F451818

General Info

Members Datasets Scaffolds Average Seq Length
477 263 955 156

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3006321560|3006322012
Length 178
Sequence QMVKQEASPEQEQHEQHGQQEQQRESRQEAARRASAAARCEAPSPYPRPDGSDQYTISEVAELTGLSAHTLRWYERIGLMPHVGRSTTGQRRFSNRDLDWLAFVGKLRLTGMPVADMVTYAEMVRAGQRTFAQRKELLEATRVDVVQRIAELQDTLTVLDHKIATYAGAEPAPERTGA

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
7 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
11 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
12 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
13 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
14 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
15 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
16 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
17 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
18 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
19 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
22 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
34 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
35 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
36 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
37 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
38 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
39 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
40 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
41 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
42 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
43 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
44 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
45 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
46 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
47 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
48 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
49 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
50 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
51 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
52 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
53 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
54 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
55 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
56 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
57 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
58 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
59 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
60 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
61 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
62 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
63 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
64 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
65 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
66 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
69 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
70 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
71 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
72 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
73 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
74 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
75 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
76 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
77 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
78 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
79 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
80 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
81 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
82 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
83 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
84 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
85 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
86 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
87 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
88 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
89 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
90 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
91 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
92 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
93 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
94 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
95 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
96 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
97 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
100 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
101 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
102 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
103 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
104 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
109 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
113 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
114 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
119 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
132 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
135 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
136 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
137 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
138 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
143 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
150 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
184 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
185 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
186 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
187 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
188 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
189 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
190 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
191 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
192 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
193 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
