F451793

General Info

Members Datasets Scaffolds Average Seq Length
477 234 475 297

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0014644|Ga0501035_0014644_4996_5910
Length 304
Sequence MTAAQDRITDRIKGSLTALITPMKDGQVDEAAFRALVSWQIAEGTHGLVPCGTTGESPTLSHAEHRRVIEICIEEAGGRVPVIAGAGSNATTEAISLTRFAKEAGADAVLSVTGYYNKPSQEGMYRHFMAIADAVDIPIILYNIPGRAIVEIAVETMARLSSHPNIIGVKDATANLMRPSRERVAIGTTRQDWLMLSGEDGTALGYMAYGGHGCISVTANVAPRLCAQFQEACLKGDFAAALAIQDKLMPLHDALFCEPSPAPVKYAASLLGLCRADVRLPLVEATGPAQERIRNAMAGAGLPI

Samples

Sample ID Description Type Environment
1 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
2 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
141 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
142 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
145 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
151 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
152 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
159 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
214 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
224 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
225 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
226 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
227 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
228 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
229 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
232 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 1.05
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.5
Nodule 0
Rhizoplane 4.82
Rhizosphere 86.58
Stem 0
Stem Tuber 0
Unclassified 2.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10000793 3300003320 Bacteria 9403
2 Ga0070658_10066655 3300005327 Bacteria 2941
3 Ga0070658_10100360 3300005327 Bacteria 2392
4 Ga0070658_10123427 3300005327 Bacteria 2153
5 Ga0070658_10123767 3300005327 Bacteria 2151
6 Ga0070658_10135106 3300005327 Bacteria 2057
7 Ga0070658_10156822 3300005327 Bacteria 1908
8 Ga0070658_10291509 3300005327 Bacteria 1390
9 Ga0070683_100418761 3300005329 Bacteria 1278
10 Ga0070670_100160842 3300005331 Bacteria 1946
11 Ga0070670_100440120 3300005331 Bacteria 1154
12 Ga0070666_10005773 3300005335 Bacteria 7604
13 Ga0070680_100006103 3300005336 Bacteria 9131
14 Ga0070680_100297453 3300005336 Bacteria 1368
15 Ga0068868_100318500 3300005338 Bacteria 1324
16 Ga0068868_100451170 3300005338 Bacteria 1119
17 Ga0070660_100008390 3300005339 Bacteria 7222
18 Ga0070660_100023494 3300005339 Bacteria 4567
19 Ga0070660_100025731 3300005339 Bacteria 4376
20 Ga0070660_100146908 3300005339 Bacteria 1894
21 Ga0070691_10003719 3300005341 Bacteria 6890
22 Ga0070661_100096241 3300005344 Bacteria 2196
23 Ga0070692_10000181 3300005345 Bacteria 16518
24 Ga0070668_100034681 3300005347 Bacteria 3846
25 Ga0070671_100181941 3300005355 Bacteria 1780
26 Ga0070659_100002415 3300005366 Bacteria 13278
27 Ga0070667_100057074 3300005367 Bacteria 3298
28 Ga0070667_100324443 3300005367 Bacteria 1390
29 Ga0070709_10000433 3300005434 Bacteria 25313
30 Ga0070714_100114529 3300005435 Bacteria 2392
31 Ga0070713_100000012 3300005436 Bacteria 137708
32 Ga0070710_10141236 3300005437 Bacteria 1477
33 Ga0070711_100175428 3300005439 Bacteria 1637
34 Ga0070694_100018461 3300005444 Bacteria 4426
35 Ga0070663_100223248 3300005455 Bacteria 1480
36 Ga0070678_100007105 3300005456 Bacteria 6623
37 Ga0070678_100023402 3300005456 Bacteria 4116
38 Ga0070681_10000074 3300005458 Bacteria 74128
39 Ga0070681_10050537 3300005458 Bacteria 4147
40 Ga0070681_10147771 3300005458 Bacteria 2278
41 Ga0070706_100338781 3300005467 Bacteria 1402
42 Ga0070679_100000961 3300005530 Bacteria 25075
43 Ga0070679_100029852 3300005530 Bacteria 5380
44 Ga0070679_100049640 3300005530 Bacteria 4179
45 Ga0070684_100184224 3300005535 Bacteria 1899
46 Ga0070684_100390870 3300005535 Bacteria 1282
47 Ga0068853_100000746 3300005539 Bacteria 22591
48 Ga0068853_100136291 3300005539 Bacteria 2201
49 Ga0068853_100268974 3300005539 Bacteria 1569
50 Ga0068853_100440300 3300005539 Bacteria 1224
51 Ga0070695_100063043 3300005545 Bacteria 2408
52 Ga0070693_100140416 3300005547 Bacteria 1520
53 Ga0070665_100002469 3300005548 Bacteria 20384
54 Ga0070665_100029434 3300005548 Bacteria 5528
55 Ga0070665_100041895 3300005548 Bacteria 4603
56 Ga0070665_100163366 3300005548 Bacteria 2229
57 Ga0068855_100026640 3300005563 Bacteria 6917
58 Ga0068855_100046246 3300005563 Bacteria 5145
59 Ga0068857_100107399 3300005577 Bacteria 2507
60 Ga0068854_100044954 3300005578 Bacteria 3138
61 Ga0068856_100001151 3300005614 Bacteria 27834
62 Ga0068856_100068435 3300005614 Bacteria 3510
63 Ga0068852_100209507 3300005616 Bacteria 1848
64 Ga0068859_100354640 3300005617 Bacteria 1562
65 Ga0068864_100146445 3300005618 Bacteria 2135
66 Ga0068861_100127439 3300005719 Bacteria 2062
67 Ga0068863_100170875 3300005841 Bacteria 2085
68 Ga0068858_100027825 3300005842 Bacteria 5252
69 Ga0068860_100067312 3300005843 Bacteria 3403
70 Ga0068860_100159045 3300005843 Bacteria 2178
71 Ga0068860_100370082 3300005843 Bacteria 1413
72 Ga0068860_100474073 3300005843 Bacteria 1247
73 Ga0068862_100116858 3300005844 Bacteria 2347
74 Ga0081455_10006404 3300005937 Bacteria 12631
75 Ga0081455_10073775 3300005937 Bacteria 2820
76 Ga0075365_10022074 3300006038 Bacteria 3982
77 Ga0075365_10080516 3300006038 Bacteria 2205
78 Ga0075368_10000420 3300006042 Bacteria 12500
