F451817

General Info

Members Datasets Scaffolds Average Seq Length
477 253 954 257

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2929212328|2929215805
Length 283
Sequence GEPPETVPGRHEHGPDHSGHHGRHEMPPDGTARPIGVLRAGGFGGVLRRGRSQIVFGALAVLLCMVLGVAIVTQVRQNESGDSLETARPADLLVLLDSLQQREAALNTEVNDLQRTLEQLQASGSSDAAAIENAQARLAALSILIGTVAATGPGVVLTITDTASGVPAETMLDVINELRAAGAEAMQIQGQQGGQPRSVRVGVDTWVTGKPGALEVDGATLNPPYSVLAIGDPPTLAAAMNIPGGAMDSVERVGGTMVVQQAERVDVTALRQPKPRQYAQPVK

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
151 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
154 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
155 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
156 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
157 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
158 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
159 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
163 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
164 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
229 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
230 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
233 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
239 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
240 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
241 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
244 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
245 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
246 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
247 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
248 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
249 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
250 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
251 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
252 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
253 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.9
Metatranscriptomes 0
Isolates 2.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13
Nodule 0.21
Rhizoplane 14.47
Rhizosphere 65.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000293 3300001977 Bacteria 7150
2 JGI24743J22301_10005086 3300001991 Bacteria 2178
3 JGI24738J21930_10016769 3300002075 Bacteria 1544
4 JGI24744J21845_10004206 3300002077 Bacteria 2968
5 JGI24742J22300_10019544 3300002244 Bacteria 1151
6 rootH2_10151049 3300003320 Bacteria 4940
7 Ga0055540_1000024 3300003792 Bacteria 199164
8 Ga0055540_1005116 3300003792 Bacteria 5644
9 Ga0055540_1011517 3300003792 Bacteria 2844
10 Ga0070677_10215782 3300005333 Bacteria 934
11 Ga0068869_100006273 3300005334 Bacteria 7528
12 Ga0070682_100023290 3300005337 Bacteria 3677
13 Ga0070682_100069301 3300005337 Bacteria 2252
14 Ga0070682_100095431 3300005337 Bacteria 1953
15 Ga0070682_100096045 3300005337 Bacteria 1947
16 Ga0068868_100001420 3300005338 Bacteria 16505
17 Ga0070691_10048047 3300005341 Bacteria 2030
18 Ga0070687_100286813 3300005343 Bacteria 1039
19 Ga0070668_100001434 3300005347 Bacteria 17206
20 Ga0070668_100204298 3300005347 Bacteria 1623
21 Ga0070669_100030631 3300005353 Bacteria 3883
22 Ga0070671_100004506 3300005355 Bacteria 11027
23 Ga0070671_100245963 3300005355 Bacteria 1519
24 Ga0070674_100000938 3300005356 Bacteria 15220
25 Ga0070674_100019530 3300005356 Bacteria 4306
26 Ga0070674_100147789 3300005356 Bacteria 1770
27 Ga0070688_100096844 3300005365 Bacteria 1939
28 Ga0070688_100172278 3300005365 Bacteria 1495
29 Ga0070659_100108012 3300005366 Bacteria 2244
30 Ga0070667_100001451 3300005367 Bacteria 21232
31 Ga0070667_100003821 3300005367 Bacteria 12799
32 Ga0070667_100250464 3300005367 Bacteria 1583
33 Ga0070667_100277404 3300005367 Bacteria 1504
34 Ga0070709_10026162 3300005434 Bacteria 3454
35 Ga0070714_100216590 3300005435 Bacteria 1758
36 Ga0070713_100008174 3300005436 Bacteria 7410
37 Ga0070713_100406214 3300005436 Bacteria 1273
38 Ga0070710_10011316 3300005437 Bacteria 4408
39 Ga0070710_10055028 3300005437 Bacteria 2247
40 Ga0070701_10001800 3300005438 Bacteria 8091
41 Ga0070701_10074931 3300005438 Bacteria 1819
42 Ga0070711_100015178 3300005439 Bacteria 4870
43 Ga0070705_100153939 3300005440 Bacteria 1528
44 Ga0070700_100002918 3300005441 Bacteria 8770
45 Ga0070700_100049459 3300005441 Bacteria 2610
46 Ga0070694_100048016 3300005444 Bacteria 2870
47 Ga0070694_100223073 3300005444 Bacteria 1415
48 Ga0070663_100023405 3300005455 Bacteria 4141
49 Ga0070663_100065687 3300005455 Bacteria 2627
50 Ga0070678_100163607 3300005456 Bacteria 1805
51 Ga0070662_100002831 3300005457 Bacteria 10754
52 Ga0070662_100226681 3300005457 Bacteria 1493
53 Ga0068867_100001679 3300005459 Bacteria 15432
54 Ga0068867_100472570 3300005459 Bacteria 1072