194 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
195 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
196 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
197 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
198 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
199 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
200 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
201 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
202 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
203 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
204 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
205 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
206 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
207 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
208 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
209 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
213 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
214 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
215 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
216 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
217 2643221548 Streptomyces sp. Root55 Isolate Unclassified
218 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
219 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
220 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
221 2643221714 Streptomyces sp. Root264 Isolate Unclassified
222 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
223 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
224 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
225 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
226 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
227 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
228 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
229 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
230 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
231 2867428634 Streptomyces sp. RP5T Isolate Unclassified
232 2867475112 Streptomyces sp. TM32 Isolate Unclassified
233 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
234 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
235 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
236 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
237 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
238 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
239 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
240 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
241 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
242 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
243 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
244 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
245 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
246 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
247 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
248 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
249 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
250 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
251 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
252 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
253 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
254 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
255 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
256 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
257 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
258 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
259 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
260 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
261 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
262 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
263 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.31
Metatranscriptomes 0
Isolates 10.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.76
Nodule 0.21
Rhizoplane 1.05
Rhizosphere 80.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10021071 3300001989 Bacteria 2324
2 JGI24737J22298_10062213 3300001990 Bacteria 1122
3 rootH1_10033851 3300003316 Bacteria 2529
4 rootH1_10033851 3300003323 Bacteria 2311
5 JGI25160J50197_1010362 3300003354 Bacteria 3375
6 JGI25160J50197_1012265 3300003354 Bacteria 2987
7 JGI25160J50197_1029839 3300003354 Bacteria 1433
8 Ga0070688_101248401 3300005365 Bacteria 598
9 Ga0070663_101013905 3300005455 Bacteria 722
10 Ga0070685_10126949 3300005466 Bacteria 1590
11 Ga0070665_100602996 3300005548 Bacteria 1111
12 Ga0081455_10175698 3300005937 Bacteria 1626
13 Ga0075363_100205618 3300006048 Bacteria 1126
14 Ga0075370_10214717 3300006353 Bacteria 1136
15 Ga0105251_10021931 3300009011 Bacteria 3325
16 Ga0105244_10520926 3300009036 Bacteria 548
17 Ga0105250_10037304 3300009092 Bacteria 1950
18 Ga0105243_10062330 3300009148 Bacteria 2985
19 Ga0105243_10394672 3300009148 Bacteria 1283
20 Ga0105248_10289597 3300009177 Bacteria 1844
21 Ga0105238_10518485 3300009551 Bacteria 1194
22 Ga0105239_10310512 3300010375 Bacteria 1777
23 Ga0105246_10063335 3300011119 Bacteria 2579
24 Ga0105246_10305927 3300011119 Bacteria 1286
25 Ga0157369_10147148 3300013105 Bacteria 2490
26 Ga0207426_1002223 3300025302 Bacteria 12988
27 Ga0207426_1007175 3300025302 Bacteria 4705
28 Ga0207426_1059457 3300025302 Bacteria 1105
29 Ga0207696_1027985 3300025711 Bacteria 1733
30 Ga0207713_1019361 3300025735 Bacteria 3331
31 Ga0207647_10007793 3300025904 Bacteria 7709
32 Ga0207707_10285573 3300025912 Bacteria 1428
33 Ga0207694_10597823 3300025924 Bacteria 928
34 Ga0207700_11303678 3300025928 Bacteria 647
35 Ga0207709_10070669 3300025935 Bacteria 2214
36 Ga0207711_10275128 3300025941 Bacteria 1550
37 Ga0207639_10020409 3300026041 Bacteria 4742
38 Ga0209371_1014295 3300027312 Bacteria 2183
39 Ga0268266_10400924 3300028379 Bacteria 1297
40 Ga0268266_10557960 3300028379 Bacteria 1098
41 Ga0307517_10055706 3300028786 Bacteria 3875
42 Ga0307515_10000262 3300028794 Bacteria 130525
43 Ga0268256_1015844 3300030500 Bacteria 2183