79 Ga0075368_10062779 3300006042 Bacteria 1490
80 Ga0075363_100021962 3300006048 Bacteria 3222
81 Ga0075363_100058165 3300006048 Bacteria 2076
82 Ga0070712_100000098 3300006175 Bacteria 44128
83 Ga0075367_10001232 3300006178 Bacteria 10750
84 Ga0075367_10007139 3300006178 Bacteria 5699
85 Ga0097621_100001637 3300006237 Bacteria 15341
86 Ga0097621_100035828 3300006237 Bacteria 3966
87 Ga0097621_100057984 3300006237 Bacteria 3168
88 Ga0097621_100094427 3300006237 Bacteria 2507
89 Ga0097621_100339153 3300006237 Bacteria 1334
90 Ga0068871_100006532 3300006358 Bacteria 8260
91 Ga0068871_100034479 3300006358 Bacteria 4016
92 Ga0068871_100092688 3300006358 Bacteria 2520
93 Ga0068871_100098128 3300006358 Bacteria 2451
94 Ga0075428_100164340 3300006844 Bacteria 2408
95 Ga0075431_100112704 3300006847 Bacteria 2807
96 Ga0075431_100429696 3300006847 Bacteria 1319
97 Ga0075431_100452513 3300006847 Bacteria 1279
98 Ga0075434_100026298 3300006871 Bacteria 5699
99 Ga0075434_100039552 3300006871 Bacteria 4674
100 Ga0075434_100052941 3300006871 Bacteria 4034
101 Ga0075429_100235142 3300006880 Bacteria 1605
102 Ga0068865_100009417 3300006881 Bacteria 6056
103 Ga0075436_100000416 3300006914 Bacteria 27313
104 Ga0097620_100354618 3300006931 Bacteria 1562
105 Ga0105240_10007938 3300009093 Bacteria 15312
106 Ga0105240_10017462 3300009093 Bacteria 9668
107 Ga0105240_10065129 3300009093 Bacteria 4524
108 Ga0105240_10157991 3300009093 Bacteria 2695
109 Ga0105240_10159139 3300009093 Bacteria 2684
110 Ga0105240_10223389 3300009093 Bacteria 2193
111 Ga0105240_10423210 3300009093 Bacteria 1496
112 Ga0105240_10457865 3300009093 Bacteria 1426
113 Ga0111539_10001024 3300009094 Bacteria 36666
114 Ga0111539_10077007 3300009094 Bacteria 3926
115 Ga0111539_10482901 3300009094 Bacteria 1443
116 Ga0105245_10041140 3300009098 Bacteria 4120
117 Ga0105245_10047517 3300009098 Bacteria 3838
118 Ga0105245_10169570 3300009098 Bacteria 2078
119 Ga0105245_10690265 3300009098 Bacteria 1053
120 Ga0105247_10110351 3300009101 Bacteria 1770
121 Ga0114129_10090961 3300009147 Bacteria 4229
122 Ga0114129_10188829 3300009147 Bacteria 2799
123 Ga0114129_10716751 3300009147 Bacteria 1284
124 Ga0105243_10006489 3300009148 Bacteria 9046
125 Ga0105243_10226090 3300009148 Bacteria 1657
126 Ga0105241_10009944 3300009174 Bacteria 6988
127 Ga0105241_10025069 3300009174 Bacteria 4432
128 Ga0105241_10386121 3300009174 Bacteria 1225
129 Ga0105248_10000013 3300009177 Bacteria 328864
130 Ga0105248_10700956 3300009177 Bacteria 1142
131 Ga0105237_10077546 3300009545 Bacteria 3313
132 Ga0105237_10227055 3300009545 Bacteria 1867
133 Ga0105237_10304701 3300009545 Bacteria 1596
134 Ga0105237_10313190 3300009545 Bacteria 1573
135 Ga0105238_10011343 3300009551 Bacteria 8967
136 Ga0105238_10071592 3300009551 Bacteria 3464
137 Ga0105238_10149922 3300009551 Bacteria 2307
138 Ga0105249_10613904 3300009553 Bacteria 1143
139 Ga0105239_10006956 3300010375 Bacteria 13038
140 Ga0105239_10031804 3300010375 Bacteria 5798
141 Ga0105239_10095539 3300010375 Bacteria 3283
142 Ga0105246_10004442 3300011119 Bacteria 8536
143 Ga0105246_10200964 3300011119 Bacteria 1549
144 Ga0157373_10035798 3300013100 Bacteria 3563
145 Ga0157370_10081034 3300013104 Bacteria 3055
146 Ga0157369_10009612 3300013105 Bacteria 11056
147 Ga0157369_10027642 3300013105 Bacteria 6285
148 Ga0157369_10160987 3300013105 Bacteria 2369
149 Ga0157374_10110854 3300013296 Bacteria 2639
150 Ga0157378_10004593 3300013297 Bacteria 12114
151 Ga0157378_10060405 3300013297 Bacteria 3383
152 Ga0157378_10205272 3300013297 Bacteria 1866
153 Ga0157378_10215752 3300013297 Bacteria 1822
154 Ga0157378_10313067 3300013297 Bacteria 1523
155 Ga0163162_10037320 3300013306 Bacteria 4849
156 Ga0163162_10058923 3300013306 Bacteria 3870
157 Ga0163162_10202213 3300013306 Bacteria 2115
158 Ga0157372_10002320 3300013307 Bacteria 20607
159 Ga0157372_10005593 3300013307 Bacteria 13364
160 Ga0157372_10206708 3300013307 Bacteria 2275
161 Ga0157372_10327482 3300013307 Bacteria 1784
162 Ga0157372_10365686 3300013307 Bacteria 1681
163 Ga0157372_10852312 3300013307 Bacteria 1058
164 Ga0157375_10035908 3300013308 Bacteria 4735
165 Ga0157375_10386578 3300013308 Bacteria 1566
166 Ga0163163_10002055 3300014325 Bacteria 16988
167 Ga0163163_10080595 3300014325 Bacteria 3255
168 Ga0163163_10339810 3300014325 Bacteria 1556
169 Ga0157380_10193653 3300014326 Bacteria 1797
170 Ga0157380_10224781 3300014326 Bacteria 1682
171 Ga0157379_10005750 3300014968 Bacteria 10671
172 Ga0157379_10369620 3300014968 Bacteria 1315
173 Ga0157376_10014691 3300014969 Bacteria 5887
174 Ga0163161_10013801 3300017792 Bacteria 5627
175 Ga0206356_11052037 3300020070 Bacteria 1110
176 Ga0206353_10470198 3300020082 Bacteria 1007
177 Ga0213876_10000148 3300021384 Bacteria 75586
178 Ga0224712_10073649 3300022467 Bacteria 1394
179 Ga0207427_108016 3300025231 Bacteria 1202
180 Ga0209233_1000013 3300025261 Bacteria 1013785
181 Ga0209675_1002273 3300025291 Bacteria 10015
182 Ga0207692_10051680 3300025898 Bacteria 2085
183 Ga0207642_10112753 3300025899 Bacteria 1388
184 Ga0207710_10110168 3300025900 Bacteria 1307
185 Ga0207699_10000227 3300025906 Bacteria 32219
186 Ga0207705_10000002 3300025909 Bacteria 2046852
187 Ga0207705_10046612 3300025909 Bacteria 3115
188 Ga0207705_10078884 3300025909 Bacteria 2397
189 Ga0207705_10111281 3300025909 Bacteria 2023