55 Ga0070685_10228413 3300005466 Bacteria 1223
56 Ga0070684_100412511 3300005535 Bacteria 1246
57 Ga0068853_100003194 3300005539 Bacteria 12513
58 Ga0068853_100051794 3300005539 Bacteria 3534
59 Ga0068853_100172854 3300005539 Bacteria 1955
60 Ga0068853_100355754 3300005539 Bacteria 1363
61 Ga0070672_100553916 3300005543 Bacteria 998
62 Ga0070686_100176311 3300005544 Bacteria 1515
63 Ga0070695_100023491 3300005545 Bacteria 3790
64 Ga0070696_100003826 3300005546 Bacteria 10049
65 Ga0070696_100119296 3300005546 Bacteria 1907
66 Ga0070665_100042386 3300005548 Bacteria 4575
67 Ga0070665_100503295 3300005548 Bacteria 1223
68 Ga0070704_100001795 3300005549 Bacteria 11789
69 Ga0070704_100576108 3300005549 Bacteria 986
70 Ga0068855_100033547 3300005563 Bacteria 6125
71 Ga0070664_100207070 3300005564 Bacteria 1752
72 Ga0070664_100301883 3300005564 Bacteria 1447
73 Ga0068854_100005363 3300005578 Bacteria 8094
74 Ga0070702_100004175 3300005615 Bacteria 6570
75 Ga0068852_100447661 3300005616 Bacteria 1278
76 Ga0068859_100004345 3300005617 Bacteria 14458
77 Ga0068859_100074714 3300005617 Bacteria 3428
78 Ga0068864_100171776 3300005618 Bacteria 1977
79 Ga0068866_10000336 3300005718 Bacteria 22152
80 Ga0068861_100000265 3300005719 Bacteria 29212
81 Ga0068870_10113130 3300005840 Bacteria 1553
82 Ga0068863_100451967 3300005841 Bacteria 1261
83 Ga0068858_100000562 3300005842 Bacteria 38739
84 Ga0068858_100101203 3300005842 Bacteria 2687
85 Ga0068860_100001976 3300005843 Bacteria 21673
86 Ga0068860_100088530 3300005843 Bacteria 2947
87 Ga0068862_100001990 3300005844 Bacteria 18528
88 Ga0068862_100203901 3300005844 Bacteria 1784
89 Ga0075365_10002576 3300006038 Bacteria 8958
90 Ga0075365_10056289 3300006038 Bacteria 2614
91 Ga0075365_10071790 3300006038 Bacteria 2331
92 Ga0075363_100001944 3300006048 Bacteria 8198
93 Ga0075363_100004058 3300006048 Bacteria 6336
94 Ga0075363_100005253 3300006048 Bacteria 5742
95 Ga0075363_100021129 3300006048 Bacteria 3274
96 Ga0075363_100045962 3300006048 Bacteria 2316
97 Ga0075363_100052549 3300006048 Bacteria 2175
98 Ga0075363_100141524 3300006048 Bacteria 1355
99 Ga0075364_10000578 3300006051 Bacteria 18885
100 Ga0075364_10006506 3300006051 Bacteria 6868
101 Ga0075364_10093144 3300006051 Bacteria 2000
102 Ga0075364_10166209 3300006051 Bacteria 1490
103 Ga0075364_10166423 3300006051 Bacteria 1490
104 Ga0075364_10196537 3300006051 Bacteria 1367
105 Ga0070715_10031623 3300006163 Bacteria 2150
106 Ga0070716_100010766 3300006173 Bacteria 4596
107 Ga0070712_100001538 3300006175 Bacteria 14088
108 Ga0070712_100002172 3300006175 Bacteria 12066
109 Ga0075367_10025917 3300006178 Bacteria 3319
110 Ga0075369_10012778 3300006186 Bacteria 3319
111 Ga0075369_10017995 3300006186 Bacteria 2872
112 Ga0075369_10065423 3300006186 Bacteria 1593
113 Ga0075369_10087857 3300006186 Bacteria 1385
114 Ga0075369_10126828 3300006186 Bacteria 1158
115 Ga0075366_10269415 3300006195 Bacteria 1040
116 Ga0075370_10001363 3300006353 Bacteria 10514
117 Ga0075370_10003874 3300006353 Bacteria 7170
118 Ga0075370_10231060 3300006353 Bacteria 1094
119 Ga0075428_100240033 3300006844 Bacteria 1955
120 Ga0075430_100050382 3300006846 Bacteria 3512
121 Ga0068865_100001148 3300006881 Bacteria 15356
122 Ga0068865_100139013 3300006881 Bacteria 1829
123 Ga0097620_100004345 3300006931 Bacteria 14458
124 Ga0097620_100074715 3300006931 Bacteria 3428
125 Ga0075435_100407829 3300007076 Bacteria 1169
126 Ga0105245_10002751 3300009098 Bacteria 15814
127 Ga0105245_10308519 3300009098 Bacteria 1555
128 Ga0105247_10001497 3300009101 Bacteria 16723
129 Ga0105247_10550971 3300009101 Bacteria 848
130 Ga0114129_10090830 3300009147 Bacteria 4233
131 Ga0105243_10001548 3300009148 Bacteria 20116
132 Ga0105243_10215621 3300009148 Bacteria 1693
133 Ga0105243_10218125 3300009148 Bacteria 1684
134 Ga0105242_10001696 3300009176 Bacteria 17433
135 Ga0105242_10187766 3300009176 Bacteria 1828
136 Ga0105242_10229190 3300009176 Bacteria 1664
137 Ga0105248_10012181 3300009177 Bacteria 9487
138 Ga0105248_10032162 3300009177 Bacteria 5864
139 Ga0105248_10375811 3300009177 Bacteria 1600
140 Ga0105248_10748973 3300009177 Bacteria 1102
141 Ga0105237_10011057 3300009545 Bacteria 9571
142 Ga0105237_10091826 3300009545 Bacteria 3026
143 Ga0105237_10136470 3300009545 Bacteria 2447
144 Ga0105237_10290939 3300009545 Bacteria 1636
145 Ga0105237_10646251 3300009545 Bacteria 1064
146 Ga0105249_10002641 3300009553 Bacteria 15506
147 Ga0099796_10032535 3300010159 Bacteria 1710
148 Ga0105239_10002595 3300010375 Bacteria 22859
149 Ga0105239_10048844 3300010375 Bacteria 4639
150 Ga0105239_10487997 3300010375 Bacteria 1400
151 Ga0105246_10026919 3300011119 Bacteria 3763
152 Ga0157369_10506761 3300013105 Bacteria 1249
