0105245_10314895 3300009098 Bacteria 1540
56 Ga0105243_10236446 3300009148 Bacteria 1623
57 Ga0105243_10542467 3300009148 Bacteria 1110
58 Ga0105241_10027436 3300009174 Bacteria 4241
59 Ga0105241_10129922 3300009174 Bacteria 2038
60 Ga0105242_10545977 3300009176 Bacteria 1110
61 Ga0105248_10266660 3300009177 Bacteria 1928
62 Ga0105248_10913720 3300009177 Bacteria 991
63 Ga0105237_10025811 3300009545 Bacteria 6008
64 Ga0105237_10161490 3300009545 Bacteria 2239
65 Ga0105238_11195621 3300009551 Bacteria 785
66 Ga0105239_10038756 3300010375 Bacteria 5221
67 Ga0105239_10092492 3300010375 Bacteria 3339
68 Ga0105239_10197721 3300010375 Bacteria 2252
69 Ga0105246_10035640 3300011119 Bacteria 3327
70 Ga0157374_10358410 3300013296 Bacteria 1450
71 Ga0157372_11853735 3300013307 Bacteria 693
72 Ga0157375_10180702 3300013308 Bacteria 2261
73 Ga0157375_10352976 3300013308 Bacteria 1636
74 Ga0163163_10051237 3300014325 Bacteria 4070
75 Ga0163163_10584356 3300014325 Bacteria 1180
76 Ga0157377_10182407 3300014745 Bacteria 1321
77 Ga0157379_10408480 3300014968 Bacteria 1249
78 Ga0157379_10914920 3300014968 Bacteria 833
79 Ga0157376_10311026 3300014969 Bacteria 1495
80 Ga0157376_10550136 3300014969 Bacteria 1142
81 Ga0163161_10533835 3300017792 Bacteria 959
82 Ga0214544_1000003 3300021320 Bacteria 643752
83 Ga0214542_1000022 3300021321 Bacteria 193578
84 Ga0214545_1000010 3300021324 Bacteria 193578
85 Ga0214543_1000035 3300021327 Bacteria 183100
86 Ga0213875_10324488 3300021388 Bacteria 730
87 Ga0209563_101925 3300025230 Bacteria 5013
88 Ga0209677_102159 3300025253 Bacteria 7685
89 Ga0209148_1000270 3300025254 Bacteria 81508
90 Ga0209233_1009530 3300025261 Bacteria 2950
91 Ga0209233_1009923 3300025261 Bacteria 2876
92 Ga0209233_1012547 3300025261 Bacteria 2453
93 Ga0209233_1055017 3300025261 Bacteria 792
94 Ga0209455_1007179 3300025272 Bacteria 3180
95 Ga0209758_1000015 3300025297 Bacteria 851943
96 Ga0209758_1000306 3300025297 Bacteria 95362
97 Ga0209758_1000458 3300025297 Bacteria 67627
98 Ga0209758_1007078 3300025297 Bacteria 7776
99 Ga0209758_1012779 3300025297 Bacteria 4653
100 Ga0209256_1004376 3300025299 Bacteria 8930
101 Ga0209256_1018865 3300025299 Bacteria 2221
102 Ga0209256_1047085 3300025299 Bacteria 1063
103 Ga0207426_1000217 3300025302 Bacteria 136180
104 Ga0207426_1001044 3300025302 Bacteria 26304
105 Ga0207426_1004208 3300025302 Bacteria 7160
106 Ga0207426_1023117 3300025302 Bacteria 2124
107 Ga0207426_1043842 3300025302 Bacteria 1371
108 Ga0209051_1031066 3300025303 Bacteria 2061
109 Ga0209051_1048818 3300025303 Bacteria 1431
110 Ga0209257_1000960 3300025304 Bacteria 39594
111 Ga0209257_1009918 3300025304 Bacteria 4956
112 Ga0207680_10794556 3300025903 Bacteria 678
113 Ga0207680_10950807 3300025903 Bacteria 616
114 Ga0207647_10014342 3300025904 Bacteria 5463
115 Ga0207705_10155297 3300025909 Bacteria 1716
116 Ga0207654_10170812 3300025911 Bacteria 1412
117 Ga0207695_10000059 3300025913 Bacteria 363920
118 Ga0207671_10014872 3300025914 Bacteria 6123
119 Ga0207657_10099964 3300025919 Bacteria 2409
120 Ga0207690_10218947 3300025932 Bacteria 1456
121 Ga0207706_10097267 3300025933 Bacteria 2589
122 Ga0207706_10438120 3300025933 Bacteria 1131
123 Ga0207709_10355016 3300025935 Bacteria 1108
124 Ga0207689_10067211 3300025942 Bacteria 2946
125 Ga0207667_10234673 3300025949 Bacteria 1878
126 Ga0207667_10694186 3300025949 Bacteria 1021
127 Ga0207651_10368107 3300025960 Bacteria 1215
128 Ga0207668_10042898 3300025972 Bacteria 3066
129 Ga0207668_10756149 3300025972 Bacteria 858
130 Ga0207640_10076363 3300025981 Bacteria 2274
131 Ga0207703_10192281 3300026035 Bacteria 1808
132 Ga0207703_10218390 3300026035 Bacteria 1703
133 Ga0207639_10831171 3300026041 Bacteria 862
134 Ga0207639_10883433 3300026041 Bacteria 835
135 Ga0207639_10996447 3300026041 Bacteria 785