190 Ga0207654_10005899 3300025911 Bacteria 6168
191 Ga0207707_10000079 3300025912 Bacteria 98440
192 Ga0207707_10010654 3300025912 Bacteria 7987
193 Ga0207707_10162546 3300025912 Bacteria 1952
194 Ga0207707_10339269 3300025912 Bacteria 1296
195 Ga0207695_10014294 3300025913 Bacteria 9414
196 Ga0207695_10025423 3300025913 Bacteria 6628
197 Ga0207695_10067132 3300025913 Bacteria 3680
198 Ga0207695_10106835 3300025913 Bacteria 2785
199 Ga0207695_10116014 3300025913 Bacteria 2652
200 Ga0207695_10226871 3300025913 Bacteria 1774
201 Ga0207695_10286978 3300025913 Bacteria 1538
202 Ga0207695_10541449 3300025913 Bacteria 1046
203 Ga0207693_10000324 3300025915 Bacteria 44179
204 Ga0207660_10001281 3300025917 Bacteria 16873
205 Ga0207660_10356126 3300025917 Bacteria 1173
206 Ga0207657_10000082 3300025919 Bacteria 89667
207 Ga0207657_10009154 3300025919 Bacteria 9991
208 Ga0207657_10019479 3300025919 Bacteria 6442
209 Ga0207652_10000931 3300025921 Bacteria 27506
210 Ga0207652_10006563 3300025921 Bacteria 9376
211 Ga0207652_10097001 3300025921 Bacteria 2598
212 Ga0207681_10113538 3300025923 Bacteria 1975
213 Ga0207694_10012988 3300025924 Bacteria 6271
214 Ga0207694_10038079 3300025924 Bacteria 3697
215 Ga0207687_10030022 3300025927 Bacteria 3661
216 Ga0207687_10067258 3300025927 Bacteria 2548
217 Ga0207687_10153399 3300025927 Bacteria 1760
218 Ga0207687_10433747 3300025927 Bacteria 1087
219 Ga0207700_10000058 3300025928 Bacteria 70410
220 Ga0207664_10095185 3300025929 Bacteria 2449
221 Ga0207664_10229760 3300025929 Bacteria 1612
222 Ga0207690_10008907 3300025932 Bacteria 5957
223 Ga0207709_10189540 3300025935 Bacteria 1460
224 Ga0207670_10369711 3300025936 Bacteria 1139
225 Ga0207704_10149315 3300025938 Bacteria 1647
226 Ga0207711_10000003 3300025941 Bacteria 1042791
227 Ga0207711_10110315 3300025941 Bacteria 2446
228 Ga0207711_10196199 3300025941 Bacteria 1841
229 Ga0207711_10331946 3300025941 Bacteria 1406
230 Ga0207689_10059018 3300025942 Bacteria 3156
231 Ga0207661_10162896 3300025944 Bacteria 1936
232 Ga0207661_10355610 3300025944 Bacteria 1322
233 Ga0207667_10007941 3300025949 Bacteria 12666
234 Ga0207667_10054984 3300025949 Bacteria 4186
235 Ga0207667_10165545 3300025949 Bacteria 2273
236 Ga0207667_10285102 3300025949 Bacteria 1688
237 Ga0207712_10187465 3300025961 Bacteria 1630
238 Ga0207712_10253776 3300025961 Bacteria 1423
239 Ga0207668_10088261 3300025972 Bacteria 2271
240 Ga0207658_10190689 3300025986 Bacteria 1703
241 Ga0207658_10435993 3300025986 Bacteria 1158
242 Ga0207677_10021131 3300026023 Bacteria 3971
243 Ga0207677_10264046 3300026023 Bacteria 1405
244 Ga0207703_10031629 3300026035 Bacteria 4186
245 Ga0207639_10085468 3300026041 Bacteria 2509
246 Ga0207639_10109722 3300026041 Bacteria 2246
247 Ga0207708_10233717 3300026075 Bacteria 1477
248 Ga0207702_10002311 3300026078 Bacteria 18241
249 Ga0207702_10486424 3300026078 Bacteria 1202
250 Ga0207641_10144191 3300026088 Bacteria 2152
251 Ga0207648_10015012 3300026089 Bacteria 7134
252 Ga0207648_10037335 3300026089 Bacteria 4279
253 Ga0207674_10051280 3300026116 Bacteria 4211
254 Ga0207674_10114849 3300026116 Bacteria 2664
255 Ga0207675_100206678 3300026118 Bacteria 1887
256 Ga0207675_100454884 3300026118 Bacteria 1269
257 Ga0207675_100524300 3300026118 Bacteria 1181
258 Ga0207683_10014768 3300026121 Bacteria 6648
259 Ga0207698_10031680 3300026142 Bacteria 3820
260 Ga0207698_10127875 3300026142 Bacteria 2165
261 Ga0209813_10000849 3300027866 Bacteria 6904
262 Ga0209813_10026833 3300027866 Bacteria 1668
263 Ga0209813_10046760 3300027866 Bacteria 1338
264 Ga0207428_10008580 3300027907 Bacteria 9222
265 Ga0207428_10040559 3300027907 Bacteria 3775
266 Ga0268266_10000871 3300028379 Bacteria 39260
267 Ga0268266_10015781 3300028379 Bacteria 6467
268 Ga0268266_10020164 3300028379 Bacteria 5683
269 Ga0268266_10041753 3300028379 Bacteria 3915
270 Ga0268265_10043329 3300028380 Bacteria 3345
271 Ga0268265_10142204 3300028380 Bacteria 2010
272 Ga0268264_10074136 3300028381 Bacteria 2890
273 Ga0268264_10165562 3300028381 Bacteria 1995
274 Ga0265318_10000348 3300028577 Bacteria 36746
275 Ga0265318_10002134 3300028577 Bacteria 10758
276 Ga0265338_10000017 3300028800 Bacteria 344481
277 Ga0265338_10003940 3300028800 Bacteria 20451
278 Ga0265338_10054623 3300028800 Bacteria 3559
279 Ga0265338_10429915 3300028800 Bacteria 937
280 Ga0265330_10051406 3300031235 Bacteria 1807
281 Ga0265332_10013596 3300031238 Bacteria 3605
282 Ga0265320_10014946 3300031240 Bacteria 4401
283 Ga0265325_10000016 3300031241 Bacteria 130316
284 Ga0265325_10001479 3300031241 Bacteria 16557
285 Ga0265340_10018554 3300031247 Bacteria 3588
286 Ga0265339_10019941 3300031249 Bacteria 3925
287 Ga0265339_10054517 3300031249 Bacteria 2171
288 Ga0265331_10003090 3300031250 Bacteria 10919
289 Ga0265331_10029318 3300031250 Bacteria 2747
290 Ga0265331_10030595 3300031250 Bacteria 2680
291 Ga0265316_10015577 3300031344 Bacteria 6640
292 Ga0265316_10068505 3300031344 Bacteria 2741
293 Ga0265316_10201820 3300031344 Bacteria 1474
294 Ga0265313_10004469 3300031595 Bacteria 10713
295 Ga0265313_10007428 3300031595 Bacteria 7496
296 Ga0265313_10008914 3300031595 Bacteria 6594
297 Ga0265314_10000635 3300031711 Bacteria 43051
298 Ga0265314_10006199 3300031711 Bacteria 10620
299 Ga0265314_10009184 3300031711 Bacteria 8385
300 Ga0265314_10018336 3300031711 Bacteria 5458