44 Ga0307511_10187872 3300030521 Bacteria 1098
45 Ga0307511_10194632 3300030521 Bacteria 1065
46 Ga0307512_10003287 3300030522 Bacteria 19019
47 Ga0307513_10183532 3300031456 Bacteria 1952
48 Ga0307513_10214396 3300031456 Bacteria 1753
49 Ga0307509_10452827 3300031507 Bacteria 977
50 Ga0307508_10003146 3300031616 Bacteria 16895
51 Ga0307508_10004366 3300031616 Bacteria 13825
52 Ga0307508_10011423 3300031616 Bacteria 8119
53 Ga0307508_10024355 3300031616 Bacteria 5493
54 Ga0307514_10083805 3300031649 Bacteria 2348
55 Ga0307514_10120805 3300031649 Bacteria 1828
56 Ga0307514_10142495 3300031649 Bacteria 1626
57 Ga0307514_10202420 3300031649 Bacteria 1245
58 Ga0307516_10007840 3300031730 Bacteria 12175
59 Ga0307516_10229262 3300031730 Bacteria 1562
60 Ga0307516_10305994 3300031730 Bacteria 1264
61 Ga0307516_10326667 3300031730 Bacteria 1204
62 Ga0307405_10860069 3300031731 Bacteria 764
63 Ga0307410_10202267 3300031852 Bacteria 1517
64 Ga0307409_100237818 3300031995 Bacteria 1656
65 Ga0307416_100721347 3300032002 Bacteria 1087
66 Ga0307507_10050253 3300033179 Bacteria 4028
67 Ga0307507_10166871 3300033179 Bacteria 1611
68 Ga0307510_10021894 3300033180 Bacteria 7437
69 Ga0307510_10035955 3300033180 Bacteria 5521
70 Ga0395900_0495741 3300037418 Bacteria 1172
71 Ga0395898_0068921 3300037466 Bacteria 3423
72 Ga0395901_0271540 3300038443 Bacteria 1764
73 Ga0395901_1430314 3300038443 Bacteria 649
74 Ga0451837_0441292 3300041494 Bacteria 6692
75 Ga0451853_1415414 3300041512 Bacteria 2046
76 Ga0439448_0070772 3300042005 Bacteria 1162
77 Ga0450895_008938 3300042132 Bacteria 844
78 Ga0450906_000131 3300042145 Bacteria 13303
79 Ga0439458_0004847 3300042157 Bacteria 3054
80 Ga0439458_0095122 3300042157 Bacteria 769
81 Ga0450901_019858 3300042533 Bacteria 717
82 Ga0466965_0577043 3300044683 Bacteria 637
83 Ga0466961_0017828 3300044693 Bacteria 4563
84 Ga0466963_0000196 3300044694 Bacteria 25509
85 Ga0466963_0723075 3300044694 Bacteria 702
86 Ga0466971_0085327 3300044719 Bacteria 1443
87 Ga0466971_0170603 3300044719 Bacteria 1021
88 Ga0466968_0356787 3300044735 Bacteria 711
89 Ga0466970_0003680 3300044765 Bacteria 7483
90 Ga0466957_0020111 3300044842 Bacteria 3929
91 Ga0466960_0029308 3300044901 Bacteria 2525
92 Ga0466967_0092774 3300045976 Bacteria 2746
93 Ga0466967_0616526 3300045976 Bacteria 1071
94 Ga0495617_098056 3300046452 Bacteria 953
95 Ga0495627_052524 3300046453 Bacteria 1222
96 Ga0495627_063265 3300046453 Bacteria 1091
97 Ga0495592_0340402 3300046454 Bacteria 964
98 Ga0495603_0001858 3300046455 Bacteria 12437
99 Ga0495603_0002751 3300046455 Bacteria 10361
100 Ga0495603_0003796 3300046455 Bacteria 8994
101 Ga0495603_0217952 3300046455 Bacteria 1101
102 Ga0495603_0572813 3300046455 Bacteria 646
103 Ga0495629_0006991 3300046459 Bacteria 8314
104 Ga0495629_0062447 3300046459 Bacteria 2602
105 Ga0495629_0063842 3300046459 Bacteria 2571
106 Ga0495629_0066724 3300046459 Bacteria 2511
107 Ga0495629_0073360 3300046459 Bacteria 2390
108 Ga0495629_0095786 3300046459 Bacteria 2070
109 Ga0495638_0008299 3300046460 Bacteria 7375
110 Ga0495638_0047886 3300046460 Bacteria 2678
111 Ga0495638_0077691 3300046460 Bacteria 2021
112 Ga0495651_0102108 3300046462 Bacteria 2133
113 Ga0495651_0167595 3300046462 Bacteria 1567
114 Ga0495582_0028832 3300046473 Bacteria 3047
115 Ga0495605_0017534 3300046474 Bacteria 3851
116 Ga0495605_0037242 3300046474 Bacteria 2448
117 Ga0495662_0021273 3300046476 Bacteria 3135
118 Ga0495662_0128453 3300046476 Bacteria 1246
119 Ga0495662_0180131 3300046476 Bacteria 1041
120 Ga0495664_0160835 3300046477 Bacteria 1362
121 Ga0495584_0129553 3300046491 Bacteria 1279
122 Ga0495585_0057590 3300046492 Bacteria 2144
123 Ga0495594_0000244 3300046499 Bacteria 26387
124 Ga0495594_0004011 3300046499 Bacteria 7575
125 Ga0495594_0008294 3300046499 Bacteria 5348
126 Ga0495594_0022825 3300046499 Bacteria 3350
127 Ga0495594_0090221 3300046499 Bacteria 1717
128 Ga0495594_0119242 3300046499 Bacteria 1491
129 Ga0495594_0170509 3300046499 Bacteria 1238
130 Ga0495594_0464623 3300046499 Bacteria 719
131 Ga0495594_0464629 3300046499 Bacteria 719
132 Ga0495594_0660146 3300046499 Bacteria 592
133 Ga0495607_0009347 3300046501 Bacteria 6639
134 Ga0495583_0020441 3300046506 Bacteria 3430
135 Ga0495583_0037699 3300046506 Bacteria 2290
136 Ga0495606_0023291 3300046507 Bacteria 4491
137 Ga0495606_0092734 3300046507 Bacteria 1854
138 Ga0495610_0050941 3300046512 Bacteria 2018
139 Ga0495616_0031733 3300046513 Bacteria 2764
140 Ga0495618_0101017 3300046514 Bacteria 1846
141 Ga0495620_0004961 3300046515 Bacteria 7462
142 Ga0495620_0010780 3300046515 Bacteria 4806
143 Ga0495620_0080730 3300046515 Bacteria 1316
144 Ga0495628_0030094 3300046516 Bacteria 4397
145 Ga0495628_0084043 3300046516 Bacteria 2470
146 Ga0495628_0316421 3300046516 Bacteria 1152
147 Ga0495631_0030629 3300046518 Bacteria 2439
148 Ga0495632_0031978 3300046519 Bacteria 2715
149 Ga0495632_0038175 3300046519 Bacteria 2433
150 Ga0495637_0063552 3300046520 Bacteria 1508
151 Ga0495643_0001406 3300046522 Bacteria 22332
152 Ga0495643_0002819 3300046522 Bacteria 13260
153 Ga0495643_0216441 3300046522 Bacteria 911
154 Ga0495648_0059080 3300046524 Bacteria 2289
155 Ga0495648_0067789 3300046524 Bacteria 2085
156 Ga0495663_0344065 3300046525 Bacteria 542
157 Ga0495666_0058675 3300046526 Bacteria 1840
158 Ga0495642_0022015 3300046528 Bacteria 2509
159 Ga0495652_0051890 3300046529 Bacteria 3500
160 Ga0495654_0007990 3300046530 Bacteria 5875
161 Ga0495640_0008927 3300046533 Bacteria 7828
162 Ga0495640_0102335 3300046533 Bacteria 1879
163 Ga0495640_0222755 3300046533 Bacteria 1189
164 Ga0495609_0003917 3300046538 Bacteria 8348
165 Ga0495609_0121841 3300046538 Bacteria 1121
166 Ga0495597_0144593 3300046542 Bacteria 979
167 Ga0495622_0007613 3300046557 Bacteria 5028
168 Ga0495622_0062570 3300046557 Bacteria 1722
169 Ga0495622_0170390 3300046557 Bacteria 979
170 Ga0495633_0089437 3300046558 Bacteria 1432
171 Ga0495633_0093405 3300046558 Bacteria 1398
172 Ga0495633_0144438 3300046558 Bacteria 1099
173 Ga0495667_0036549 3300046559 Bacteria 3278