136 Ga0207678_10166063 3300026067 Bacteria 1885
137 Ga0207678_10238991 3300026067 Bacteria 1556
138 Ga0207702_11088354 3300026078 Bacteria 793
139 Ga0207641_10289769 3300026088 Bacteria 1543
140 Ga0207641_10569978 3300026088 Bacteria 1106
141 Ga0207676_10354468 3300026095 Bacteria 1358
142 Ga0207674_10396353 3300026116 Bacteria 1334
143 Ga0207675_100259819 3300026118 Bacteria 1683
144 Ga0207683_10488681 3300026121 Bacteria 1136
145 Ga0209389_1000012 3300027296 Bacteria 213243
146 Ga0209489_100019 3300027361 Bacteria 213243
147 Ga0209700_100018 3300027363 Bacteria 238200
148 Ga0209813_10136175 3300027866 Bacteria 868
149 Ga0268266_10122450 3300028379 Bacteria 2316
150 Ga0268266_11005866 3300028379 Bacteria 807
151 Ga0268265_11017008 3300028380 Bacteria 819
152 Ga0268264_10254054 3300028381 Bacteria 1634
153 Ga0307510_10043829 3300033180 Bacteria 4856
154 Ga0307510_10198613 3300033180 Bacteria 1543
155 Ga0373925_0102810 3300037068 Bacteria 2199
156 Ga0395898_1293295 3300037466 Bacteria 659
157 Ga0395905_0049069 3300037471 Bacteria 3955
158 Ga0395905_0265428 3300037471 Bacteria 1602
159 Ga0436364_0191513 3300037853 Bacteria 2479
160 Ga0436365_0021689 3300039437 Bacteria 2086
161 Ga0451789_1289095 3300041443 Bacteria 733
162 Ga0451802_1311346 3300041460 Bacteria 713
163 Ga0451839_0168991 3300041496 Bacteria 954
164 Ga0466969_0051376 3300044656 Bacteria 2029
165 Ga0466972_0024078 3300044658 Bacteria 3022
166 Ga0466972_0114216 3300044658 Bacteria 1275
167 Ga0466965_0562220 3300044683 Bacteria 645
168 Ga0466961_0000042 3300044693 Bacteria 78589
169 Ga0466961_0311922 3300044693 Bacteria 960
170 Ga0466963_0086377 3300044694 Bacteria 2131
171 Ga0466968_0021328 3300044735 Bacteria 2622
172 Ga0466957_0229550 3300044842 Bacteria 1228
173 Ga0466960_0257140 3300044901 Bacteria 972
174 Ga0466960_0571911 3300044901 Bacteria 668
175 Ga0466959_0000575 3300045049 Bacteria 21390
176 Ga0466967_0048021 3300045976 Bacteria 3725
177 Ga0495592_0020925 3300046454 Bacteria 4976
178 Ga0495592_0215268 3300046454 Bacteria 1288
179 Ga0495603_0013593 3300046455 Bacteria 4925
180 Ga0495629_0018389 3300046459 Bacteria 5003
181 Ga0495638_0004707 3300046460 Bacteria 10308
182 Ga0495651_0002020 3300046462 Bacteria 15666
183 Ga0495651_0034182 3300046462 Bacteria 3963
184 Ga0495664_0044292 3300046477 Bacteria 2637
185 Ga0495664_0185523 3300046477 Bacteria 1261
186 Ga0495584_0102012 3300046491 Bacteria 1451
187 Ga0495596_0079747 3300046500 Bacteria 1271
188 Ga0495606_0035594 3300046507 Bacteria 3401
189 Ga0495606_0097418 3300046507 Bacteria 1797
190 Ga0495608_0014878 3300046511 Bacteria 5399
191 Ga0495610_0120419 3300046512 Bacteria 1151
192 Ga0495616_0208109 3300046513 Bacteria 857
193 Ga0495618_0060694 3300046514 Bacteria 2398
194 Ga0495620_0187330 3300046515 Bacteria 799
195 Ga0495628_0019170 3300046516 Bacteria 5658
196 Ga0495630_0094442 3300046517 Bacteria 2261
197 Ga0495632_0214611 3300046519 Bacteria 872
198 Ga0495643_0017327 3300046522 Bacteria 4212
199 Ga0495643_0351739 3300046522 Bacteria 660
200 Ga0495648_0011671 3300046524 Bacteria 6600
201 Ga0495648_0160618 3300046524 Bacteria 1162
202 Ga0495648_0283821 3300046524 Bacteria 783
203 Ga0495640_0031578 3300046533 Bacteria 3778
204 Ga0495640_0089750 3300046533 Bacteria 2029
205 Ga0495587_0006843 3300046536 Bacteria 7423
206 Ga0495645_0192345 3300046543 Bacteria 1389
207 Ga0495622_0008846 3300046557 Bacteria 4662
208 Ga0495622_0045097 3300046557 Bacteria 2049
209 Ga0495667_0025772 3300046559 Bacteria 3961
210 Ga0495668_0367280 3300046616 Bacteria 790
211 Ga0495634_0065246 3300046642 Bacteria 2413
212 Ga0495611_0113553 3300046648 Bacteria 1262
213 Ga0495625_0030363 3300046660 Bacteria 4034
214 Ga0495635_0014136 3300046663 Bacteria 5586
215 Ga0495635_0020076 3300046663 Bacteria 4657
216 Ga0495661_0193585 3300046665 Bacteria 1069
217 Ga0495588_0002921 3300046674 Bacteria 7373