301 Ga0265314_10049029 3300031711 Bacteria 2959
302 Ga0265342_10014649 3300031712 Bacteria 5198
303 Ga0265342_10026721 3300031712 Bacteria 3614
304 Ga0265342_10032819 3300031712 Bacteria 3199
305 Ga0316578_10104021 3300031728 Bacteria 1703
306 Ga0316578_10106425 3300031728 Bacteria 1683
307 Ga0307516_10045075 3300031730 Bacteria 4358
308 Ga0373956_0063894 3300035119 Bacteria 1671
309 Ga0373947_0050955 3300035725 Bacteria 2490
310 Ga0316584_0111105 3300036712 Bacteria 2051
311 Ga0395898_0007832 3300037466 Bacteria 11341
312 Ga0436365_0897189 3300039437 Bacteria 4754
313 Ga0436365_1201434 3300039437 Bacteria 113887
314 Ga0436360_1147519 3300039438 Bacteria 1441
315 Ga0436360_1292018 3300039438 Bacteria 1922
316 Ga0436361_0770122 3300039447 Bacteria 1509
317 Ga0466957_0165772 3300044842 Bacteria 1437
318 Ga0466967_0345885 3300045976 Bacteria 1439
319 Ga0495603_0039840 3300046455 Bacteria 2814
320 Ga0495580_0219541 3300046472 Bacteria 1307
321 Ga0495648_0119691 3300046524 Bacteria 1418
322 Ga0495587_0013611 3300046536 Bacteria 5112
323 Ga0495622_0001758 3300046557 Bacteria 10705
324 Ga0495667_0119818 3300046559 Bacteria 1700
325 Ga0495611_0031308 3300046648 Bacteria 2341
326 Ga0495674_0178017 3300047319 Bacteria 1772
327 Ga0495681_0032695 3300047470 Bacteria 2616
328 Ga0496100_0106358 3300048903 Bacteria 1942
329 Ga0496101_0025013 3300048904 Bacteria 4139
330 Ga0496102_0113603 3300048905 Bacteria 2527
331 Ga0496104_0000182 3300048907 Bacteria 56117
332 Ga0496104_0014071 3300048907 Bacteria 7222
333 Ga0496105_0016358 3300048908 Bacteria 5921
334 Ga0496105_0041906 3300048908 Bacteria 3773
335 Ga0496106_0080844 3300048909 Bacteria 2496
336 Ga0496106_0086259 3300048909 Bacteria 2418
337 Ga0496106_0164221 3300048909 Bacteria 1757
338 Ga0496108_0001152 3300048911 Bacteria 20646
339 Ga0496108_0114166 3300048911 Bacteria 2312
340 Ga0496109_0002055 3300048912 Bacteria 16695
341 Ga0496110_0008147 3300048913 Bacteria 8419
342 Ga0496110_0168370 3300048913 Bacteria 1987
343 Ga0496111_0051603 3300048914 Bacteria 2969
344 Ga0496111_0114699 3300048914 Bacteria 1986
345 Ga0496112_0015595 3300048915 Bacteria 7097
346 Ga0496112_0161537 3300048915 Bacteria 2207
347 Ga0496112_0300985 3300048915 Bacteria 1549
348 Ga0496114_0046600 3300048917 Bacteria 3603
349 Ga0496115_0037499 3300048918 Bacteria 3841
350 Ga0496115_0058453 3300048918 Bacteria 3103
351 Ga0496121_0001676 3300048924 Bacteria 36412
352 Ga0496126_0000525 3300048929 Bacteria 74677
353 Ga0496126_0304422 3300048929 Bacteria 1314
354 Ga0495682_0001726 3300049460 Bacteria 11086
355 Ga0495682_0062492 3300049460 Bacteria 1344
356 Ga0501032_0073296 3300049569 Bacteria 2281
357 Ga0501032_0079108 3300049569 Bacteria 2189
358 Ga0501032_0109298 3300049569 Bacteria 1830
359 Ga0501033_0041703 3300049570 Bacteria 3423
360 Ga0501033_0060020 3300049570 Bacteria 2807
361 Ga0501033_0112225 3300049570 Bacteria 1983
362 Ga0501033_0192460 3300049570 Bacteria 1459
363 Ga0501034_0008131 3300049571 Bacteria 11123
364 Ga0501034_0052322 3300049571 Bacteria 4114
365 Ga0501034_0067309 3300049571 Bacteria 3595
366 Ga0501034_0119139 3300049571 Bacteria 2626
367 Ga0501034_0288055 3300049571 Bacteria 1581
368 Ga0501036_0005095 3300049572 Bacteria 10632
369 Ga0501036_0041808 3300049572 Bacteria 3879
370 Ga0501036_0062114 3300049572 Bacteria 3164
371 Ga0501037_0005918 3300049573 Bacteria 8930
372 Ga0501037_0036213 3300049573 Bacteria 3637
373 Ga0501037_0046307 3300049573 Bacteria 3190
374 Ga0501037_0143535 3300049573 Bacteria 1708
375 Ga0501038_0083378 3300049574 Bacteria 2691
376 Ga0501038_0355806 3300049574 Bacteria 1139
377 Ga0501038_0369603 3300049574 Bacteria 1114
378 Ga0501038_0409106 3300049574 Bacteria 1048
379 Ga0501039_0017479 3300049575 Bacteria 5501
380 Ga0501039_0313724 3300049575 Bacteria 1233
381 Ga0501043_0064752 3300049579 Bacteria 2871
382 Ga0501043_0092452 3300049579 Bacteria 2378
383 Ga0501043_0107749 3300049579 Bacteria 2188
384 Ga0501043_0117579 3300049579 Bacteria 2086
385 Ga0501046_0036137 3300049580 Bacteria 3977
386 Ga0501047_0003459 3300049581 Bacteria 14920
387 Ga0501047_0048550 3300049581 Bacteria 4099
388 Ga0501047_0059207 3300049581 Bacteria 3698
389 Ga0501047_0093667 3300049581 Bacteria 2883
390 Ga0501047_0108790 3300049581 Bacteria 2654
391 Ga0501047_0191759 3300049581 Bacteria 1907
392 Ga0501047_0281474 3300049581 Bacteria 1508
393 Ga0501047_0372396 3300049581 Bacteria 1263
394 Ga0501047_0492337 3300049581 Bacteria 1053
395 Ga0501048_0001040 3300049582 Bacteria 20782
396 Ga0501048_0006804 3300049582 Bacteria 8684
397 Ga0501048_0066582 3300049582 Bacteria 2547
398 Ga0501067_0002358 3300049583 Bacteria 10461
399 Ga0501067_0032250 3300049583 Bacteria 2908
400 Ga0501067_0076183 3300049583 Bacteria 1859
401 Ga0501068_0026074 3300049584 Bacteria 3441
402 Ga0501070_0000242 3300049586 Bacteria 51302
403 Ga0501070_0027115 3300049586 Bacteria 4806
404 Ga0501071_0117478 3300049587 Bacteria 1970
405 Ga0501072_0063690 3300049588 Bacteria 2909
406 Ga0501073_0025346 3300049589 Bacteria 4254
407 Ga0501073_0043803 3300049589 Bacteria 3155
408 Ga0501074_0002413 3300049590 Bacteria 13023
409 Ga0501074_0177285 3300049590 Bacteria 1521
410 Ga0501079_0001660 3300049741 Bacteria 15834
411 Ga0501080_0005087 3300049742 Bacteria 11720
412 Ga0501080_0010288 3300049742 Bacteria 8553
413 Ga0501080_0147177 3300049742 Bacteria 2177