153 Ga0157374_10021241 3300013296 Bacteria 5772
154 Ga0157378_10000448 3300013297 Bacteria 39646
155 Ga0163162_10008162 3300013306 Bacteria 10218
156 Ga0163162_10137763 3300013306 Bacteria 2552
157 Ga0157372_10004124 3300013307 Bacteria 15566
158 Ga0157372_10438244 3300013307 Bacteria 1523
159 Ga0157375_10001299 3300013308 Bacteria 21503
160 Ga0157375_10337167 3300013308 Bacteria 1673
161 Ga0157375_10957863 3300013308 Bacteria 997
162 Ga0163163_10172207 3300014325 Bacteria 2211
163 Ga0157380_10014231 3300014326 Bacteria 5819
164 Ga0157380_10273633 3300014326 Bacteria 1541
165 Ga0157377_10093588 3300014745 Bacteria 1779
166 Ga0157379_10005763 3300014968 Bacteria 10660
167 Ga0157379_10080262 3300014968 Bacteria 2922
168 Ga0157376_10277543 3300014969 Bacteria 1577
169 Ga0163161_10002025 3300017792 Bacteria 14666
170 Ga0163161_10042112 3300017792 Bacteria 3283
171 Ga0209051_1000021 3300025303 Bacteria 507633
172 Ga0209051_1002210 3300025303 Bacteria 14371
173 Ga0209051_1011370 3300025303 Bacteria 4400
174 Ga0207692_10003219 3300025898 Bacteria 6344
175 Ga0207692_10140435 3300025898 Bacteria 1374
176 Ga0207642_10000403 3300025899 Bacteria 12996
177 Ga0207642_10042782 3300025899 Bacteria 1993
178 Ga0207710_10002107 3300025900 Bacteria 9411
179 Ga0207710_10036729 3300025900 Bacteria 2161
180 Ga0207688_10003429 3300025901 Bacteria 8644
181 Ga0207688_10010843 3300025901 Bacteria 4958
182 Ga0207680_10025685 3300025903 Bacteria 3252
183 Ga0207647_10120051 3300025904 Bacteria 1550
184 Ga0207699_10085954 3300025906 Bacteria 1963
185 Ga0207707_10267595 3300025912 Bacteria 1482
186 Ga0207671_10010365 3300025914 Bacteria 7698
187 Ga0207671_10058983 3300025914 Bacteria 2845
188 Ga0207693_10001914 3300025915 Bacteria 18219
189 Ga0207663_10000742 3300025916 Bacteria 14536
190 Ga0207663_10025778 3300025916 Bacteria 3404
191 Ga0207657_10120045 3300025919 Bacteria 2163
192 Ga0207657_10159122 3300025919 Bacteria 1835
193 Ga0207694_10367594 3300025924 Bacteria 1193
194 Ga0207650_10071803 3300025925 Bacteria 2605
195 Ga0207659_10024051 3300025926 Bacteria 4076
196 Ga0207687_10005643 3300025927 Bacteria 8277
197 Ga0207664_10185214 3300025929 Bacteria 1789
198 Ga0207644_10007199 3300025931 Bacteria 7242
199 Ga0207644_10037839 3300025931 Bacteria 3396
200 Ga0207690_10009092 3300025932 Bacteria 5896
201 Ga0207706_10011765 3300025933 Bacteria 7967
202 Ga0207706_10047402 3300025933 Bacteria 3802
203 Ga0207686_10005861 3300025934 Bacteria 6592
204 Ga0207709_10004992 3300025935 Bacteria 7587
205 Ga0207669_10000694 3300025937 Bacteria 14529
206 Ga0207669_10018223 3300025937 Bacteria 3623
207 Ga0207669_10069458 3300025937 Bacteria 2204
208 Ga0207704_10001427 3300025938 Bacteria 10689
209 Ga0207665_10006589 3300025939 Bacteria 7699
210 Ga0207665_10076063 3300025939 Bacteria 2301
211 Ga0207711_10013903 3300025941 Bacteria 6685
212 Ga0207711_10036225 3300025941 Bacteria 4186
213 Ga0207689_10023414 3300025942 Bacteria 5184
214 Ga0207667_10058057 3300025949 Bacteria 4060
215 Ga0207668_10002916 3300025972 Bacteria 10037
216 Ga0207640_10002577 3300025981 Bacteria 9715
217 Ga0207658_10001338 3300025986 Bacteria 19306
218 Ga0207658_10004833 3300025986 Bacteria 9315
219 Ga0207658_10307901 3300025986 Bacteria 1367
220 Ga0207677_10003330 3300026023 Bacteria 8505
221 Ga0207703_10006568 3300026035 Bacteria 9279
222 Ga0207639_10062990 3300026041 Bacteria 2870
223 Ga0207639_10168436 3300026041 Bacteria 1853
224 Ga0207639_10609057 3300026041 Bacteria 1008
225 Ga0207678_10024112 3300026067 Bacteria 5316
226 Ga0207678_10061374 3300026067 Bacteria 3233
227 Ga0207678_10088231 3300026067 Bacteria 2651
228 Ga0207708_10017968 3300026075 Bacteria 5320
229 Ga0207708_10019256 3300026075 Bacteria 5142
230 Ga0207648_10004877 3300026089 Bacteria 13681
231 Ga0207648_10022332 3300026089 Bacteria 5685
232 Ga0207676_10065182 3300026095 Bacteria 2900
233 Ga0207675_100003343 3300026118 Bacteria 15693
234 Ga0207675_100658571 3300026118 Bacteria 1054
235 Ga0207683_10002931 3300026121 Bacteria 14875
236 Ga0207683_10011121 3300026121 Bacteria 7670
237 Ga0207698_10007131 3300026142 Bacteria 6998
238 Ga0207698_10088823 3300026142 Bacteria 2522
239 Ga0207698_10257526 3300026142 Bacteria 1601
240 Ga0207428_10329534 3300027907 Bacteria 1126
241 Ga0268266_10083007 3300028379 Bacteria 2796
242 Ga0268265_10006144 3300028380 Bacteria 8147
243 Ga0268264_10002792 3300028381 Bacteria 15252
244 Ga0268264_10566161 3300028381 Bacteria 1116
245 Ga0265327_10000185 3300031251 Bacteria 131884
246 Ga0265327_10016677 3300031251 Bacteria 4651
247 Ga0307408_100202209 3300031548 Bacteria 1609
248 Ga0307413_10007246 3300031824 Bacteria 5134
249 Ga0307413_10212635 3300031824 Bacteria 1406
250 Ga0307410_10002413 3300031852 Bacteria 9026
251 Ga0307410_10285313 3300031852 Bacteria 1297