174 Ga0495656_0557320 3300046615 Bacteria 611
175 Ga0495668_0052490 3300046616 Bacteria 2255
176 Ga0495634_0025796 3300046642 Bacteria 4105
177 Ga0495634_0633762 3300046642 Bacteria 618
178 Ga0495611_0014161 3300046648 Bacteria 3403
179 Ga0495611_0064283 3300046648 Bacteria 1671
180 Ga0495611_0152183 3300046648 Bacteria 1080
181 Ga0495625_0007730 3300046660 Bacteria 9297
182 Ga0495625_0431346 3300046660 Bacteria 817
183 Ga0495635_0723791 3300046663 Bacteria 644
184 Ga0495659_0180646 3300046664 Bacteria 859
185 Ga0495661_0011759 3300046665 Bacteria 5929
186 Ga0495588_0002826 3300046674 Bacteria 7465
187 Ga0495588_0028317 3300046674 Bacteria 2803
188 Ga0495657_0005323 3300046675 Bacteria 10182
189 Ga0495657_0045198 3300046675 Bacteria 2989
190 Ga0495657_0215872 3300046675 Bacteria 1164
191 Ga0495646_0245164 3300046680 Bacteria 962
192 Ga0495613_0000689 3300046689 Bacteria 26707
193 Ga0495613_0012437 3300046689 Bacteria 6324
194 Ga0495613_0033705 3300046689 Bacteria 3803
195 Ga0495613_0062646 3300046689 Bacteria 2721
196 Ga0495613_0070855 3300046689 Bacteria 2541
197 Ga0495613_0292233 3300046689 Bacteria 1129
198 Ga0495624_0086138 3300046690 Bacteria 1940
199 Ga0495624_0096161 3300046690 Bacteria 1825
200 Ga0495624_0100457 3300046690 Bacteria 1781
201 Ga0495670_0004493 3300046691 Bacteria 6836
202 Ga0495670_0430195 3300046691 Bacteria 714
203 Ga0495671_0060403 3300046692 Bacteria 1871
204 Ga0495649_0205413 3300046694 Bacteria 1022
205 Ga0495589_0016211 3300046794 Bacteria 3829
206 Ga0495589_0025229 3300046794 Bacteria 3018
207 Ga0495589_0029496 3300046794 Bacteria 2765
208 Ga0495589_0032763 3300046794 Bacteria 2612
209 Ga0495589_0168355 3300046794 Bacteria 1042
210 Ga0495589_0302817 3300046794 Bacteria 740
211 Ga0495589_0309442 3300046794 Bacteria 731
212 Ga0495600_0338655 3300046809 Bacteria 943
213 Ga0495600_0494491 3300046809 Bacteria 752
214 Ga0495600_0743438 3300046809 Bacteria 587
215 Ga0495660_0015012 3300046810 Bacteria 4477
216 Ga0495660_0136770 3300046810 Bacteria 1223
217 Ga0495581_0027697 3300047315 Bacteria 3287
218 Ga0495581_0134493 3300047315 Bacteria 1441
219 Ga0495604_0078544 3300047317 Bacteria 2476
220 Ga0495604_0090744 3300047317 Bacteria 2268
221 Ga0495604_0093792 3300047317 Bacteria 2220
222 Ga0495636_0001903 3300047318 Bacteria 7979
223 Ga0495636_0023783 3300047318 Bacteria 2482
224 Ga0495636_0038517 3300047318 Bacteria 1978
225 Ga0495636_0059711 3300047318 Bacteria 1610
226 Ga0495636_0245253 3300047318 Bacteria 827
227 Ga0495674_0267603 3300047319 Bacteria 1403
228 Ga0495676_0000208 3300047321 Bacteria 46581
229 Ga0495676_0002844 3300047321 Bacteria 15596
230 Ga0495676_0031274 3300047321 Bacteria 4503
231 Ga0495676_0080655 3300047321 Bacteria 2469
232 Ga0495676_0253592 3300047321 Bacteria 1199
233 Ga0495676_0321401 3300047321 Bacteria 1039
234 Ga0495680_0227688 3300047322 Bacteria 1328
235 Ga0495683_0009058 3300047323 Bacteria 5305
236 Ga0495683_0172731 3300047323 Bacteria 992
237 Ga0495687_021631 3300047443 Bacteria 3106
238 Ga0495687_023000 3300047443 Bacteria 2983
239 Ga0495687_063550 3300047443 Bacteria 1510
240 Ga0495675_0015663 3300047444 Bacteria 4793
241 Ga0495675_0070443 3300047444 Bacteria 2207
242 Ga0495675_0088114 3300047444 Bacteria 1950
243 Ga0495675_0278246 3300047444 Bacteria 998
244 Ga0495677_0007089 3300047445 Bacteria 4196
245 Ga0495679_022476 3300047446 Bacteria 2157
246 Ga0495685_000162 3300047447 Bacteria 22500
247 Ga0495685_005084 3300047447 Bacteria 4283
248 Ga0495685_012571 3300047447 Bacteria 2868
249 Ga0495685_021304 3300047447 Bacteria 2230
250 Ga0495685_080398 3300047447 Bacteria 1086
251 Ga0495685_183508 3300047447 Bacteria 673
252 Ga0495673_0054067 3300047469 Bacteria 1748
253 Ga0495681_0000665 3300047470 Bacteria 26108
254 Ga0495681_0004558 3300047470 Bacteria 9443
255 Ga0495686_0044087 3300047472 Bacteria 2824
256 Ga0495593_0038208 3300047673 Bacteria 2593
257 Ga0495593_0043997 3300047673 Bacteria 2390
258 Ga0495593_0067206 3300047673 Bacteria 1866
259 Ga0495593_0125137 3300047673 Bacteria 1307
260 Ga0495602_0209222 3300048088 Bacteria 1482
261 Ga0495614_0000585 3300048089 Bacteria 15189
262 Ga0495614_0004622 3300048089 Bacteria 6199
263 Ga0495626_0031833 3300048091 Bacteria 2535
264 Ga0495626_0353522 3300048091 Bacteria 573
265 Ga0496106_0077490 3300048909 Bacteria 2549
266 Ga0496108_0067612 3300048911 Bacteria 3014
267 Ga0496109_0015110 3300048912 Bacteria 6719
268 Ga0496110_0464058 3300048913 Bacteria 1154
269 Ga0496126_0358350 3300048929 Bacteria 1192
270 Ga0495678_021792 3300049459 Bacteria 2815
271 Ga0495678_079275 3300049459 Bacteria 1183
272 Ga0495682_0082824 3300049460 Bacteria 1154
273 Ga0501031_0029067 3300049568 Bacteria 3604
274 Ga0501031_0034311 3300049568 Bacteria 3311
275 Ga0501031_0109143 3300049568 Bacteria 1807
276 Ga0501031_0159480 3300049568 Bacteria 1474
277 Ga0501031_0324477 3300049568 Bacteria 997
278 Ga0501032_0013084 3300049569 Bacteria 5909
279 Ga0501032_0017534 3300049569 Bacteria 5026
280 Ga0501032_0022832 3300049569 Bacteria 4333
281 Ga0501032_0056591 3300049569 Bacteria 2636
282 Ga0501032_0091127 3300049569 Bacteria 2022
283 Ga0501032_0149180 3300049569 Bacteria 1538
284 Ga0501032_0166294 3300049569 Bacteria 1447
285 Ga0501033_0029939 3300049570 Bacteria 4091
286 Ga0501033_0037377 3300049570 Bacteria 3634
287 Ga0501033_0047555 3300049570 Bacteria 3189
288 Ga0501033_0049765 3300049570 Bacteria 3111
289 Ga0501033_0069312 3300049570 Bacteria 2592
290 Ga0501034_0011624 3300049571 Bacteria 9113
291 Ga0501034_0049044 3300049571 Bacteria 4261
292 Ga0501034_0051993 3300049571 Bacteria 4130
293 Ga0501034_0059199 3300049571 Bacteria 3848
294 Ga0501034_0129992 3300049571 Bacteria 2502
295 Ga0501034_0139207 3300049571 Bacteria 2407
296 Ga0501034_0675133 3300049571 Bacteria 933
297 Ga0501036_0003039 3300049572 Bacteria 13363
298 Ga0501036_0060038 3300049572 Bacteria 3221
299 Ga0501036_0094682 3300049572 Bacteria 2524
300 Ga0501036_0099588 3300049572 Bacteria 2458
301 Ga0501036_0122337 3300049572 Bacteria 2198
302 Ga0501036_0173284 3300049572 Bacteria 1817
303 Ga0501036_0646940 3300049572 Bacteria 875