414 Ga0501080_0397460 3300049742 Bacteria 1240
415 Ga0501083_0016832 3300049744 Bacteria 5107
416 Ga0501083_0016948 3300049744 Bacteria 5088
417 Ga0501083_0228870 3300049744 Bacteria 1211
418 Ga0501035_0002988 3300049822 Bacteria 16241
419 Ga0501035_0014644 3300049822 Bacteria 7241
420 Ga0501035_0024455 3300049822 Bacteria 5539
421 Ga0501035_0052374 3300049822 Bacteria 3652
422 Ga0501035_0100381 3300049822 Bacteria 2541
423 Ga0501035_0183232 3300049822 Bacteria 1803
424 Ga0501035_0231837 3300049822 Bacteria 1573
425 Ga0501035_0331700 3300049822 Bacteria 1276
426 Ga0501044_0001386 3300049823 Bacteria 28428
427 Ga0501044_0010640 3300049823 Bacteria 9981
428 Ga0501044_0026582 3300049823 Bacteria 6126
429 Ga0501044_0037145 3300049823 Bacteria 5092
430 Ga0501044_0041293 3300049823 Bacteria 4801
431 Ga0501044_0067685 3300049823 Bacteria 3638
432 Ga0501044_0132641 3300049823 Bacteria 2484
433 Ga0501044_0159757 3300049823 Bacteria 2231
434 Ga0501044_0183117 3300049823 Bacteria 2061
435 Ga0501044_0273230 3300049823 Bacteria 1625
436 Ga0501044_0617211 3300049823 Bacteria 976
437 Ga0501045_0052890 3300049824 Bacteria 2966
438 nmdc:mga03n38_17119_c1 3300050490 Bacteria 2832
439 nmdc:mga03n38_9060_c1 3300050490 Bacteria 3601
440 nmdc:mga00v17_10264_c1 3300050491 Bacteria 5107
441 nmdc:mga06z11_113721_c1 3300050494 Bacteria 1502
442 nmdc:mga06z11_1197_c1 3300050494 Bacteria 9554
443 nmdc:mga06z11_4979_c1 3300050494 Bacteria 5280
444 nmdc:mga04h51_33098_c1 3300050495 Bacteria 1644
445 nmdc:mga04h51_4050_c1 3300050495 Bacteria 3613
446 nmdc:mga04h51_54945_c1 3300050495 Bacteria 1348
447 nmdc:mga05p37_116126_c1 3300050507 Bacteria 3289
448 nmdc:mga05p37_142928_c1 3300050507 Bacteria 2931
449 nmdc:mga05p37_440160_c1 3300050507 Bacteria 1512
450 nmdc:mga09592_166517_c1 3300050508 Bacteria 1905
451 nmdc:mga09592_225425_c1 3300050508 Bacteria 1624
452 nmdc:mga06r32_52085_c1 3300050510 Bacteria 3919
453 nmdc:mga06r32_9052_c1 3300050510 Bacteria 8972
454 nmdc:mga08y16_6160_c1 3300050511 Bacteria 12584
455 nmdc:mga08y16_65653_c1 3300050511 Bacteria 3788
456 nmdc:mga0n895_37493_c1 3300050512 Bacteria 4690
457 nmdc:mga0n895_44158_c1 3300050512 Bacteria 4346
458 nmdc:mga0n895_58068_c1 3300050512 Bacteria 3815
459 nmdc:mga0rr50_9776_c1 3300050513 Bacteria 6053
460 nmdc:mga08x19_177_c1 3300050514 Bacteria 51482
461 nmdc:mga0a205_145950_c1 3300050515 Bacteria 2266
462 Ga0495612_0100093 3300053078 Bacteria 1234
463 Ga0500643_000021 3300053087 Bacteria 284326
464 Ga0500646_0088961 3300053090 Bacteria 953
465 Ga0500556_0000669 3300053104 Bacteria 21370
466 Ga0500595_008735 3300053119 Bacteria 4123
467 Ga0500595_014106 3300053119 Bacteria 3041
468 Ga0500655_003247 3300053133 Bacteria 2943
469 Ga0500573_0000050 3300053140 Bacteria 95598
470 Ga0500616_0067198 3300053153 Bacteria 1839
471 Ga0501084_0004597 3300054114 Bacteria 11281
472 Ga0587101_006305 3300059623 Bacteria 1355
473 Ga0587111_0029957 3300060346 Bacteria 1105
474 Ga0501082_0032180 3300060353 Bacteria 4523
475 Ga0501082_0035117 3300060353 Bacteria 4321

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025961 Ga0207712_10253776 Ga0207712_102537763 273
2 3300049579 Ga0501043_0117579 Ga0501043_0117579_1254_2075 273
3 3300049823 Ga0501044_0617211 Ga0501044_0617211_13_837 273
4 3300009093 Ga0105240_10017462 Ga0105240_1001746210 278
5 3300009177 Ga0105248_10000013 Ga0105248_1000001331 278
6 3300013100 Ga0157373_10035798 Ga0157373_100357982 278
7 3300013307 Ga0157372_10206708 Ga0157372_102067082 278
8 3300049574 Ga0501038_0369603 Ga0501038_0369603_20_856 278
9 3300049581 Ga0501047_0372396 Ga0501047_0372396_320_1159 278
10 3300049590 Ga0501074_0177285 Ga0501074_0177285_157_993 278
11 3300010375 Ga0105239_10031804 Ga0105239_100318044 286
12 3300039438 Ga0436360_1292018 Ga0436360_1292018_916_1809 286
13 iso_pu_bacteria 2597490356 2599101182 286
14 iso_pu_bacteria 2846952575 2846954098 286
15 3300009093 Ga0105240_10007938 Ga0105240_100079385 288
16 3300009545 Ga0105237_10227055 Ga0105237_102270552 288
17 3300025913 Ga0207695_10014294 Ga0207695_1001429412 288
18 3300005345 Ga0070692_10000181 Ga0070692_100001814 289
19 3300005366 Ga0070659_100002415 Ga0070659_1000024157 289
20 3300005467 Ga0070706_100338781 Ga0070706_1003387811 289
21 3300005617 Ga0068859_100354640 Ga0068859_1003546402 289
22 3300005843 Ga0068860_100067312 Ga0068860_1000673122 289
23 3300005937 Ga0081455_10073775 Ga0081455_100737752 289
24 3300006931 Ga0097620_100354618 Ga0097620_1003546182 289
25 3300025909 Ga0207705_10000002 Ga0207705_100000021524 289
26 3300025919 Ga0207657_10000082 Ga0207657_1000008240 289
27 3300025932 Ga0207690_10008907 Ga0207690_100089075 289
28 3300028381 Ga0268264_10074136 Ga0268264_100741362 289
29 3300005339 Ga0070660_100023494 Ga0070660_1000234944 290
30 3300005347 Ga0070668_100034681 Ga0070668_1000346812 290
31 3300005367 Ga0070667_100324443 Ga0070667_1003244431 290
32 3300005444 Ga0070694_100018461 Ga0070694_1000184613 290
33 3300005458 Ga0070681_10050537 Ga0070681_100505376 290
34 3300005530 Ga0070679_100029852 Ga0070679_1000298522 290
35 3300005545 Ga0070695_100063043 Ga0070695_1000630432 290
36 3300005548 Ga0070665_100163366 Ga0070665_1001633662 290
37 3300005577 Ga0068857_100107399 Ga0068857_1001073993 290
38 3300005841 Ga0068863_100170875 Ga0068863_1001708752 290
39 3300005843 Ga0068860_100370082 Ga0068860_1003700822 290