218 Ga0495588_0336137 3300046674 Bacteria 794
219 Ga0495657_0005376 3300046675 Bacteria 10128
220 Ga0495599_0016790 3300046678 Bacteria 4547
221 Ga0495646_0169131 3300046680 Bacteria 1205
222 Ga0495613_0058368 3300046689 Bacteria 2832
223 Ga0495613_0263846 3300046689 Bacteria 1199
224 Ga0495649_0020001 3300046694 Bacteria 3757
225 Ga0495649_0176126 3300046694 Bacteria 1118
226 Ga0495589_0230869 3300046794 Bacteria 868
227 Ga0495600_0000770 3300046809 Bacteria 16882
228 Ga0495600_0066560 3300046809 Bacteria 2355
229 Ga0495660_0419475 3300046810 Bacteria 583
230 Ga0495581_0222020 3300047315 Bacteria 1105
231 Ga0495674_0011547 3300047319 Bacteria 8335
232 Ga0495674_0301208 3300047319 Bacteria 1309
233 Ga0495676_0094566 3300047321 Bacteria 2226
234 Ga0495680_0006952 3300047322 Bacteria 10441
235 Ga0495683_0043440 3300047323 Bacteria 2263
236 Ga0495687_062067 3300047443 Bacteria 1535
237 Ga0495675_0055756 3300047444 Bacteria 2506
238 Ga0495677_0262127 3300047445 Bacteria 677
239 Ga0495673_0067611 3300047469 Bacteria 1512
240 Ga0495686_0029179 3300047472 Bacteria 3590
241 Ga0495686_0048014 3300047472 Bacteria 2694
242 Ga0495593_0020065 3300047673 Bacteria 3743
243 Ga0495602_0014213 3300048088 Bacteria 8090
244 Ga0495626_0123591 3300048091 Bacteria 1110
245 Ga0496100_0553462 3300048903 Bacteria 890
246 Ga0496101_0686626 3300048904 Bacteria 808
247 Ga0496102_0022168 3300048905 Bacteria 5626
248 Ga0496102_0424817 3300048905 Bacteria 1248
249 Ga0496102_0600230 3300048905 Bacteria 1024
250 Ga0496103_0587943 3300048906 Bacteria 710
251 Ga0496104_0037820 3300048907 Bacteria 4512
252 Ga0496105_0010134 3300048908 Bacteria 7403
253 Ga0496106_0063580 3300048909 Bacteria 2805
254 Ga0496107_0091827 3300048910 Bacteria 2219
255 Ga0496108_0238398 3300048911 Bacteria 1582
256 Ga0496108_0602056 3300048911 Bacteria 958
257 Ga0496109_0454440 3300048912 Bacteria 1210
258 Ga0496109_0472059 3300048912 Bacteria 1185
259 Ga0496111_0021126 3300048914 Bacteria 4542
260 Ga0496112_0099269 3300048915 Bacteria 2881
261 Ga0496112_0113578 3300048915 Bacteria 2679
262 Ga0496113_0143365 3300048916 Bacteria 1881
263 Ga0496113_0660726 3300048916 Bacteria 835
264 Ga0496115_0037528 3300048918 Bacteria 3840
265 Ga0496115_0322158 3300048918 Bacteria 1264
266 Ga0496115_0417173 3300048918 Bacteria 1088
267 Ga0496116_0038995 3300048919 Bacteria 3290
268 Ga0496118_0017354 3300048921 Bacteria 6554
269 Ga0496118_0074983 3300048921 Bacteria 2415
270 Ga0496118_0314229 3300048921 Bacteria 853
271 Ga0496119_0007586 3300048922 Bacteria 9733
272 Ga0496119_0185841 3300048922 Bacteria 1086
273 Ga0496120_0018673 3300048923 Bacteria 4460
274 Ga0496121_0173381 3300048924 Bacteria 1564
275 Ga0496121_0228861 3300048924 Bacteria 1303
276 Ga0496122_0201578 3300048925 Bacteria 1163
277 Ga0496123_0153805 3300048926 Bacteria 1237
278 Ga0496124_0052632 3300048927 Bacteria 3458
279 Ga0496125_0035616 3300048928 Bacteria 4361
280 Ga0496125_0162551 3300048928 Bacteria 1514
281 Ga0496126_0044976 3300048929 Bacteria 4061
282 Ga0496126_0060662 3300048929 Bacteria 3400
283 Ga0496126_0579243 3300048929 Bacteria 887
284 Ga0496126_0652581 3300048929 Bacteria 823
285 Ga0495682_0007237 3300049460 Bacteria 4429
286 Ga0495682_0242815 3300049460 Bacteria 637
287 nmdc:mga00v17_171515_c1 3300050491 Bacteria 1399
288 nmdc:mga0yw44_270289_c1 3300050492 Bacteria 1135
289 nmdc:mga0k408_52233_c1 3300050493 Bacteria 2369
290 nmdc:mga0k408_81043_c1 3300050493 Bacteria 1136
291 nmdc:mga06z11_362206_c1 3300050494 Bacteria 869
292 nmdc:mga06z11_87193_c1 3300050494 Bacteria 1688
293 nmdc:mga04h51_45234_c1 3300050495 Bacteria 1455
294 nmdc:mga07m45_22107_c1 3300050496 Bacteria 3471
295 nmdc:mga07m45_556411_c1 3300050496 Bacteria 663
296 nmdc:mga07m45_60749_c1 3300050496 Bacteria 2140
297 nmdc:mga07m45_85086_c1 3300050496 Bacteria 1808