252 Ga0307407_10008782 3300031903 Bacteria 4663
253 Ga0307409_100003442 3300031995 Bacteria 8593
254 Ga0307416_100268670 3300032002 Bacteria 1673
255 Ga0307414_10093768 3300032004 Bacteria 2239
256 Ga0307414_10512058 3300032004 Bacteria 1064
257 Ga0307415_100218979 3300032126 Bacteria 1525
258 Ga0373940_0081155 3300035088 Bacteria 959
259 Ga0373941_0135315 3300035115 Bacteria 891
260 Ga0436364_0208361 3300037853 Bacteria 12457
261 Ga0439466_0011019 3300041411 Bacteria 3352
262 Ga0439465_0012759 3300041413 Bacteria 2627
263 Ga0439465_0013556 3300041413 Bacteria 2539
264 Ga0439450_038298 3300042008 Bacteria 1105
265 Ga0439434_0040061 3300042435 Bacteria 1438
266 Ga0466969_0062813 3300044656 Bacteria 1801
267 Ga0466972_0002119 3300044658 Bacteria 9741
268 Ga0466972_0012590 3300044658 Bacteria 4250
269 Ga0466965_0007854 3300044683 Bacteria 4918
270 Ga0466965_0011689 3300044683 Bacteria 4117
271 Ga0466965_0169684 3300044683 Bacteria 1147
272 Ga0466966_0009905 3300044684 Bacteria 6317
273 Ga0466966_0011780 3300044684 Bacteria 5793
274 Ga0466961_0003546 3300044693 Bacteria 9731
275 Ga0466961_0012307 3300044693 Bacteria 5471
276 Ga0466964_0090786 3300044706 Bacteria 1329
277 Ga0466968_0005171 3300044735 Bacteria 4880
278 Ga0466968_0022063 3300044735 Bacteria 2585
279 Ga0466968_0068064 3300044735 Bacteria 1545
280 Ga0466970_0003253 3300044765 Bacteria 7898
281 Ga0466970_0039650 3300044765 Bacteria 2500
282 Ga0466970_0071454 3300044765 Bacteria 1867
283 Ga0466957_0005609 3300044842 Bacteria 7053
284 Ga0466957_0028509 3300044842 Bacteria 3325
285 Ga0466957_0120135 3300044842 Bacteria 1674
286 Ga0466960_0000012 3300044901 Bacteria 60091
287 Ga0466960_0010929 3300044901 Bacteria 3780
288 Ga0466959_0002112 3300045049 Bacteria 12573
289 Ga0466959_0006635 3300045049 Bacteria 8039
290 Ga0466959_0007300 3300045049 Bacteria 7747
291 Ga0466958_0001878 3300045836 Bacteria 10262
292 Ga0466958_0003647 3300045836 Bacteria 8033
293 Ga0466967_0025634 3300045976 Bacteria 4866
294 Ga0466967_0033555 3300045976 Bacteria 4346
295 Ga0466967_0115224 3300045976 Bacteria 2475
296 Ga0466967_0132038 3300045976 Bacteria 2319
297 Ga0466967_0414022 3300045976 Bacteria 1313
298 Ga0466967_0501015 3300045976 Bacteria 1192
299 Ga0495603_0016953 3300046455 Bacteria 4408
300 Ga0495641_0074020 3300046461 Bacteria 1528
301 Ga0495653_0272951 3300046463 Bacteria 1113
302 Ga0495582_0031655 3300046473 Bacteria 2908
303 Ga0495606_0037240 3300046507 Bacteria 3305
304 Ga0495618_0189706 3300046514 Bacteria 1304
305 Ga0495644_0083710 3300046523 Bacteria 1203
306 Ga0495648_0074539 3300046524 Bacteria 1954
307 Ga0495658_0122494 3300046683 Bacteria 1574
308 Ga0495624_0039569 3300046690 Bacteria 3022
309 Ga0495649_0026951 3300046694 Bacteria 3191
310 Ga0495649_0258231 3300046694 Bacteria 894
311 Ga0495581_0022349 3300047315 Bacteria 3666
312 Ga0495674_0385668 3300047319 Bacteria 1133
313 Ga0495672_0006687 3300047320 Bacteria 8853
314 Ga0495672_0043413 3300047320 Bacteria 2704
315 Ga0495676_0133535 3300047321 Bacteria 1788
316 Ga0495673_0001818 3300047469 Bacteria 16118
317 Ga0495686_0002396 3300047472 Bacteria 17811
318 Ga0495602_0253831 3300048088 Bacteria 1309
319 Ga0496100_0000080 3300048903 Bacteria 54146
320 Ga0496100_0001558 3300048903 Bacteria 11275
321 Ga0496100_0008045 3300048903 Bacteria 5859
322 Ga0496100_0017103 3300048903 Bacteria 4274
323 Ga0496100_0046056 3300048903 Bacteria 2802
324 Ga0496100_0476186 3300048903 Bacteria 960
325 Ga0496101_0000113 3300048904 Bacteria 81197
326 Ga0496101_0000853 3300048904 Bacteria 17992
327 Ga0496101_0001206 3300048904 Bacteria 15475
328 Ga0496101_0009248 3300048904 Bacteria 6471
329 Ga0496101_0012421 3300048904 Bacteria 5684
330 Ga0496101_0017610 3300048904 Bacteria 4847
331 Ga0496101_0019195 3300048904 Bacteria 4663
332 Ga0496102_0000035 3300048905 Bacteria 213557
333 Ga0496102_0003167 3300048905 Bacteria 13958
334 Ga0496102_0005777 3300048905 Bacteria 10519
335 Ga0496102_0045680 3300048905 Bacteria 3977
336 Ga0496102_0051769 3300048905 Bacteria 3740
337 Ga0496102_0075419 3300048905 Bacteria 3101
338 Ga0496102_0167232 3300048905 Bacteria 2069
339 Ga0496102_0293915 3300048905 Bacteria 1531
340 Ga0496103_0000028 3300048906 Bacteria 213660
341 Ga0496103_0000909 3300048906 Bacteria 21275
342 Ga0496103_0004600 3300048906 Bacteria 8357
343 Ga0496103_0275794 3300048906 Bacteria 1082
344 Ga0496104_0015783 3300048907 Bacteria 6851
345 Ga0496104_0149494 3300048907 Bacteria 2243
346 Ga0496104_0206973 3300048907 Bacteria 1874
347 Ga0496104_0386675 3300048907 Bacteria 1311
348 Ga0496105_0002971 3300048908 Bacteria 12453
349 Ga0496105_0069155 3300048908 Bacteria 2918
350 Ga0496106_0001401 3300048909 Bacteria 18078
351 Ga0496106_0001795 3300048909 Bacteria 16032