40 3300005843 Ga0068860_100474073 Ga0068860_1004740732 290
41 3300006038 Ga0075365_10022074 Ga0075365_100220742 290
42 3300006038 Ga0075365_10080516 Ga0075365_100805162 290
43 3300006042 Ga0075368_10000420 Ga0075368_100004203 290
44 3300006042 Ga0075368_10062779 Ga0075368_100627791 290
45 3300006048 Ga0075363_100021962 Ga0075363_1000219622 290
46 3300006048 Ga0075363_100058165 Ga0075363_1000581653 290
47 3300006178 Ga0075367_10001232 Ga0075367_100012324 290
48 3300006178 Ga0075367_10007139 Ga0075367_100071395 290
49 3300006844 Ga0075428_100164340 Ga0075428_1001643402 290
50 3300006847 Ga0075431_100112704 Ga0075431_1001127042 290
51 3300006847 Ga0075431_100429696 Ga0075431_1004296962 290
52 3300006847 Ga0075431_100452513 Ga0075431_1004525131 290
53 3300006871 Ga0075434_100026298 Ga0075434_1000262983 290
54 3300006871 Ga0075434_100039552 Ga0075434_1000395524 290
55 3300006880 Ga0075429_100235142 Ga0075429_1002351421 290
56 3300009093 Ga0105240_10423210 Ga0105240_104232101 290
57 3300009094 Ga0111539_10001024 Ga0111539_100010243 290
58 3300009094 Ga0111539_10077007 Ga0111539_100770073 290
59 3300009094 Ga0111539_10482901 Ga0111539_104829012 290
60 3300009101 Ga0105247_10110351 Ga0105247_101103512 290
61 3300009147 Ga0114129_10090961 Ga0114129_100909613 290
62 3300009147 Ga0114129_10188829 Ga0114129_101888293 290
63 3300009147 Ga0114129_10716751 Ga0114129_107167512 290
64 3300009553 Ga0105249_10613904 Ga0105249_106139041 290
65 3300013105 Ga0157369_10009612 Ga0157369_100096125 290
66 3300013297 Ga0157378_10215752 Ga0157378_102157523 290
67 3300013306 Ga0163162_10202213 Ga0163162_102022133 290
68 3300013307 Ga0157372_10327482 Ga0157372_103274824 290
69 3300014325 Ga0163163_10080595 Ga0163163_100805953 290
70 3300014326 Ga0157380_10193653 Ga0157380_101936532 290
71 3300020070 Ga0206356_11052037 Ga0206356_110520371 290
72 3300020082 Ga0206353_10470198 Ga0206353_104701981 290
73 3300022467 Ga0224712_10073649 Ga0224712_100736492 290
74 3300025291 Ga0209675_1002273 Ga0209675_10022733 290
75 3300025900 Ga0207710_10110168 Ga0207710_101101681 290
76 3300025912 Ga0207707_10162546 Ga0207707_101625462 290
77 3300025912 Ga0207707_10339269 Ga0207707_103392692 290
78 3300025913 Ga0207695_10286978 Ga0207695_102869781 290
79 3300025923 Ga0207681_10113538 Ga0207681_101135382 290
80 3300025927 Ga0207687_10433747 Ga0207687_104337472 290
81 3300025936 Ga0207670_10369711 Ga0207670_103697111 290
82 3300025941 Ga0207711_10196199 Ga0207711_101961992 290
83 3300025949 Ga0207667_10285102 Ga0207667_102851021 290
84 3300025961 Ga0207712_10187465 Ga0207712_101874651 290
85 3300025972 Ga0207668_10088261 Ga0207668_100882612 290
86 3300025986 Ga0207658_10435993 Ga0207658_104359932 290
87 3300026075 Ga0207708_10233717 Ga0207708_102337172 290
88 3300026088 Ga0207641_10144191 Ga0207641_101441912 290
89 3300026116 Ga0207674_10051280 Ga0207674_100512806 290
90 3300026118 Ga0207675_100206678 Ga0207675_1002066782 290
91 3300026118 Ga0207675_100454884 Ga0207675_1004548841 290
92 3300026118 Ga0207675_100524300 Ga0207675_1005243001 290
93 3300027866 Ga0209813_10000849 Ga0209813_100008497 290
94 3300027866 Ga0209813_10026833 Ga0209813_100268332 290
95 3300027866 Ga0209813_10046760 Ga0209813_100467602 290
96 3300027907 Ga0207428_10008580 Ga0207428_100085801 290
97 3300027907 Ga0207428_10040559 Ga0207428_100405593 290
98 3300031728 Ga0316578_10104021 Ga0316578_101040211 290
99 3300031728 Ga0316578_10106425 Ga0316578_101064251 290
100 3300035119 Ga0373956_0063894 Ga0373956_0063894_773_1648 290
101 3300035725 Ga0373947_0050955 Ga0373947_0050955_1028_1921 290
102 3300036712 Ga0316584_0111105 Ga0316584_0111105_717_1592 290
103 3300046472 Ga0495580_0219541 Ga0495580_0219541_289_1182 290
104 3300046559 Ga0495667_0119818 Ga0495667_0119818_470_1360 290
105 3300048903 Ga0496100_0106358 Ga0496100_0106358_829_1722 290
106 3300048904 Ga0496101_0025013 Ga0496101_0025013_78_971 290
107 3300048905 Ga0496102_0113603 Ga0496102_0113603_1150_2043 290
108 3300048907 Ga0496104_0000182 Ga0496104_0000182_22088_22981 290
109 3300048907 Ga0496104_0014071 Ga0496104_0014071_5166_6059 290
110 3300048908 Ga0496105_0016358 Ga0496105_0016358_656_1549 290
111 3300048908 Ga0496105_0041906 Ga0496105_0041906_1084_1977 290
112 3300048909 Ga0496106_0080844 Ga0496106_0080844_851_1744 290
113 3300048909 Ga0496106_0086259 Ga0496106_0086259_500_1393 290
114 3300048911 Ga0496108_0001152 Ga0496108_0001152_17744_18637 290
115 3300048911 Ga0496108_0114166 Ga0496108_0114166_743_1636 290
116 3300048912 Ga0496109_0002055 Ga0496109_0002055_4887_5780 290
117 3300048913 Ga0496110_0008147 Ga0496110_0008147_2419_3312 290
118 3300048913 Ga0496110_0168370 Ga0496110_0168370_476_1369 290
119 3300048914 Ga0496111_0051603 Ga0496111_0051603_1354_2247 290
120 3300048914 Ga0496111_0114699 Ga0496111_0114699_598_1491 290
121 3300048915 Ga0496112_0015595 Ga0496112_0015595_5575_6468 290
122 3300048915 Ga0496112_0161537 Ga0496112_0161537_51_944 290
123 3300048915 Ga0496112_0300985 Ga0496112_0300985_310_1203 290
124 3300048917 Ga0496114_0046600 Ga0496114_0046600_1407_2300 290
125 3300048918 Ga0496115_0037499 Ga0496115_0037499_1997_2890 290
126 3300048918 Ga0496115_0058453 Ga0496115_0058453_876_1751 290
127 3300049571 Ga0501034_0052322 Ga0501034_0052322_699_1592 290
128 3300049571 Ga0501034_0067309 Ga0501034_0067309_1810_2685 290
129 3300049574 Ga0501038_0409106 Ga0501038_0409106_121_996 290