298 nmdc:mga0sz30_16135_c1 3300050516 Bacteria 2960
299 nmdc:mga0sz30_66959_c1 3300050516 Bacteria 1542
300 Ga0500635_0005187 3300053080 Bacteria 3399
301 Ga0495655_0012913 3300053083 Bacteria 1714
302 Ga0495655_0116823 3300053083 Bacteria 808
303 Ga0495595_0249071 3300053084 Bacteria 889
304 Ga0495619_0743880 3300053085 Bacteria 665
305 Ga0500578_0138234 3300053086 Bacteria 1524
306 Ga0500578_0303427 3300053086 Bacteria 946
307 Ga0500578_0372134 3300053086 Bacteria 830
308 Ga0500643_000111 3300053087 Bacteria 85038
309 Ga0500583_0299915 3300053092 Bacteria 786
310 Ga0500566_0000610 3300053094 Bacteria 20102
311 Ga0500555_002537 3300053103 Bacteria 5266
312 Ga0500557_000065 3300053105 Bacteria 41931
313 Ga0500572_112877 3300053111 Bacteria 875
314 Ga0500595_061073 3300053119 Bacteria 1138
315 Ga0500642_0000079 3300053130 Bacteria 52621
316 Ga0500658_0327386 3300053134 Bacteria 704
317 Ga0500559_0050794 3300053136 Bacteria 1830
318 Ga0500564_026302 3300053138 Bacteria 2675
319 Ga0500568_0065217 3300053139 Bacteria 1402
320 Ga0500577_0027644 3300053142 Bacteria 1945
321 Ga0500577_0238273 3300053142 Bacteria 789
322 Ga0500589_067319 3300053147 Bacteria 1628
323 Ga0500590_140979 3300053148 Bacteria 1101
324 Ga0500616_0064213 3300053153 Bacteria 1891
325 Ga0500634_0070391 3300053161 Bacteria 1832
326 Ga0500638_046700 3300053162 Bacteria 2098
327 Ga0500638_117457 3300053162 Bacteria 1221
328 Ga0500639_142509 3300053163 Bacteria 1118
329 Ga0500636_0000057 3300053177 Bacteria 53579
330 Ga0500636_0300342 3300053177 Bacteria 791
331 Ga0500636_0361075 3300053177 Bacteria 689
332 Ga0500625_001029 3300053729 Bacteria 8935
333 Ga0500645_013409 3300053730 Bacteria 2630
334 Ga0500609_020102 3300053731 Bacteria 910
335 Ga0500599_005920 3300053736 Bacteria 1548
336 Ga0500601_000933 3300053737 Bacteria 3473
337 2888378742 2888378607 Bacteria 9652610
338 2507505803 2507262055 Bacteria 8048963
339 2508539996 2508501009 Bacteria 7784016
340 2508696068 2508501042 Bacteria 8719808
341 2511396490 2511231028 Bacteria 8046582
342 2513626983 2513237092 Bacteria 8341956
343 2513638890 2513237094 Bacteria 8789602
344 2513652401 2513237095 Bacteria 8976980
345 2513715489 2513237104 Bacteria 10034502
346 2513875478 2513237139 Bacteria 8737671
347 2514011144 2513237161 Bacteria 8871253
348 2517105787 2517093001 Bacteria 9002274
349 2524435519 2524023205 Bacteria 8918781
350 2528851083 2528768022 Bacteria 10457665
351 2617347684 2617270735 Bacteria 9163226
352 2617374599 2617270741 Bacteria 8201522
353 2745079775 2744054633 Bacteria 8678936
354 2793063666 2791355196 Bacteria 7323613
355 2805921166 2802429603 Bacteria 8777136
356 2818240770 2816332527 Bacteria 8933356
357 2824603532 2824600985 Bacteria 8488197
358 2824610923 2824609381 Bacteria 8672835
359 2824653976 2824653114 Bacteria 8493680
360 2824676258 2824671348 Bacteria 8369588
361 2824681796 2824679649 Bacteria 8248951
362 2824692572 2824687955 Bacteria 8360029
363 2824700862 2824696289 Bacteria 8335049
364 2824710813 2824704595 Bacteria 9667483
365 2824734992 2824732956 Bacteria 7810675
366 2824750429 2824746037 Bacteria 7911610
367 2824754929 2824753945 Bacteria 9787441
368 2824765217 2824763712 Bacteria 9792355
369 2824775842 2824773399 Bacteria 8360218
370 2838129277 2838122688 Bacteria 8803140
371 2841945953 2841941048 Bacteria 8688029
372 2841957633 2841949485 Bacteria 8680857
373 2841963363 2841957949 Bacteria 8652217
374 2841968877 2841966195 Bacteria 8673214
375 2841979601 2841974524 Bacteria 8931498
376 2841989753 2841983080 Bacteria 8395090
377 2842044271 2842038055 Bacteria 8002051
378 2842051740 2842045827 Bacteria 8006841
379 2844321593 2844315083 Bacteria 8138177
380 2847939573 2847930680 Bacteria 9342022
381 2847941377 2847939898 Bacteria 8606328
382 2874620131 2874612657 Bacteria 8252029
383 2874622341 2874620515 Bacteria 8290088