352 Ga0496106_0002374 3300048909 Bacteria 14017
353 Ga0496106_0013651 3300048909 Bacteria 5997
354 Ga0496106_0022714 3300048909 Bacteria 4661
355 Ga0496107_0000284 3300048910 Bacteria 26860
356 Ga0496107_0000411 3300048910 Bacteria 23223
357 Ga0496107_0003615 3300048910 Bacteria 10383
358 Ga0496108_0061251 3300048911 Bacteria 3166
359 Ga0496108_0068582 3300048911 Bacteria 2992
360 Ga0496108_0092462 3300048911 Bacteria 2572
361 Ga0496108_0196502 3300048911 Bacteria 1749
362 Ga0496109_0000745 3300048912 Bacteria 27076
363 Ga0496109_0002956 3300048912 Bacteria 14219
364 Ga0496109_0019643 3300048912 Bacteria 5960
365 Ga0496109_0054066 3300048912 Bacteria 3664
366 Ga0496109_0465980 3300048912 Bacteria 1193
367 Ga0496110_0007854 3300048913 Bacteria 8547
368 Ga0496110_0084952 3300048913 Bacteria 2825
369 Ga0496110_0120701 3300048913 Bacteria 2361
370 Ga0496111_0058943 3300048914 Bacteria 2781
371 Ga0496112_0005129 3300048915 Bacteria 11261
372 Ga0496112_0015164 3300048915 Bacteria 7182
373 Ga0496112_0036704 3300048915 Bacteria 4781
374 Ga0496112_0036932 3300048915 Bacteria 4767
375 Ga0496112_0349642 3300048915 Bacteria 1421
376 Ga0496113_0009923 3300048916 Bacteria 6273
377 Ga0496113_0055896 3300048916 Bacteria 2961
378 Ga0496113_0076570 3300048916 Bacteria 2556
379 Ga0496113_0466916 3300048916 Bacteria 1014
380 Ga0496114_0000117 3300048917 Bacteria 57611
381 Ga0496114_0000808 3300048917 Bacteria 23470
382 Ga0496114_0000898 3300048917 Bacteria 22255
383 Ga0496114_0067299 3300048917 Bacteria 3005
384 Ga0496114_0788441 3300048917 Bacteria 829
385 Ga0496115_0003690 3300048918 Bacteria 11022
386 Ga0496115_0008575 3300048918 Bacteria 7568
387 Ga0496115_0054301 3300048918 Bacteria 3217
388 Ga0496116_0000090 3300048919 Bacteria 212651
389 Ga0496116_0001748 3300048919 Bacteria 23655
390 Ga0496117_0000051 3300048920 Bacteria 285716
391 Ga0496117_0013172 3300048920 Bacteria 7232
392 Ga0496118_0000043 3300048921 Bacteria 285716
393 Ga0496118_0017042 3300048921 Bacteria 6633
394 Ga0496119_0009569 3300048922 Bacteria 8287
395 Ga0496119_0011453 3300048922 Bacteria 7341
396 Ga0496119_0222630 3300048922 Bacteria 965
397 Ga0496120_0000274 3300048923 Bacteria 86195
398 Ga0496120_0023245 3300048923 Bacteria 3883
399 Ga0496121_0000014 3300048924 Bacteria 609379
400 Ga0496121_0000080 3300048924 Bacteria 230195
401 Ga0496122_0000097 3300048925 Bacteria 199223
402 Ga0496122_0004224 3300048925 Bacteria 18054
403 Ga0496123_0009963 3300048926 Bacteria 8472
404 Ga0496123_0010122 3300048926 Bacteria 8382
405 Ga0496124_0000019 3300048927 Bacteria 436995
406 Ga0496125_0000014 3300048928 Bacteria 610124
407 Ga0496125_0232659 3300048928 Bacteria 1177
408 Ga0496126_0000017 3300048929 Bacteria 610676
409 Ga0496126_0001415 3300048929 Bacteria 37973
410 Ga0496126_0001960 3300048929 Bacteria 29175
411 Ga0501032_0006005 3300049569 Bacteria 8955
412 Ga0501032_0030197 3300049569 Bacteria 3718
413 Ga0501033_0011282 3300049570 Bacteria 6841
414 Ga0501034_0007201 3300049571 Bacteria 11874
415 Ga0501034_0208668 3300049571 Bacteria 1909
416 Ga0501034_0316418 3300049571 Bacteria 1494
417 Ga0501036_0080513 3300049572 Bacteria 2753
418 Ga0501037_0000581 3300049573 Bacteria 28754
419 Ga0501038_0001720 3300049574 Bacteria 20347
420 Ga0501039_0001136 3300049575 Bacteria 19618
421 Ga0501043_0005616 3300049579 Bacteria 10101
422 Ga0501043_0079593 3300049579 Bacteria 2575
423 Ga0501047_0004425 3300049581 Bacteria 13227
424 Ga0501047_0031544 3300049581 Bacteria 5111
425 Ga0501068_0016223 3300049584 Bacteria 4292
426 Ga0501070_0000247 3300049586 Bacteria 50837
427 Ga0501070_0061017 3300049586 Bacteria 3125
428 Ga0501070_0192927 3300049586 Bacteria 1674
429 Ga0501070_0335744 3300049586 Bacteria 1228
430 Ga0501035_0000640 3300049822 Bacteria 38536
431 Ga0501044_0002179 3300049823 Bacteria 22462
432 Ga0501044_0002213 3300049823 Bacteria 22295
433 nmdc:mga03683_43835_c1 3300050489 Bacteria 1847
434 nmdc:mga03n38_11962_c1 3300050490 Bacteria 3249
435 nmdc:mga03n38_234125_c1 3300050490 Bacteria 964
436 nmdc:mga03n38_28697_c1 3300050490 Bacteria 2322
437 nmdc:mga03n38_50979_c1 3300050490 Bacteria 1846
438 nmdc:mga03n38_58418_c1 3300050490 Bacteria 1748
439 nmdc:mga03n38_745_c1 3300050490 Bacteria 8601
440 nmdc:mga00v17_143885_c1 3300050491 Bacteria 1530
441 nmdc:mga00v17_14794_c1 3300050491 Bacteria 4365
442 nmdc:mga00v17_204069_c1 3300050491 Bacteria 1278
443 nmdc:mga00v17_391695_c1 3300050491 Bacteria 903
444 nmdc:mga00v17_39338_c1 3300050491 Bacteria 2832
445 nmdc:mga00v17_39829_c1 3300050491 Bacteria 2816
446 nmdc:mga00v17_67712_c1 3300050491 Bacteria 2206
447 nmdc:mga00v17_87375_c1 3300050491 Bacteria 1954
448 nmdc:mga0yw44_13752_c1 3300050492 Bacteria 4273
449 nmdc:mga0yw44_3079_c1 3300050492 Bacteria 7304