130 3300049582 Ga0501048_0001040 Ga0501048_0001040_14563_15453 290
131 3300049583 Ga0501067_0076183 Ga0501067_0076183_399_1292 290
132 3300049744 Ga0501083_0228870 Ga0501083_0228870_245_1138 290
133 3300049823 Ga0501044_0026582 Ga0501044_0026582_1666_2580 290
134 3300049823 Ga0501044_0132641 Ga0501044_0132641_452_1327 290
135 3300049823 Ga0501044_0183117 Ga0501044_0183117_721_1596 290
136 3300050490 nmdc:mga03n38_17119_c1 nmdc:mga03n38_17119_c1_1513_2406 290
137 3300050490 nmdc:mga03n38_9060_c1 nmdc:mga03n38_9060_c1_2530_3423 290
138 3300050491 nmdc:mga00v17_10264_c1 nmdc:mga00v17_10264_c1_1069_1962 290
139 3300050494 nmdc:mga06z11_113721_c1 nmdc:mga06z11_113721_c1_451_1344 290
140 3300050494 nmdc:mga06z11_1197_c1 nmdc:mga06z11_1197_c1_8340_9233 290
141 3300050494 nmdc:mga06z11_4979_c1 nmdc:mga06z11_4979_c1_2445_3338 290
142 3300050495 nmdc:mga04h51_33098_c1 nmdc:mga04h51_33098_c1_271_1164 290
143 3300050495 nmdc:mga04h51_4050_c1 nmdc:mga04h51_4050_c1_2055_2948 290
144 3300050495 nmdc:mga04h51_54945_c1 nmdc:mga04h51_54945_c1_326_1219 290
145 3300050507 nmdc:mga05p37_116126_c1 nmdc:mga05p37_116126_c1_268_1161 290
146 3300050507 nmdc:mga05p37_142928_c1 nmdc:mga05p37_142928_c1_842_1735 290
147 3300050507 nmdc:mga05p37_440160_c1 nmdc:mga05p37_440160_c1_164_1057 290
148 3300050508 nmdc:mga09592_166517_c1 nmdc:mga09592_166517_c1_70_963 290
149 3300050508 nmdc:mga09592_225425_c1 nmdc:mga09592_225425_c1_591_1484 290
150 3300050510 nmdc:mga06r32_52085_c1 nmdc:mga06r32_52085_c1_2922_3815 290
151 3300050510 nmdc:mga06r32_9052_c1 nmdc:mga06r32_9052_c1_4091_4984 290
152 3300050511 nmdc:mga08y16_6160_c1 nmdc:mga08y16_6160_c1_4254_5147 290
153 3300050511 nmdc:mga08y16_65653_c1 nmdc:mga08y16_65653_c1_1147_2040 290
154 3300050512 nmdc:mga0n895_37493_c1 nmdc:mga0n895_37493_c1_735_1628 290
155 3300050512 nmdc:mga0n895_44158_c1 nmdc:mga0n895_44158_c1_2359_3252 290
156 3300050513 nmdc:mga0rr50_9776_c1 nmdc:mga0rr50_9776_c1_2235_3128 290
157 3300050515 nmdc:mga0a205_145950_c1 nmdc:mga0a205_145950_c1_1058_1951 290
158 3300053078 Ga0495612_0100093 Ga0495612_0100093_128_1018 290
159 3300053104 Ga0500556_0000669 Ga0500556_0000669_16072_16962 290
160 3300053153 Ga0500616_0067198 Ga0500616_0067198_421_1314 290
161 3300059623 Ga0587101_006305 Ga0587101_006305_156_1031 290
162 3300060346 Ga0587111_0029957 Ga0587111_0029957_99_974 290
163 3300031595 Ga0265313_10004469 Ga0265313_100044694 291
164 3300005937 Ga0081455_10006404 Ga0081455_100064042 292
165 3300028380 Ga0268265_10043329 Ga0268265_100433292 292
166 3300025929 Ga0207664_10229760 Ga0207664_102297602 293
167 3300026142 Ga0207698_10031680 Ga0207698_100316802 293
168 3300039447 Ga0436361_0770122 Ga0436361_0770122_28_915 293
169 3300049583 Ga0501067_0032250 Ga0501067_0032250_334_1242 293
170 3300005331 Ga0070670_100160842 Ga0070670_1001608422 295
171 3300005331 Ga0070670_100440120 Ga0070670_1004401201 295
172 3300005547 Ga0070693_100140416 Ga0070693_1001404162 295
173 3300009098 Ga0105245_10041140 Ga0105245_100411402 295
174 3300013307 Ga0157372_10002320 Ga0157372_1000232014 295
175 3300013307 Ga0157372_10005593 Ga0157372_100055933 295
176 3300021384 Ga0213876_10000148 Ga0213876_1000014836 295
177 3300025927 Ga0207687_10030022 Ga0207687_100300226 295
178 3300028577 Ga0265318_10002134 Ga0265318_100021344 295
179 3300031250 Ga0265331_10030595 Ga0265331_100305953 295
180 3300031711 Ga0265314_10006199 Ga0265314_1000619910 295
181 3300039437 Ga0436365_0897189 Ga0436365_0897189_255_1145 295
182 3300039437 Ga0436365_1201434 Ga0436365_1201434_54463_55365 295
183 3300045976 Ga0466967_0345885 Ga0466967_0345885_435_1325 295
184 3300047319 Ga0495674_0178017 Ga0495674_0178017_668_1561 295
185 3300049569 Ga0501032_0079108 Ga0501032_0079108_1187_2092 295
186 3300049570 Ga0501033_0192460 Ga0501033_0192460_368_1258 295
187 3300049571 Ga0501034_0119139 Ga0501034_0119139_401_1306 295
188 3300049571 Ga0501034_0288055 Ga0501034_0288055_242_1207 295
189 3300049581 Ga0501047_0003459 Ga0501047_0003459_2660_3550 295
190 3300049586 Ga0501070_0027115 Ga0501070_0027115_1181_2086 295
191 3300049742 Ga0501080_0010288 Ga0501080_0010288_2963_3853 295
192 3300049822 Ga0501035_0024455 Ga0501035_0024455_3414_4304 295
193 3300049822 Ga0501035_0231837 Ga0501035_0231837_260_1186 295
194 3300049823 Ga0501044_0037145 Ga0501044_0037145_1206_2096 295
195 3300003320 rootH2_10000793 rootH2_100007938 296
196 3300005327 Ga0070658_10066655 Ga0070658_100666552 296
197 3300005327 Ga0070658_10100360 Ga0070658_101003603 296
198 3300005327 Ga0070658_10123427 Ga0070658_101234272 296
199 3300005327 Ga0070658_10123767 Ga0070658_101237672 296
200 3300005327 Ga0070658_10135106 Ga0070658_101351062 296
201 3300005327 Ga0070658_10156822 Ga0070658_101568222 296
202 3300005327 Ga0070658_10291509 Ga0070658_102915092 296
203 3300005329 Ga0070683_100418761 Ga0070683_1004187612 296
204 3300005335 Ga0070666_10005773 Ga0070666_100057734 296
205 3300005336 Ga0070680_100006103 Ga0070680_10000610310 296
206 3300005336 Ga0070680_100297453 Ga0070680_1002974532 296
207 3300005338 Ga0068868_100318500 Ga0068868_1003185002 296
208 3300005338 Ga0068868_100451170 Ga0068868_1004511701 296
209 3300005339 Ga0070660_100008390 Ga0070660_1000083906 296
210 3300005339 Ga0070660_100025731 Ga0070660_1000257312 296
211 3300005339 Ga0070660_100146908 Ga0070660_1001469082 296
212 3300005341 Ga0070691_10003719 Ga0070691_100037192 296