384 2876762301 2876761206 Bacteria 10111113
385 2879091431 2879083081 Bacteria 8587928
386 2879100706 2879099564 Bacteria 10442239
387 2888390060 2888388044 Bacteria 7304136
388 2888420991 2888419890 Bacteria 7857137
389 2903727832 2903727486 Bacteria 8281579
390 2904671652 2904666416 Bacteria 8226587
391 2904714405 2904711408 Bacteria 9771557
392 2906602683 2906602504 Bacteria 8295279
393 2906627211 2906626472 Bacteria 8826946
394 2908777078 2908775508 Bacteria 8092255
395 2922377618
396 2922398677 2922393267 Bacteria 8285685
397 2929622395 2929615660 Bacteria 9193770
398 2929629959 2929624759 Bacteria 9339455
399 2932788115 2932784394 Bacteria 9704911
400 2932794903 2932794094 Bacteria 7915132
401 2932805303 2932801729 Bacteria 7987968
402 2932813491 2932809354 Bacteria 9135765
403 2932820188 2932818245 Bacteria 9955613
404 2932832749 2932828146 Bacteria 9745859
405 2933583991 2933577622 Bacteria 9116884
406 2935614857 2935608549 Bacteria 8203142
407 2935620237 2935616580 Bacteria 9032984
408 2935640559 2935638405 Bacteria 10015038
409 2935649256 2935648319 Bacteria 8801166
410 2935657972 2935656913 Bacteria 8965014
411 2935668751 2935665750 Bacteria 9571747
412 2935682049 2935675223 Bacteria 9928132
413 2935687057 2935684952 Bacteria 9590419
414 2935696972 2935694250 Bacteria 9291695
415 2935709739 2935703347 Bacteria 10242284
416 2935716745 2935713505 Bacteria 9608509
417 2935723130 2935722832 Bacteria 9608746
418 2935734687 2935732158 Bacteria 9706831
419 2935744522 2935741537 Bacteria 9707219
420 2935753023 2935750917 Bacteria 9590372
421 2935766919 2935760218 Bacteria 9817913
422 2935804669 2935801545 Bacteria 9301974
423 2935815820 2935810662 Bacteria 9401221
424 2935826103 2935819856 Bacteria 8261050
425 2935832065 2935827899 Bacteria 10038562
426 2935841105 2935837841 Bacteria 9454360
427 2935853599 2935847175 Bacteria 8228321
428 2935859123 2935855204 Bacteria 9035059
429 2935864307 2935864058 Bacteria 9784707
430 2935875341 2935873716 Bacteria 9632195
431 2935887614 2935883170 Bacteria 7964738
432 2935910822 2935908558 Bacteria 8568796
433 2935922004 2935916978 Bacteria 9113783
434 2935929859 2935926038 Bacteria 8601059
435 2935937527 2935934488 Bacteria 8602579
436 2935948074 2935942939 Bacteria 8599779
437 2935957705 2935951376 Bacteria 8602333
438 2935971016 2935967501 Bacteria 8603075
439 2935985534 2935984226 Bacteria 8302647
440 2935995681 2935992306 Bacteria 9802711
441 2936008098 2936002035 Bacteria 9362176
442 2936012191 2936011229 Bacteria 8801034
443 2936020728 2936019824 Bacteria 8804134
444 2936029484 2936028420 Bacteria 8965941
445 2936041722 2936037263 Bacteria 9446081
446 2936048192 2936046547 Bacteria 8903709
447 2936056696 2936055302 Bacteria 8785755
448 2940558936 2940556831 Bacteria 9590747
449 2941541633 2941538514 Bacteria 9402094
450 3005485935 3005483717 Bacteria 7877331
451 3005601962 3005594810 Bacteria 8716512
452 3005717696 3005710791 Bacteria 7622528
453 3005724744 3005718088 Bacteria 8283608
454 8016517479 8016511872 Bacteria 9921665
455 8016526819 8016522445 Bacteria 8156687
456 8016531909 8016530956 Bacteria 8155261
457 8016545113 8016539877 Bacteria 8155419
458 8016556966 8016548790 Bacteria 8155074
459 8016565313 8016557553 Bacteria 8154380
460 8016570194 8016566248 Bacteria 8158151
461 8016582753 8016575299 Bacteria 8154085
462 8016585548 8016583857 Bacteria 10421953
463 8016602956 8016595262 Bacteria 8149947
464 8016605841 8016603502 Bacteria 8731218
465 8016617742 8016613128 Bacteria 8794220
466 8016623831 8016622563 Bacteria 7999408
467 8017059137 8017057580 Bacteria 10023680
468 8019531730 8019530166 Bacteria 8155624
469 8019539800 8019538911 Bacteria 7872763
470 8019550853 8019547302 Bacteria 7996444
471 8019576498 8019576017 Bacteria 10049540
472 8019594369 8019586578 Bacteria 10212056