304 Ga0501037_0003381 3300049573 Bacteria 11596
305 Ga0501037_0028327 3300049573 Bacteria 4137
306 Ga0501037_0036872 3300049573 Bacteria 3604
307 Ga0501037_0113029 3300049573 Bacteria 1955
308 Ga0501037_0191884 3300049573 Bacteria 1446
309 Ga0501037_0246765 3300049573 Bacteria 1250
310 Ga0501037_0255861 3300049573 Bacteria 1224
311 Ga0501038_0009174 3300049574 Bacteria 9080
312 Ga0501038_0016541 3300049574 Bacteria 6686
313 Ga0501038_0031240 3300049574 Bacteria 4708
314 Ga0501038_0039741 3300049574 Bacteria 4114
315 Ga0501038_0094417 3300049574 Bacteria 2500
316 Ga0501038_0134666 3300049574 Bacteria 2025
317 Ga0501038_0530479 3300049574 Bacteria 897
318 Ga0501039_0106263 3300049575 Bacteria 2192
319 Ga0501039_0122146 3300049575 Bacteria 2041
320 Ga0501039_0135446 3300049575 Bacteria 1934
321 Ga0501039_0522941 3300049575 Bacteria 931
322 Ga0501039_0953014 3300049575 Bacteria 667
323 Ga0501040_0004791 3300049576 Bacteria 8776
324 Ga0501041_0010760 3300049577 Bacteria 5397
325 Ga0501042_0067398 3300049578 Bacteria 2558
326 Ga0501043_0006896 3300049579 Bacteria 9064
327 Ga0501043_0027234 3300049579 Bacteria 4488
328 Ga0501043_0041696 3300049579 Bacteria 3606
329 Ga0501043_0047902 3300049579 Bacteria 3360
330 Ga0501043_0060562 3300049579 Bacteria 2971
331 Ga0501043_0082017 3300049579 Bacteria 2534
332 Ga0501046_0008170 3300049580 Bacteria 9141
333 Ga0501046_0094212 3300049580 Bacteria 2301
334 Ga0501046_0293550 3300049580 Bacteria 1188
335 Ga0501046_0351438 3300049580 Bacteria 1070
336 Ga0501047_0000056 3300049581 Bacteria 143501
337 Ga0501047_0021521 3300049581 Bacteria 6193
338 Ga0501047_0070723 3300049581 Bacteria 3360
339 Ga0501047_0092408 3300049581 Bacteria 2904
340 Ga0501047_0115715 3300049581 Bacteria 2563
341 Ga0501047_0161347 3300049581 Bacteria 2113
342 Ga0501047_0260628 3300049581 Bacteria 1581
343 Ga0501047_0382772 3300049581 Bacteria 1241
344 Ga0501048_0008440 3300049582 Bacteria 7790
345 Ga0501048_0032637 3300049582 Bacteria 3762
346 Ga0501048_0129515 3300049582 Bacteria 1784
347 Ga0501048_0337457 3300049582 Bacteria 1074
348 Ga0501067_0055037 3300049583 Bacteria 2204
349 Ga0501067_0187214 3300049583 Bacteria 1153
350 Ga0501068_0001907 3300049584 Bacteria 11089
351 Ga0501069_0064851 3300049585 Bacteria 2041
352 Ga0501069_0152335 3300049585 Bacteria 1329
353 Ga0501070_0008114 3300049586 Bacteria 8887
354 Ga0501070_0070049 3300049586 Bacteria 2904
355 Ga0501070_0077363 3300049586 Bacteria 2754
356 Ga0501070_0225179 3300049586 Bacteria 1537
357 Ga0501070_0412058 3300049586 Bacteria 1092
358 Ga0501071_0002013 3300049587 Bacteria 12158
359 Ga0501072_0002882 3300049588 Bacteria 12933
360 Ga0501073_0139057 3300049589 Bacteria 1683
361 Ga0501073_0147651 3300049589 Bacteria 1629
362 Ga0501074_0161980 3300049590 Bacteria 1598
363 Ga0501074_0207050 3300049590 Bacteria 1397
364 Ga0501076_0051428 3300049592 Bacteria 3262
365 Ga0501077_0024196 3300049593 Bacteria 3855
366 Ga0501079_0111125 3300049741 Bacteria 2129
367 Ga0501080_0045923 3300049742 Bacteria 4067
368 Ga0501080_0124353 3300049742 Bacteria 2389
369 Ga0501080_0358014 3300049742 Bacteria 1317
370 Ga0501083_0116555 3300049744 Bacteria 1753
371 Ga0501083_0344419 3300049744 Bacteria 969
372 Ga0501035_0036288 3300049822 Bacteria 4468
373 Ga0501035_0038338 3300049822 Bacteria 4339
374 Ga0501035_0047596 3300049822 Bacteria 3848
375 Ga0501035_0091487 3300049822 Bacteria 2677
376 Ga0501035_0133115 3300049822 Bacteria 2166
377 Ga0501035_0643155 3300049822 Bacteria 860
378 Ga0501044_0002369 3300049823 Bacteria 21458
379 Ga0501044_0012722 3300049823 Bacteria 9113
380 Ga0501044_0021565 3300049823 Bacteria 6869
381 Ga0501044_0022165 3300049823 Bacteria 6772
382 Ga0501044_0080793 3300049823 Bacteria 3292
383 Ga0501044_0097855 3300049823 Bacteria 2954
384 Ga0501044_0162630 3300049823 Bacteria 2207
385 Ga0501044_0178323 3300049823 Bacteria 2092
386 Ga0501044_0474616 3300049823 Bacteria 1154
387 Ga0501044_0682779 3300049823 Bacteria 913
388 Ga0501044_0843657 3300049823 Bacteria 793
389 Ga0501045_0175258 3300049824 Bacteria 1597
390 Ga0501045_0269271 3300049824 Bacteria 1268
391 Ga0501045_0592519 3300049824 Bacteria 821
392 nmdc:mga0yw44_190237_c1 3300050492 Bacteria 1353
393 nmdc:mga04h51_12579_c1 3300050495 Bacteria 2378
394 nmdc:mga07m45_103400_c1 3300050496 Bacteria 1637
395 Ga0500610_0148516 3300053079 Bacteria 1177
396 Ga0495655_0053872 3300053083 Bacteria 1075
397 Ga0495655_0204581 3300053083 Bacteria 647
398 Ga0500578_0004838 3300053086 Bacteria 9328
399 Ga0500583_0405007 3300053092 Bacteria 654
400 Ga0500651_0315836 3300053093 Bacteria 893
401 Ga0500566_0070024 3300053094 Bacteria 1970
402 Ga0500654_035797 3300053099 Bacteria 2906
403 Ga0500553_051888 3300053101 Bacteria 1962
404 Ga0500560_034311 3300053107 Bacteria 1555
405 Ga0500569_000083 3300053109 Bacteria 15479
406 Ga0500614_033720 3300053123 Bacteria 1266
407 Ga0500628_001892 3300053129 Bacteria 3524
408 Ga0500652_245165 3300053131 Bacteria 711
409 Ga0500658_0007791 3300053134 Bacteria 3956
410 Ga0500561_0000581 3300053137 Bacteria 5915
411 Ga0500573_0015931 3300053140 Bacteria 4264
412 Ga0500573_0208318 3300053140 Bacteria 1033
413 Ga0500577_0048777 3300053142 Bacteria 1581
414 Ga0500579_025173 3300053143 Bacteria 3844
415 Ga0500586_191699 3300053145 Bacteria 676
416 Ga0500600_0007862 3300053149 Bacteria 6421
417 Ga0500603_185373 3300053150 Bacteria 656
418 Ga0500616_0004760 3300053153 Bacteria 9533
419 Ga0500634_0000287 3300053161 Bacteria 16181
420 Ga0500634_0286745 3300053161 Bacteria 661
421 Ga0500656_000436 3300053732 Bacteria 3042
422 Ga0500587_004931 3300053739 Bacteria 1816
423 Ga0501084_0010545 3300054114 Bacteria 7642
424 Ga0501084_0813715 3300054114 Bacteria 787
425 Ga0501082_0016552 3300060353 Bacteria 6348
426 Ga0501082_0890297 3300060353 Bacteria 779
427 Ga0530510_0145315 3300061734 Bacteria 1749
428 3006322012 3006321560 Bacteria 8247479
429 2585301020 2582581312 Bacteria 7308206
430 2585308398 2582581313 Bacteria 10042643
431 2585313211 2582581314 Bacteria 11452267
432 2643759578 2643221548 Bacteria 8053412
433 2644408800 2643221673 Bacteria 9196637