450 nmdc:mga06z11_95426_c1 3300050494 Bacteria 1622
451 nmdc:mga07m45_1645_c1 3300050496 Bacteria 10296
452 nmdc:mga07m45_5679_c1 3300050496 Bacteria 4511
453 nmdc:mga0qj67_105878_c1 3300050509 Bacteria 2269
454 nmdc:mga0qj67_286133_c1 3300050509 Bacteria 1336
455 nmdc:mga08y16_774845_c1 3300050511 Bacteria 954
456 nmdc:mga0sz30_110018_c1 3300050516 Bacteria 1207
457 nmdc:mga0sz30_25173_c1 3300050516 Bacteria 2434
458 nmdc:mga0sz30_4858_c2 3300050516 Bacteria 4250
459 nmdc:mga0sz30_635_c1 3300050516 Bacteria 12587
460 nmdc:mga0sz30_6705_c1 3300050516 Bacteria 4288
461 Ga0495601_0213613 3300053077 Bacteria 1260
462 Ga0500610_0007394 3300053079 Bacteria 4702
463 Ga0500643_004632 3300053087 Bacteria 6142
464 Ga0500556_0006160 3300053104 Bacteria 3402
465 Ga0500642_0155550 3300053130 Bacteria 1073
466 Ga0500616_0187579 3300053153 Bacteria 926
467 Ga0466962_0088209 3300061719 Bacteria 1486
468 2929215805 2929212328 Bacteria 7708288
469 2644485410 2643221687 Bacteria 6500351
470 2644634674 2643221715 Bacteria 6671032
471 2738667625 2738541264 Bacteria 5935393
472 2739146695 2738541356 Bacteria 5935017
473 2842139959 2842134933 Bacteria 5847019
474 2902794859 2902792274 Bacteria 7270173
475 2902804520 2902799365 Bacteria 5419524
476 2902838074 2902837492 Bacteria 6697721
477 2939585422 2939582691 Bacteria 7088898
478 JGI24746J21847_1000293
479 JGI24743J22301_10005086
480 JGI24738J21930_10016769
481 JGI24744J21845_10004206
482 JGI24742J22300_10019544
483 rootH2_10151049
484 Ga0055540_1000024
485 Ga0055540_1005116
486 Ga0055540_1011517
487 Ga0070677_10215782
488 Ga0068869_100006273
489 Ga0070682_100023290
490 Ga0070682_100069301
491 Ga0070682_100095431
492 Ga0070682_100096045
493 Ga0068868_100001420
494 Ga0070691_10048047
495 Ga0070687_100286813
496 Ga0070668_100001434
497 Ga0070668_100204298
498 Ga0070669_100030631
499 Ga0070671_100004506
500 Ga0070671_100245963
501 Ga0070674_100000938
502 Ga0070674_100019530
503 Ga0070674_100147789
504 Ga0070688_100096844
505 Ga0070688_100172278
506 Ga0070659_100108012
507 Ga0070667_100001451
508 Ga0070667_100003821
509 Ga0070667_100250464
510 Ga0070667_100277404
511 Ga0070709_10026162
512 Ga0070714_100216590
513 Ga0070713_100008174
514 Ga0070713_100406214
515 Ga0070710_10011316
516 Ga0070710_10055028
517 Ga0070701_10001800
518 Ga0070701_10074931
519 Ga0070711_100015178
520 Ga0070705_100153939
521 Ga0070700_100002918
522 Ga0070700_100049459
523 Ga0070694_100048016
524 Ga0070694_100223073
525 Ga0070663_100023405
526 Ga0070663_100065687
527 Ga0070678_100163607
528 Ga0070662_100002831
529 Ga0070662_100226681
530 Ga0068867_100001679
531 Ga0068867_100472570
532 Ga0070685_10228413
533 Ga0070684_100412511
534 Ga0068853_100003194
535 Ga0068853_100051794
536 Ga0068853_100172854
537 Ga0068853_100355754
538 Ga0070672_100553916
539 Ga0070686_100176311
540 Ga0070695_100023491
541 Ga0070696_100003826
542 Ga0070696_100119296
543 Ga0070665_100042386
544 Ga0070665_100503295
545 Ga0070704_100001795
546 Ga0070704_100576108
547 Ga0068855_100033547
548 Ga0070664_100207070
549 Ga0070664_100301883
550 Ga0068854_100005363
551 Ga0070702_100004175
552 Ga0068852_100447661
553 Ga0068859_100004345
554 Ga0068859_100074714
555 Ga0068864_100171776
556 Ga0068866_10000336
557 Ga0068861_100000265
558 Ga0068870_10113130
559 Ga0068863_100451967
560 Ga0068858_100000562
561 Ga0068858_100101203
562 Ga0068860_100001976
563 Ga0068860_100088530
564 Ga0068862_100001990
565 Ga0068862_100203901
566 Ga0075365_10002576
567 Ga0075365_10056289
568 Ga0075365_10071790
569 Ga0075363_100001944
570 Ga0075363_100004058
571 Ga0075363_100005253
572 Ga0075363_100021129
573 Ga0075363_100045962
574 Ga0075363_100052549
575 Ga0075363_100141524
576 Ga0075364_10000578
577 Ga0075364_10006506
578 Ga0075364_10093144
579 Ga0075364_10166209
580 Ga0075364_10166423
581 Ga0075364_10196537
582 Ga0070715_10031623
583 Ga0070716_100010766
584 Ga0070712_100001538
585 Ga0070712_100002172
586 Ga0075367_10025917
587 Ga0075369_10012778
588 Ga0075369_10017995
589 Ga0075369_10065423
590 Ga0075369_10087857
591 Ga0075369_10126828
592 Ga0075366_10269415
593 Ga0075370_10001363
594 Ga0075370_10003874
595 Ga0075370_10231060
596 Ga0075428_100240033
597 Ga0075430_100050382
598 Ga0068865_100001148
599 Ga0068865_100139013
600 Ga0097620_100004345
601 Ga0097620_100074715
602 Ga0075435_100407829
603 Ga0105245_10002751
604 Ga0105245_10308519
605 Ga0105247_10001497
606 Ga0105247_10550971
607 Ga0114129_10090830
608 Ga0105243_10001548
609 Ga0105243_10215621
610 Ga0105243_10218125
611 Ga0105242_10001696
612 Ga0105242_10187766
613 Ga0105242_10229190
614 Ga0105248_10012181
615 Ga0105248_10032162
616 Ga0105248_10375811
617 Ga0105248_10748973
618 Ga0105237_10011057
619 Ga0105237_10091826
620 Ga0105237_10136470
621 Ga0105237_10290939