473 8019607193 8019597564 Bacteria 10041141
474 8019611320 8019608314 Bacteria 10042931
475 8019651828 8019648815 Bacteria 10014479
476 8019695597 8019687851 Bacteria 8712826
477 8055743355 8055742211 Bacteria 9226248
478 8056975467 8056967851 Bacteria 9038162
479 JGI25153J46596_10000729
480 JGI25153J46596_10002323
481 rootH1_10008525
482 JGI25160J50197_1000623
483 JGI25160J50197_1001838
484 Ga0055531_10002783
485 Ga0065165_1001117
486 Ga0065165_1003342
487 Ga0070660_100408339
488 Ga0070660_101053725
489 Ga0070669_100506626
490 Ga0070671_100040642
491 Ga0070673_100954735
492 Ga0070659_100306369
493 Ga0070711_100410002
494 Ga0070663_100047035
495 Ga0070663_100124738
496 Ga0070678_100164729
497 Ga0070662_100093092
498 Ga0070662_100341640
499 Ga0068867_100225017
500 Ga0070684_101180684
501 Ga0068853_100901902
502 Ga0070665_100016137
503 Ga0070665_100723062
504 Ga0070665_101298299
505 Ga0068855_100911957
506 Ga0068855_101058120
507 Ga0068857_100377614
508 Ga0068854_100122693
509 Ga0068856_100357289
510 Ga0068856_101201179
511 Ga0068852_100050037
512 Ga0068852_100188898
513 Ga0068863_100374069
514 Ga0068860_100858161
515 Ga0081540_1009713
516 Ga0070717_10744578
517 Ga0075365_10054817
518 Ga0075365_10056862
519 Ga0075368_10071204
520 Ga0075362_10012683
521 Ga0075367_10079989
522 Ga0075367_10209607
523 Ga0075367_10410818
524 Ga0075369_10056161
525 Ga0075366_10046501
526 Ga0075366_10436777
527 Ga0075370_10037231
528 Ga0075370_10086625
529 Ga0068865_100427000
530 Ga0099825_1034943
531 Ga0099823_1025375
532 Ga0105240_10001242
533 Ga0105245_10314895
534 Ga0105243_10236446
535 Ga0105243_10542467
536 Ga0105241_10027436
537 Ga0105241_10129922
538 Ga0105242_10545977
539 Ga0105248_10266660
540 Ga0105248_10913720
541 Ga0105237_10025811
542 Ga0105237_10161490
543 Ga0105238_11195621
544 Ga0105239_10038756
545 Ga0105239_10092492
546 Ga0105239_10197721
547 Ga0105246_10035640
548 Ga0157374_10358410
549 Ga0157372_11853735
550 Ga0157375_10180702
551 Ga0157375_10352976
552 Ga0163163_10051237
553 Ga0163163_10584356
554 Ga0157377_10182407
555 Ga0157379_10408480
556 Ga0157379_10914920
557 Ga0157376_10311026
558 Ga0157376_10550136
559 Ga0163161_10533835
560 Ga0214544_1000003
561 Ga0214542_1000022
562 Ga0214545_1000010
563 Ga0214543_1000035
564 Ga0213875_10324488
565 Ga0209563_101925
566 Ga0209677_102159
567 Ga0209148_1000270
568 Ga0209233_1009530
569 Ga0209233_1009923
570 Ga0209233_1012547
571 Ga0209233_1055017
572 Ga0209455_1007179
573 Ga0209758_1000015
574 Ga0209758_1000306
575 Ga0209758_1000458
576 Ga0209758_1007078
577 Ga0209758_1012779
578 Ga0209256_1004376
579 Ga0209256_1018865
580 Ga0209256_1047085
581 Ga0207426_1000217
582 Ga0207426_1001044
583 Ga0207426_1004208
584 Ga0207426_1023117
585 Ga0207426_1043842
586 Ga0209051_1031066
587 Ga0209051_1048818
588 Ga0209257_1000960
589 Ga0209257_1009918
590 Ga0207680_10794556
591 Ga0207680_10950807
592 Ga0207647_10014342
593 Ga0207705_10155297
594 Ga0207654_10170812
595 Ga0207695_10000059
596 Ga0207671_10014872
597 Ga0207657_10099964
598 Ga0207690_10218947
599 Ga0207706_10097267
600 Ga0207706_10438120
601 Ga0207709_10355016
602 Ga0207689_10067211
603 Ga0207667_10234673
604 Ga0207667_10694186
605 Ga0207651_10368107
606 Ga0207668_10042898
607 Ga0207668_10756149
608 Ga0207640_10076363
609 Ga0207703_10192281
610 Ga0207703_10218390
611 Ga0207639_10831171
612 Ga0207639_10883433
613 Ga0207639_10996447
614 Ga0207678_10166063
615 Ga0207678_10238991
616 Ga0207702_11088354
617 Ga0207641_10289769
618 Ga0207641_10569978
619 Ga0207676_10354468
620 Ga0207674_10396353
621 Ga0207675_100259819
622 Ga0207683_10488681
623 Ga0209389_1000012
624 Ga0209489_100019
625 Ga0209700_100018
626 Ga0209813_10136175
627 Ga0268266_10122450
628 Ga0268266_11005866
629 Ga0268265_11017008
630 Ga0268264_10254054
631 Ga0307510_10043829
632 Ga0307510_10198613
633 Ga0373925_0102810