434 2644436101 2643221678 Bacteria 9540101
435 2644463006 2643221682 Bacteria 6743283
436 2644632036 2643221714 Bacteria 9015452
437 2785344621 2784746763 Bacteria 9783172
438 2785368278 2784746768 Bacteria 10036182
439 2786669278 2786546132 Bacteria 10419719
440 2793982058 2791355406 Bacteria 11364898
441 2808840927 2808606359 Bacteria 9866990
442 2811847951 2808606982 Bacteria 7791042
443 2812481437 2811994917 Bacteria 7761064
444 2819693840 2818991463 Bacteria 7948711
445 2862296673 2862290372 Bacteria 7471434
446 2867429528 2867428634 Bacteria 9590268
447 2867479615 2867475112 Bacteria 6909112
448 2877682299 2877676314 Bacteria 9512378
449 2912725222 2912723979 Bacteria 8557534
450 2912759770 2912757875 Bacteria 7940295
451 2919468413 2919468124 Bacteria 9133025
452 2946051078 2946045630 Bacteria 8527308
453 2946074890 2946072368 Bacteria 8999607
454 2954675741 2954673503 Bacteria 9685905
455 2954688523 2954682443 Bacteria 9862841
456 2954717284 2954711539 Bacteria 10867210
457 2954727252 2954721474 Bacteria 10456478
458 2954734540 2954731030 Bacteria 10243860
459 2954746158 2954740390 Bacteria 10229294
460 2954753437 2954749733 Bacteria 10366972
461 2954765125 2954759201 Bacteria 9358192
462 2966603471 2966598605 Bacteria 7676064
463 2990066717 2990059506 Bacteria 9321252
464 2997456358 2997451912 Bacteria 8492419
465 3006397300 3006393351 Bacteria 6615579
466 3006427455 3006425503 Bacteria 6491253
467 8008559238 8008558824 Bacteria 10610750
468 8025480033 8025478263 Bacteria 8209203
469 8025531162 8025530807 Bacteria 8495698
470 8047899228 8047893842 Bacteria 11723082
471 8048129461 8048127548 Bacteria 11053136
472 8048359691 8048356638 Bacteria 11044339
473 8048376190 8048369669 Bacteria 11666822
474 8048385249 8048379754 Bacteria 11877923
475 8048407978 8048406513 Bacteria 8936924
476 8054164949 8054160619 Bacteria 7783213
477 8056673405 8056667051 Bacteria 6953971
478 8056836715 8056829672 Bacteria 9045328
479 JGI24739J22299_10021071
480 JGI24737J22298_10062213
481 rootH1_10033851
482 JGI25160J50197_1010362
483 JGI25160J50197_1012265
484 JGI25160J50197_1029839
485 Ga0070688_101248401
486 Ga0070663_101013905
487 Ga0070685_10126949
488 Ga0070665_100602996
489 Ga0081455_10175698
490 Ga0075363_100205618
491 Ga0075370_10214717
492 Ga0105251_10021931
493 Ga0105244_10520926
494 Ga0105250_10037304
495 Ga0105243_10062330
496 Ga0105243_10394672
497 Ga0105248_10289597
498 Ga0105238_10518485
499 Ga0105239_10310512
500 Ga0105246_10063335
501 Ga0105246_10305927
502 Ga0157369_10147148
503 Ga0207426_1002223
504 Ga0207426_1007175
505 Ga0207426_1059457
506 Ga0207696_1027985
507 Ga0207713_1019361
508 Ga0207647_10007793
509 Ga0207707_10285573
510 Ga0207694_10597823
511 Ga0207700_11303678
512 Ga0207709_10070669
513 Ga0207711_10275128
514 Ga0207639_10020409
515 Ga0209371_1014295
516 Ga0268266_10400924
517 Ga0268266_10557960
518 Ga0307517_10055706
519 Ga0307515_10000262
520 Ga0268256_1015844
521 Ga0307511_10187872
522 Ga0307511_10194632
523 Ga0307512_10003287
524 Ga0307513_10183532
525 Ga0307513_10214396
526 Ga0307509_10452827
527 Ga0307508_10003146
528 Ga0307508_10004366
529 Ga0307508_10011423
530 Ga0307508_10024355
531 Ga0307514_10083805
532 Ga0307514_10120805
533 Ga0307514_10142495
534 Ga0307514_10202420
535 Ga0307516_10007840
536 Ga0307516_10229262
537 Ga0307516_10305994
538 Ga0307516_10326667
539 Ga0307405_10860069
540 Ga0307410_10202267
541 Ga0307409_100237818
542 Ga0307416_100721347
543 Ga0307507_10050253
544 Ga0307507_10166871
545 Ga0307510_10021894
546 Ga0307510_10035955
547 Ga0395900_0495741
548 Ga0395898_0068921
549 Ga0395901_0271540
550 Ga0395901_1430314
551 Ga0451837_0441292
552 Ga0451853_1415414
553 Ga0439448_0070772
554 Ga0450895_008938
555 Ga0450906_000131
556 Ga0439458_0004847
557 Ga0439458_0095122
558 Ga0450901_019858
559 Ga0466965_0577043
560 Ga0466961_0017828
561 Ga0466963_0000196
562 Ga0466963_0723075
563 Ga0466971_0085327
564 Ga0466971_0170603
565 Ga0466968_0356787
566 Ga0466970_0003680
567 Ga0466957_0020111
568 Ga0466960_0029308
569 Ga0466967_0092774
570 Ga0466967_0616526
571 Ga0495617_098056
572 Ga0495627_052524
573 Ga0495627_063265
574 Ga0495592_0340402
575 Ga0495603_0001858
576 Ga0495603_0002751
577 Ga0495603_0003796
578 Ga0495603_0217952
579 Ga0495603_0572813
580 Ga0495629_0006991
581 Ga0495629_0062447
582 Ga0495629_0063842
583 Ga0495629_0066724
584 Ga0495629_0073360
585 Ga0495629_0095786
586 Ga0495638_0008299
587 Ga0495638_0047886
588 Ga0495638_0077691
589 Ga0495651_0102108
590 Ga0495651_0167595
591 Ga0495582_0028832
592 Ga0495605_0017534
593 Ga0495605_0037242
594 Ga0495662_0021273
595 Ga0495662_0128453
596 Ga0495662_0180131
597 Ga0495664_0160835
598 Ga0495584_0129553
599 Ga0495585_0057590
600 Ga0495594_0000244
601 Ga0495594_0004011
602 Ga0495594_0008294
603 Ga0495594_0022825
604 Ga0495594_0090221
605 Ga0495594_0119242
606 Ga0495594_0170509
607 Ga0495594_0464623
608 Ga0495594_0464629
609 Ga0495594_0660146
610 Ga0495607_0009347
611 Ga0495583_0020441
612 Ga0495583_0037699
613 Ga0495606_0023291
614 Ga0495606_0092734
615 Ga0495610_0050941
616 Ga0495616_0031733
617 Ga0495618_0101017
618 Ga0495620_0004961
619 Ga0495620_0010780
620 Ga0495620_0080730
621 Ga0495628_0030094
622 Ga0495628_0084043
623 Ga0495628_0316421
624 Ga0495631_0030629
625 Ga0495632_0031978
626 Ga0495632_0038175
627 Ga0495637_0063552
628 Ga0495643_0001406
629 Ga0495643_0002819
630 Ga0495643_0216441
631 Ga0495648_0059080
632 Ga0495648_0067789
633 Ga0495663_0344065
634 Ga0495666_0058675
635 Ga0495642_0022015
636 Ga0495652_0051890
637 Ga0495654_0007990
638 Ga0495640_0008927
639 Ga0495640_0102335
640 Ga0495640_0222755
641 Ga0495609_0003917
642 Ga0495609_0121841
643 Ga0495597_0144593
644 Ga0495622_0007613
645 Ga0495622_0062570
646 Ga0495622_0170390
647 Ga0495633_0089437
648 Ga0495633_0093405
649 Ga0495633_0144438
650 Ga0495667_0036549
651 Ga0495656_0557320
652 Ga0495668_0052490
653 Ga0495634_0025796
654 Ga0495634_0633762
655 Ga0495611_0014161
656 Ga0495611_0064283
657 Ga0495611_0152183
658 Ga0495625_0007730
659 Ga0495625_0431346
660 Ga0495635_0723791
661 Ga0495659_0180646
662 Ga0495661_0011759