622 Ga0105237_10646251
623 Ga0105249_10002641
624 Ga0099796_10032535
625 Ga0105239_10002595
626 Ga0105239_10048844
627 Ga0105239_10487997
628 Ga0105246_10026919
629 Ga0157369_10506761
630 Ga0157374_10021241
631 Ga0157378_10000448
632 Ga0163162_10008162
633 Ga0163162_10137763
634 Ga0157372_10004124
635 Ga0157372_10438244
636 Ga0157375_10001299
637 Ga0157375_10337167
638 Ga0157375_10957863
639 Ga0163163_10172207
640 Ga0157380_10014231
641 Ga0157380_10273633
642 Ga0157377_10093588
643 Ga0157379_10005763
644 Ga0157379_10080262
645 Ga0157376_10277543
646 Ga0163161_10002025
647 Ga0163161_10042112
648 Ga0209051_1000021
649 Ga0209051_1002210
650 Ga0209051_1011370
651 Ga0207692_10003219
652 Ga0207692_10140435
653 Ga0207642_10000403
654 Ga0207642_10042782
655 Ga0207710_10002107
656 Ga0207710_10036729
657 Ga0207688_10003429
658 Ga0207688_10010843
659 Ga0207680_10025685
660 Ga0207647_10120051
661 Ga0207699_10085954
662 Ga0207707_10267595
663 Ga0207671_10010365
664 Ga0207671_10058983
665 Ga0207693_10001914
666 Ga0207663_10000742
667 Ga0207663_10025778
668 Ga0207657_10120045
669 Ga0207657_10159122
670 Ga0207694_10367594
671 Ga0207650_10071803
672 Ga0207659_10024051
673 Ga0207687_10005643
674 Ga0207664_10185214
675 Ga0207644_10007199
676 Ga0207644_10037839
677 Ga0207690_10009092
678 Ga0207706_10011765
679 Ga0207706_10047402
680 Ga0207686_10005861
681 Ga0207709_10004992
682 Ga0207669_10000694
683 Ga0207669_10018223
684 Ga0207669_10069458
685 Ga0207704_10001427
686 Ga0207665_10006589
687 Ga0207665_10076063
688 Ga0207711_10013903
689 Ga0207711_10036225
690 Ga0207689_10023414
691 Ga0207667_10058057
692 Ga0207668_10002916
693 Ga0207640_10002577
694 Ga0207658_10001338
695 Ga0207658_10004833
696 Ga0207658_10307901
697 Ga0207677_10003330
698 Ga0207703_10006568
699 Ga0207639_10062990
700 Ga0207639_10168436
701 Ga0207639_10609057
702 Ga0207678_10024112
703 Ga0207678_10061374
704 Ga0207678_10088231
705 Ga0207708_10017968
706 Ga0207708_10019256
707 Ga0207648_10004877
708 Ga0207648_10022332
709 Ga0207676_10065182
710 Ga0207675_100003343
711 Ga0207675_100658571
712 Ga0207683_10002931
713 Ga0207683_10011121
714 Ga0207698_10007131
715 Ga0207698_10088823
716 Ga0207698_10257526
717 Ga0207428_10329534
718 Ga0268266_10083007
719 Ga0268265_10006144
720 Ga0268264_10002792
721 Ga0268264_10566161
722 Ga0265327_10000185
723 Ga0265327_10016677
724 Ga0307408_100202209
725 Ga0307413_10007246
726 Ga0307413_10212635
727 Ga0307410_10002413
728 Ga0307410_10285313
729 Ga0307407_10008782
730 Ga0307409_100003442
731 Ga0307416_100268670
732 Ga0307414_10093768
733 Ga0307414_10512058
734 Ga0307415_100218979
735 Ga0373940_0081155
736 Ga0373941_0135315
737 Ga0436364_0208361
738 Ga0439466_0011019
739 Ga0439465_0012759
740 Ga0439465_0013556
741 Ga0439450_038298
742 Ga0439434_0040061
743 Ga0466969_0062813
744 Ga0466972_0002119
745 Ga0466972_0012590
746 Ga0466965_0007854
747 Ga0466965_0011689
748 Ga0466965_0169684
749 Ga0466966_0009905
750 Ga0466966_0011780
751 Ga0466961_0003546
752 Ga0466961_0012307
753 Ga0466964_0090786
754 Ga0466968_0005171
755 Ga0466968_0022063
756 Ga0466968_0068064
757 Ga0466970_0003253
758 Ga0466970_0039650
759 Ga0466970_0071454
760 Ga0466957_0005609
761 Ga0466957_0028509
762 Ga0466957_0120135
763 Ga0466960_0000012
764 Ga0466960_0010929
765 Ga0466959_0002112
766 Ga0466959_0006635
767 Ga0466959_0007300
768 Ga0466958_0001878
769 Ga0466958_0003647
770 Ga0466967_0025634
771 Ga0466967_0033555
772 Ga0466967_0115224
773 Ga0466967_0132038
774 Ga0466967_0414022
775 Ga0466967_0501015
776 Ga0495603_0016953
777 Ga0495641_0074020
778 Ga0495653_0272951
779 Ga0495582_0031655
780 Ga0495606_0037240
781 Ga0495618_0189706
782 Ga0495644_0083710
783 Ga0495648_0074539
784 Ga0495658_0122494
785 Ga0495624_0039569
786 Ga0495649_0026951
787 Ga0495649_0258231
788 Ga0495581_0022349
789 Ga0495674_0385668
790 Ga0495672_0006687
791 Ga0495672_0043413
792 Ga0495676_0133535
793 Ga0495673_0001818
794 Ga0495686_0002396
795 Ga0495602_0253831
796 Ga0496100_0000080
797 Ga0496100_0001558
798 Ga0496100_0008045
799 Ga0496100_0017103
800 Ga0496100_0046056
801 Ga0496100_0476186
802 Ga0496101_0000113
803 Ga0496101_0000853
804 Ga0496101_0001206
805 Ga0496101_0009248
806 Ga0496101_0012421
807 Ga0496101_0017610
808 Ga0496101_0019195
809 Ga0496102_0000035
810 Ga0496102_0003167
811 Ga0496102_0005777
812 Ga0496102_0045680
813 Ga0496102_0051769
814 Ga0496102_0075419
815 Ga0496102_0167232
816 Ga0496102_0293915
817 Ga0496103_0000028
818 Ga0496103_0000909
819 Ga0496103_0004600
820 Ga0496103_0275794
821 Ga0496104_0015783
822 Ga0496104_0149494
823 Ga0496104_0206973
824 Ga0496104_0386675
825 Ga0496105_0002971
826 Ga0496105_0069155
827 Ga0496106_0001401
828 Ga0496106_0001795
829 Ga0496106_0002374
830 Ga0496106_0013651
831 Ga0496106_0022714