634 Ga0395898_1293295
635 Ga0395905_0049069
636 Ga0395905_0265428
637 Ga0436364_0191513
638 Ga0436365_0021689
639 Ga0451789_1289095
640 Ga0451802_1311346
641 Ga0451839_0168991
642 Ga0466969_0051376
643 Ga0466972_0024078
644 Ga0466972_0114216
645 Ga0466965_0562220
646 Ga0466961_0000042
647 Ga0466961_0311922
648 Ga0466963_0086377
649 Ga0466968_0021328
650 Ga0466957_0229550
651 Ga0466960_0257140
652 Ga0466960_0571911
653 Ga0466959_0000575
654 Ga0466967_0048021
655 Ga0495592_0020925
656 Ga0495592_0215268
657 Ga0495603_0013593
658 Ga0495629_0018389
659 Ga0495638_0004707
660 Ga0495651_0002020
661 Ga0495651_0034182
662 Ga0495664_0044292
663 Ga0495664_0185523
664 Ga0495584_0102012
665 Ga0495596_0079747
666 Ga0495606_0035594
667 Ga0495606_0097418
668 Ga0495608_0014878
669 Ga0495610_0120419
670 Ga0495616_0208109
671 Ga0495618_0060694
672 Ga0495620_0187330
673 Ga0495628_0019170
674 Ga0495630_0094442
675 Ga0495632_0214611
676 Ga0495643_0017327
677 Ga0495643_0351739
678 Ga0495648_0011671
679 Ga0495648_0160618
680 Ga0495648_0283821
681 Ga0495640_0031578
682 Ga0495640_0089750
683 Ga0495587_0006843
684 Ga0495645_0192345
685 Ga0495622_0008846
686 Ga0495622_0045097
687 Ga0495667_0025772
688 Ga0495668_0367280
689 Ga0495634_0065246
690 Ga0495611_0113553
691 Ga0495625_0030363
692 Ga0495635_0014136
693 Ga0495635_0020076
694 Ga0495661_0193585
695 Ga0495588_0002921
696 Ga0495588_0336137
697 Ga0495657_0005376
698 Ga0495599_0016790
699 Ga0495646_0169131
700 Ga0495613_0058368
701 Ga0495613_0263846
702 Ga0495649_0020001
703 Ga0495649_0176126
704 Ga0495589_0230869
705 Ga0495600_0000770
706 Ga0495600_0066560
707 Ga0495660_0419475
708 Ga0495581_0222020
709 Ga0495674_0011547
710 Ga0495674_0301208
711 Ga0495676_0094566
712 Ga0495680_0006952
713 Ga0495683_0043440
714 Ga0495687_062067
715 Ga0495675_0055756
716 Ga0495677_0262127
717 Ga0495673_0067611
718 Ga0495686_0029179
719 Ga0495686_0048014
720 Ga0495593_0020065
721 Ga0495602_0014213
722 Ga0495626_0123591
723 Ga0496100_0553462
724 Ga0496101_0686626
725 Ga0496102_0022168
726 Ga0496102_0424817
727 Ga0496102_0600230
728 Ga0496103_0587943
729 Ga0496104_0037820
730 Ga0496105_0010134
731 Ga0496106_0063580
732 Ga0496107_0091827
733 Ga0496108_0238398
734 Ga0496108_0602056
735 Ga0496109_0454440
736 Ga0496109_0472059
737 Ga0496111_0021126
738 Ga0496112_0099269
739 Ga0496112_0113578
740 Ga0496113_0143365
741 Ga0496113_0660726
742 Ga0496115_0037528
743 Ga0496115_0322158
744 Ga0496115_0417173
745 Ga0496116_0038995
746 Ga0496118_0017354
747 Ga0496118_0074983
748 Ga0496118_0314229
749 Ga0496119_0007586
750 Ga0496119_0185841
751 Ga0496120_0018673
752 Ga0496121_0173381
753 Ga0496121_0228861
754 Ga0496122_0201578
755 Ga0496123_0153805
756 Ga0496124_0052632
757 Ga0496125_0035616
758 Ga0496125_0162551
759 Ga0496126_0044976
760 Ga0496126_0060662
761 Ga0496126_0579243
762 Ga0496126_0652581
763 Ga0495682_0007237
764 Ga0495682_0242815
765 nmdc:mga00v17_171515_c1
766 nmdc:mga0yw44_270289_c1
767 nmdc:mga0k408_52233_c1
768 nmdc:mga0k408_81043_c1
769 nmdc:mga06z11_362206_c1
770 nmdc:mga06z11_87193_c1
771 nmdc:mga04h51_45234_c1
772 nmdc:mga07m45_22107_c1
773 nmdc:mga07m45_556411_c1
774 nmdc:mga07m45_60749_c1
775 nmdc:mga07m45_85086_c1
776 nmdc:mga0sz30_16135_c1
777 nmdc:mga0sz30_66959_c1
778 Ga0500635_0005187
779 Ga0495655_0012913
780 Ga0495655_0116823
781 Ga0495595_0249071
782 Ga0495619_0743880
783 Ga0500578_0138234
784 Ga0500578_0303427
785 Ga0500578_0372134
786 Ga0500643_000111
787 Ga0500583_0299915
788 Ga0500566_0000610
789 Ga0500555_002537
790 Ga0500557_000065
791 Ga0500572_112877
792 Ga0500595_061073
793 Ga0500642_0000079
794 Ga0500658_0327386
795 Ga0500559_0050794
796 Ga0500564_026302
797 Ga0500568_0065217
798 Ga0500577_0027644
799 Ga0500577_0238273
800 Ga0500589_067319
801 Ga0500590_140979
802 Ga0500616_0064213
803 Ga0500634_0070391
804 Ga0500638_046700
805 Ga0500638_117457