663 Ga0495588_0002826
664 Ga0495588_0028317
665 Ga0495657_0005323
666 Ga0495657_0045198
667 Ga0495657_0215872
668 Ga0495646_0245164
669 Ga0495613_0000689
670 Ga0495613_0012437
671 Ga0495613_0033705
672 Ga0495613_0062646
673 Ga0495613_0070855
674 Ga0495613_0292233
675 Ga0495624_0086138
676 Ga0495624_0096161
677 Ga0495624_0100457
678 Ga0495670_0004493
679 Ga0495670_0430195
680 Ga0495671_0060403
681 Ga0495649_0205413
682 Ga0495589_0016211
683 Ga0495589_0025229
684 Ga0495589_0029496
685 Ga0495589_0032763
686 Ga0495589_0168355
687 Ga0495589_0302817
688 Ga0495589_0309442
689 Ga0495600_0338655
690 Ga0495600_0494491
691 Ga0495600_0743438
692 Ga0495660_0015012
693 Ga0495660_0136770
694 Ga0495581_0027697
695 Ga0495581_0134493
696 Ga0495604_0078544
697 Ga0495604_0090744
698 Ga0495604_0093792
699 Ga0495636_0001903
700 Ga0495636_0023783
701 Ga0495636_0038517
702 Ga0495636_0059711
703 Ga0495636_0245253
704 Ga0495674_0267603
705 Ga0495676_0000208
706 Ga0495676_0002844
707 Ga0495676_0031274
708 Ga0495676_0080655
709 Ga0495676_0253592
710 Ga0495676_0321401
711 Ga0495680_0227688
712 Ga0495683_0009058
713 Ga0495683_0172731
714 Ga0495687_021631
715 Ga0495687_023000
716 Ga0495687_063550
717 Ga0495675_0015663
718 Ga0495675_0070443
719 Ga0495675_0088114
720 Ga0495675_0278246
721 Ga0495677_0007089
722 Ga0495679_022476
723 Ga0495685_000162
724 Ga0495685_005084
725 Ga0495685_012571
726 Ga0495685_021304
727 Ga0495685_080398
728 Ga0495685_183508
729 Ga0495673_0054067
730 Ga0495681_0000665
731 Ga0495681_0004558
732 Ga0495686_0044087
733 Ga0495593_0038208
734 Ga0495593_0043997
735 Ga0495593_0067206
736 Ga0495593_0125137
737 Ga0495602_0209222
738 Ga0495614_0000585
739 Ga0495614_0004622
740 Ga0495626_0031833
741 Ga0495626_0353522
742 Ga0496106_0077490
743 Ga0496108_0067612
744 Ga0496109_0015110
745 Ga0496110_0464058
746 Ga0496126_0358350
747 Ga0495678_021792
748 Ga0495678_079275
749 Ga0495682_0082824
750 Ga0501031_0029067
751 Ga0501031_0034311
752 Ga0501031_0109143
753 Ga0501031_0159480
754 Ga0501031_0324477
755 Ga0501032_0013084
756 Ga0501032_0017534
757 Ga0501032_0022832
758 Ga0501032_0056591
759 Ga0501032_0091127
760 Ga0501032_0149180
761 Ga0501032_0166294
762 Ga0501033_0029939
763 Ga0501033_0037377
764 Ga0501033_0047555
765 Ga0501033_0049765
766 Ga0501033_0069312
767 Ga0501034_0011624
768 Ga0501034_0049044
769 Ga0501034_0051993
770 Ga0501034_0059199
771 Ga0501034_0129992
772 Ga0501034_0139207
773 Ga0501034_0675133
774 Ga0501036_0003039
775 Ga0501036_0060038
776 Ga0501036_0094682
777 Ga0501036_0099588
778 Ga0501036_0122337
779 Ga0501036_0173284
780 Ga0501036_0646940
781 Ga0501037_0003381
782 Ga0501037_0028327
783 Ga0501037_0036872
784 Ga0501037_0113029
785 Ga0501037_0191884
786 Ga0501037_0246765
787 Ga0501037_0255861
788 Ga0501038_0009174
789 Ga0501038_0016541
790 Ga0501038_0031240
791 Ga0501038_0039741
792 Ga0501038_0094417
793 Ga0501038_0134666
794 Ga0501038_0530479
795 Ga0501039_0106263
796 Ga0501039_0122146
797 Ga0501039_0135446
798 Ga0501039_0522941
799 Ga0501039_0953014
800 Ga0501040_0004791
801 Ga0501041_0010760
802 Ga0501042_0067398
803 Ga0501043_0006896
804 Ga0501043_0027234
805 Ga0501043_0041696
806 Ga0501043_0047902
807 Ga0501043_0060562
808 Ga0501043_0082017
809 Ga0501046_0008170
810 Ga0501046_0094212
811 Ga0501046_0293550
812 Ga0501046_0351438
813 Ga0501047_0000056
814 Ga0501047_0021521
815 Ga0501047_0070723
816 Ga0501047_0092408
817 Ga0501047_0115715
818 Ga0501047_0161347
819 Ga0501047_0260628
820 Ga0501047_0382772
821 Ga0501048_0008440
822 Ga0501048_0032637
823 Ga0501048_0129515
824 Ga0501048_0337457
825 Ga0501067_0055037
826 Ga0501067_0187214
827 Ga0501068_0001907
828 Ga0501069_0064851
829 Ga0501069_0152335
830 Ga0501070_0008114
831 Ga0501070_0070049
832 Ga0501070_0077363
833 Ga0501070_0225179
834 Ga0501070_0412058
835 Ga0501071_0002013
836 Ga0501072_0002882
837 Ga0501073_0139057
838 Ga0501073_0147651
839 Ga0501074_0161980
840 Ga0501074_0207050
841 Ga0501076_0051428
842 Ga0501077_0024196
843 Ga0501079_0111125
844 Ga0501080_0045923
845 Ga0501080_0124353
846 Ga0501080_0358014
847 Ga0501083_0116555
848 Ga0501083_0344419
849 Ga0501035_0036288
850 Ga0501035_0038338
851 Ga0501035_0047596
852 Ga0501035_0091487
853 Ga0501035_0133115
854 Ga0501035_0643155
855 Ga0501044_0002369
856 Ga0501044_0012722
857 Ga0501044_0021565
858 Ga0501044_0022165
859 Ga0501044_0080793
860 Ga0501044_0097855
861 Ga0501044_0162630
862 Ga0501044_0178323
863 Ga0501044_0474616
864 Ga0501044_0682779
865 Ga0501044_0843657
866 Ga0501045_0175258
867 Ga0501045_0269271
868 Ga0501045_0592519
869 nmdc:mga0yw44_190237_c1
870 nmdc:mga04h51_12579_c1
871 nmdc:mga07m45_103400_c1
872 Ga0500610_0148516
873 Ga0495655_0053872
874 Ga0495655_0204581
875 Ga0500578_0004838
876 Ga0500583_0405007
877 Ga0500651_0315836
878 Ga0500566_0070024
879 Ga0500654_035797
880 Ga0500553_051888
881 Ga0500560_034311
882 Ga0500569_000083
883 Ga0500614_033720
884 Ga0500628_001892
885 Ga0500652_245165
886 Ga0500658_0007791
887 Ga0500561_0000581
888 Ga0500573_0015931
889 Ga0500573_0208318
890 Ga0500577_0048777
891 Ga0500579_025173
892 Ga0500586_191699
893 Ga0500600_0007862
894 Ga0500603_185373
895 Ga0500616_0004760
896 Ga0500634_0000287
897 Ga0500634_0286745
898 Ga0500656_000436
899 Ga0500587_004931
900 Ga0501084_0010545
901 Ga0501084_0813715
902 Ga0501082_0016552
903 Ga0501082_0890297
904 Ga0530510_0145315
905 3006322012
906 2585301020
907 2585308398
908 2585313211
909 2643759578
910 2644408800
911 2644436101
912 2644463006
913 2644632036
914 2785344621
915 2785368278
916 2786669278
917 2793982058
918 2808840927
919 2811847951
920 2812481437
921 2819693840
922 2862296673
923 2867429528
924 2867479615
925 2877682299
926 2912725222
927 2912759770
928 2919468413
929 2946051078
930 2946074890
931 2954675741
932 2954688523
933 2954717284
934 2954727252
935 2954734540
936 2954746158
937 2954753437
938 2954765125
939 2966603471
940 2990066717
941 2997456358
942 3006397300
943 3006427455
944 8008559238
945 8025480033
946 8025531162
947 8047899228
948 8048129461
949 8048359691
950 8048376190
951 8048385249
952 8048407978
953 8054164949
954 8056673405
955 8056836715