832 Ga0496107_0000284
833 Ga0496107_0000411
834 Ga0496107_0003615
835 Ga0496108_0061251
836 Ga0496108_0068582
837 Ga0496108_0092462
838 Ga0496108_0196502
839 Ga0496109_0000745
840 Ga0496109_0002956
841 Ga0496109_0019643
842 Ga0496109_0054066
843 Ga0496109_0465980
844 Ga0496110_0007854
845 Ga0496110_0084952
846 Ga0496110_0120701
847 Ga0496111_0058943
848 Ga0496112_0005129
849 Ga0496112_0015164
850 Ga0496112_0036704
851 Ga0496112_0036932
852 Ga0496112_0349642
853 Ga0496113_0009923
854 Ga0496113_0055896
855 Ga0496113_0076570
856 Ga0496113_0466916
857 Ga0496114_0000117
858 Ga0496114_0000808
859 Ga0496114_0000898
860 Ga0496114_0067299
861 Ga0496114_0788441
862 Ga0496115_0003690
863 Ga0496115_0008575
864 Ga0496115_0054301
865 Ga0496116_0000090
866 Ga0496116_0001748
867 Ga0496117_0000051
868 Ga0496117_0013172
869 Ga0496118_0000043
870 Ga0496118_0017042
871 Ga0496119_0009569
872 Ga0496119_0011453
873 Ga0496119_0222630
874 Ga0496120_0000274
875 Ga0496120_0023245
876 Ga0496121_0000014
877 Ga0496121_0000080
878 Ga0496122_0000097
879 Ga0496122_0004224
880 Ga0496123_0009963
881 Ga0496123_0010122
882 Ga0496124_0000019
883 Ga0496125_0000014
884 Ga0496125_0232659
885 Ga0496126_0000017
886 Ga0496126_0001415
887 Ga0496126_0001960
888 Ga0501032_0006005
889 Ga0501032_0030197
890 Ga0501033_0011282
891 Ga0501034_0007201
892 Ga0501034_0208668
893 Ga0501034_0316418
894 Ga0501036_0080513
895 Ga0501037_0000581
896 Ga0501038_0001720
897 Ga0501039_0001136
898 Ga0501043_0005616
899 Ga0501043_0079593
900 Ga0501047_0004425
901 Ga0501047_0031544
902 Ga0501068_0016223
903 Ga0501070_0000247
904 Ga0501070_0061017
905 Ga0501070_0192927
906 Ga0501070_0335744
907 Ga0501035_0000640
908 Ga0501044_0002179
909 Ga0501044_0002213
910 nmdc:mga03683_43835_c1
911 nmdc:mga03n38_11962_c1
912 nmdc:mga03n38_234125_c1
913 nmdc:mga03n38_28697_c1
914 nmdc:mga03n38_50979_c1
915 nmdc:mga03n38_58418_c1
916 nmdc:mga03n38_745_c1
917 nmdc:mga00v17_143885_c1
918 nmdc:mga00v17_14794_c1
919 nmdc:mga00v17_204069_c1
920 nmdc:mga00v17_391695_c1
921 nmdc:mga00v17_39338_c1
922 nmdc:mga00v17_39829_c1
923 nmdc:mga00v17_67712_c1
924 nmdc:mga00v17_87375_c1
925 nmdc:mga0yw44_13752_c1
926 nmdc:mga0yw44_3079_c1
927 nmdc:mga06z11_95426_c1
928 nmdc:mga07m45_1645_c1
929 nmdc:mga07m45_5679_c1
930 nmdc:mga0qj67_105878_c1
931 nmdc:mga0qj67_286133_c1
932 nmdc:mga08y16_774845_c1
933 nmdc:mga0sz30_110018_c1
934 nmdc:mga0sz30_25173_c1
935 nmdc:mga0sz30_4858_c2
936 nmdc:mga0sz30_635_c1
937 nmdc:mga0sz30_6705_c1
938 Ga0495601_0213613
939 Ga0500610_0007394
940 Ga0500643_004632
941 Ga0500556_0006160
942 Ga0500642_0155550
943 Ga0500616_0187579
944 Ga0466962_0088209
945 2929215805
946 2644485410
947 2644634674
948 2738667625
949 2739146695
950 2842139959
951 2902794859
952 2902804520
953 2902838074
954 2939585422

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05949

DUF881

Bacterial protein of unknown function (DUF881)

137

280

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gmg-assembly1.cif.gz_B crystal structure of an uncharacterized conserved protein from mycobacterium tuberculosis 0.9213 139 280
3gmg-assembly1.cif.gz_B crystal structure of an uncharacterized conserved protein from mycobacterium tuberculosis 0.9087 139 280
6mx1-assembly1.cif.gz_B the crystal structure of the regulatory domain of aspartokinase in the bifunctional aspartokinase/homoserine dehydrogenase 1 from escherichia coli str. k-12 substr. mg1655 0.5786 151 259
3mah-assembly1.cif.gz_A-2 a putative c-terminal regulatory domain of aspartate kinase from porphyromonas gingivalis w83. 0.5713 150 259
5uzn-assembly1.cif.gz_A crystal structure of glorund qrrm3 domain 0.5704 152 263
ID Description Score Start End Superfamily
3gmgB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function DUF881 0.9213 139 280 3.30.70.1880
3gmgB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function DUF881 0.9087 139 280 3.30.70.1880
af_P9WFG1_148_306_3.30.70.1880 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function DUF881 0.8092 139 278 3.30.70.1880
af_L0T243_102_259_3.30.70.1880 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function DUF881 0.7564 137 281 3.30.70.1880
af_P9WFG1_148_306_3.30.70.1880 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function DUF881 0.7157 139 278 3.30.70.1880
ID Description Score Start End GO Terms
AF-A0A2S9FQJ5-F1-model_v4 Uncharacterized protein 0.956 163 260 GO:0005886
AF-A0A2X0UGG3-F1-model_v4 Bacterial protein of uncharacterized function (DUF881) 0.9462 152 277 GO:0005886
AF-A0A655FA10-F1-model_v4 Bacterial protein of uncharacterized function (DUF881) 0.925 141 281 GO:0005886
AF-X8F8R4-F1-model_v4 deleted 0.9234 168 281
AF-A0A7W1LIY9-F1-model_v4 DUF881 domain-containing protein 0.9199 148 279 GO:0005886

Map