806 Ga0500639_142509
807 Ga0500636_0000057
808 Ga0500636_0300342
809 Ga0500636_0361075
810 Ga0500625_001029
811 Ga0500645_013409
812 Ga0500609_020102
813 Ga0500599_005920
814 Ga0500601_000933
815 2888378742
816 2507505803
817 2508539996
818 2508696068
819 2511396490
820 2513626983
821 2513638890
822 2513652401
823 2513715489
824 2513875478
825 2514011144
826 2517105787
827 2524435519
828 2528851083
829 2617347684
830 2617374599
831 2745079775
832 2793063666
833 2805921166
834 2818240770
835 2824603532
836 2824610923
837 2824653976
838 2824676258
839 2824681796
840 2824692572
841 2824700862
842 2824710813
843 2824734992
844 2824750429
845 2824754929
846 2824765217
847 2824775842
848 2838129277
849 2841945953
850 2841957633
851 2841963363
852 2841968877
853 2841979601
854 2841989753
855 2842044271
856 2842051740
857 2844321593
858 2847939573
859 2847941377
860 2874620131
861 2874622341
862 2876762301
863 2879091431
864 2879100706
865 2888390060
866 2888420991
867 2903727832
868 2904671652
869 2904714405
870 2906602683
871 2906627211
872 2908777078
873 2922377618
874 2922398677
875 2929622395
876 2929629959
877 2932788115
878 2932794903
879 2932805303
880 2932813491
881 2932820188
882 2932832749
883 2933583991
884 2935614857
885 2935620237
886 2935640559
887 2935649256
888 2935657972
889 2935668751
890 2935682049
891 2935687057
892 2935696972
893 2935709739
894 2935716745
895 2935723130
896 2935734687
897 2935744522
898 2935753023
899 2935766919
900 2935804669
901 2935815820
902 2935826103
903 2935832065
904 2935841105
905 2935853599
906 2935859123
907 2935864307
908 2935875341
909 2935887614
910 2935910822
911 2935922004
912 2935929859
913 2935937527
914 2935948074
915 2935957705
916 2935971016
917 2935985534
918 2935995681
919 2936008098
920 2936012191
921 2936020728
922 2936029484
923 2936041722
924 2936048192
925 2936056696
926 2940558936
927 2941541633
928 3005485935
929 3005601962
930 3005717696
931 3005724744
932 8016517479
933 8016526819
934 8016531909
935 8016545113
936 8016556966
937 8016565313
938 8016570194
939 8016582753
940 8016585548
941 8016602956
942 8016605841
943 8016617742
944 8016623831
945 8017059137
946 8019531730
947 8019539800
948 8019550853
949 8019576498
950 8019594369
951 8019607193
952 8019611320
953 8019651828
954 8019695597
955 8055743355
956 8056975467

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2iaw-assembly1.cif.gz_A crystal structure of squid ganglion dfpase n175d mutant 0.6945 51 74
3hav-assembly2.cif.gz_B "structure of the streptomycin-atp-aph(2"")-iia ternary complex" 0.6601 36 66
6szz-assembly1.cif.gz_A crystal structure of cold shock protein b (cspb) containing the modified residue 4-f-trp 0.6199 41 69
7eq5-assembly2.cif.gz_B plant growth-promoting factor yxal mutant from bacillus velezensis - t175w/w215g 0.6009 49 76
3pqh-assembly1.cif.gz_A crystal structure of the c-terminal fragment of the bacteriophage phi92 membrane-piercing protein gp138 0.5962 40 71
ID Description Score Start End Superfamily
af_Q0IYV3_96_397_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7902 50 72 2.130.10.10
af_Q9N595_21_743_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7734 50 74 2.130.10.10
af_Q9SRV0_53_302_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7567 50 68 2.130.10.10
af_Q63132_694_914_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7555 49 77 2.120.10.30
af_Q6PDZ2_223_490_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.743 50 77 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A1I3M337-F1-model_v4 SUKH-4 immunity protein 0.8978 1 184
AF-A0A6B2DTS5-F1-model_v4 SUKH-4 family immunity protein 0.8954 4 164
AF-A0A837C5D0-F1-model_v4 Uncharacterized protein 0.8952 1 184
AF-A0A837C5D0-F1-model_v4 Uncharacterized protein 0.8905 1 184
AF-R1GG05-F1-model_v4 SUKH-4 immunity protein 0.8898 4 164

Map