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00376

MerR

MerR family regulatory protein

56

93

0.99

PF09278

MerR-DNA-bind

MerR, DNA binding

98

162

0.97

PF13411

MerR_1

MerR HTH family regulatory protein

55

123

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tea-assembly2.cif.gz_C crystal structure of s. aureus glnr-dna complex 0.9336 27 91
4r4e-assembly1.cif.gz_B structure of glnr-dna complex 0.9051 27 87
2dg6-assembly1.cif.gz_A-2 crystal structure of the putative transcriptional regulator sco5550 from streptomyces coelicolor a3(2) 0.9028 27 96
5i44-assembly4.cif.gz_E structure of raca-dna complex; p21 form 0.9025 25 89
5i44-assembly4.cif.gz_G-2 structure of raca-dna complex; p21 form 0.8918 26 89
ID Description Score Start End Superfamily
3hh0D01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9288 26 91 1.10.1660.10
3gp4B00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9168 26 135 1.10.1660.10
af_O06302_4_79_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9062 24 91 1.10.1660.10
5i44K00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9011 26 88 1.10.1660.10
3hh0C01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8967 26 91 1.10.1660.10
ID Description Score Start End GO Terms
AF-X2JTA8-F1-model_v4 deleted 0.9812 26 113
AF-F1Z152-F1-model_v4 HTH-type transcriptional regulator AdhR 0.9661 27 135 GO:0003677
GO:0003700
AF-A0A498R3P9-F1-model_v4 Merr bacterial regulatory protein hth signature 0.9654 27 129 GO:0003677
GO:0003700
AF-A0A060LRX6-F1-model_v4 DNA-binding transcription regulator MerR 0.9552 27 149 GO:0003677
GO:0003700
AF-A0A0R1LQT5-F1-model_v4 HTH merR-type domain-containing protein 0.9545 28 140 GO:0003677
GO:0003700

Map