213 3300005344 Ga0070661_100096241 Ga0070661_1000962412 296
214 3300005355 Ga0070671_100181941 Ga0070671_1001819412 296
215 3300005367 Ga0070667_100057074 Ga0070667_1000570742 296
216 3300005434 Ga0070709_10000433 Ga0070709_100004333 296
217 3300005435 Ga0070714_100114529 Ga0070714_1001145292 296
218 3300005436 Ga0070713_100000012 Ga0070713_10000001287 296
219 3300005437 Ga0070710_10141236 Ga0070710_101412361 296
220 3300005439 Ga0070711_100175428 Ga0070711_1001754282 296
221 3300005455 Ga0070663_100223248 Ga0070663_1002232482 296
222 3300005456 Ga0070678_100007105 Ga0070678_1000071055 296
223 3300005456 Ga0070678_100023402 Ga0070678_1000234023 296
224 3300005458 Ga0070681_10000074 Ga0070681_1000007434 296
225 3300005458 Ga0070681_10147771 Ga0070681_101477713 296
226 3300005530 Ga0070679_100000961 Ga0070679_10000096112 296
227 3300005530 Ga0070679_100049640 Ga0070679_1000496402 296
228 3300005535 Ga0070684_100184224 Ga0070684_1001842242 296
229 3300005535 Ga0070684_100390870 Ga0070684_1003908701 296
230 3300005539 Ga0068853_100000746 Ga0068853_1000007462 296
231 3300005539 Ga0068853_100136291 Ga0068853_1001362912 296
232 3300005539 Ga0068853_100268974 Ga0068853_1002689742 296
233 3300005539 Ga0068853_100440300 Ga0068853_1004403001 296
234 3300005548 Ga0070665_100002469 Ga0070665_1000024695 296
235 3300005548 Ga0070665_100029434 Ga0070665_1000294344 296
236 3300005548 Ga0070665_100041895 Ga0070665_1000418954 296
237 3300005563 Ga0068855_100026640 Ga0068855_1000266407 296
238 3300005563 Ga0068855_100046246 Ga0068855_1000462462 296
239 3300005578 Ga0068854_100044954 Ga0068854_1000449543 296
240 3300005614 Ga0068856_100001151 Ga0068856_10000115129 296
241 3300005614 Ga0068856_100068435 Ga0068856_1000684353 296
242 3300005616 Ga0068852_100209507 Ga0068852_1002095072 296
243 3300005618 Ga0068864_100146445 Ga0068864_1001464452 296
244 3300005719 Ga0068861_100127439 Ga0068861_1001274392 296
245 3300005842 Ga0068858_100027825 Ga0068858_1000278252 296
246 3300005843 Ga0068860_100159045 Ga0068860_1001590452 296
247 3300005844 Ga0068862_100116858 Ga0068862_1001168583 296
248 3300006175 Ga0070712_100000098 Ga0070712_10000009828 296
249 3300006237 Ga0097621_100001637 Ga0097621_10000163717 296
250 3300006237 Ga0097621_100035828 Ga0097621_1000358286 296
251 3300006237 Ga0097621_100057984 Ga0097621_1000579843 296
252 3300006237 Ga0097621_100094427 Ga0097621_1000944271 296
253 3300006237 Ga0097621_100339153 Ga0097621_1003391532 296
254 3300006358 Ga0068871_100006532 Ga0068871_1000065325 296
255 3300006358 Ga0068871_100034479 Ga0068871_1000344792 296
256 3300006358 Ga0068871_100092688 Ga0068871_1000926881 296
257 3300006358 Ga0068871_100098128 Ga0068871_1000981284 296
258 3300006871 Ga0075434_100052941 Ga0075434_1000529412 296
259 3300006881 Ga0068865_100009417 Ga0068865_1000094172 296
260 3300006914 Ga0075436_100000416 Ga0075436_1000004164 296
261 3300009093 Ga0105240_10065129 Ga0105240_100651292 296
262 3300009093 Ga0105240_10157991 Ga0105240_101579912 296
263 3300009093 Ga0105240_10159139 Ga0105240_101591391 296
264 3300009093 Ga0105240_10223389 Ga0105240_102233891 296
265 3300009093 Ga0105240_10457865 Ga0105240_104578651 296
266 3300009098 Ga0105245_10047517 Ga0105245_100475172 296
267 3300009098 Ga0105245_10169570 Ga0105245_101695702 296
268 3300009098 Ga0105245_10690265 Ga0105245_106902651 296
269 3300009148 Ga0105243_10006489 Ga0105243_100064892 296
270 3300009148 Ga0105243_10226090 Ga0105243_102260902 296
271 3300009174 Ga0105241_10009944 Ga0105241_100099444 296
272 3300009174 Ga0105241_10025069 Ga0105241_100250692 296
273 3300009174 Ga0105241_10386121 Ga0105241_103861211 296
274 3300009177 Ga0105248_10700956 Ga0105248_107009561 296
275 3300009545 Ga0105237_10077546 Ga0105237_100775463 296
276 3300009545 Ga0105237_10304701 Ga0105237_103047012 296
277 3300009545 Ga0105237_10313190 Ga0105237_103131902 296
278 3300009551 Ga0105238_10011343 Ga0105238_100113434 296
279 3300009551 Ga0105238_10071592 Ga0105238_100715922 296
280 3300009551 Ga0105238_10149922 Ga0105238_101499222 296
281 3300010375 Ga0105239_10006956 Ga0105239_100069562 296
282 3300010375 Ga0105239_10095539 Ga0105239_100955392 296
283 3300011119 Ga0105246_10004442 Ga0105246_100044426 296
284 3300011119 Ga0105246_10200964 Ga0105246_102009642 296
285 3300013104 Ga0157370_10081034 Ga0157370_100810342 296
286 3300013105 Ga0157369_10027642 Ga0157369_100276424 296
287 3300013105 Ga0157369_10160987 Ga0157369_101609872 296
288 3300013296 Ga0157374_10110854 Ga0157374_101108542 296
289 3300013297 Ga0157378_10004593 Ga0157378_1000459310 296
290 3300013297 Ga0157378_10060405 Ga0157378_100604055 296
291 3300013297 Ga0157378_10205272 Ga0157378_102052722 296
292 3300013297 Ga0157378_10313067 Ga0157378_103130672 296
293 3300013306 Ga0163162_10037320 Ga0163162_100373206 296
294 3300013306 Ga0163162_10058923 Ga0163162_100589232 296
295 3300013307 Ga0157372_10365686 Ga0157372_103656862 296
296 3300013307 Ga0157372_10852312 Ga0157372_108523121 296
297 3300013308 Ga0157375_10035908 Ga0157375_100359084 296
298 3300013308 Ga0157375_10386578 Ga0157375_103865782 296
299 3300014325 Ga0163163_10002055 Ga0163163_100020555 296
300 3300014325 Ga0163163_10339810 Ga0163163_103398103 296
301 3300014326 Ga0157380_10224781 Ga0157380_102247812 296
302 3300014968 Ga0157379_10005750 Ga0157379_100057506 296
303 3300014968 Ga0157379_10369620 Ga0157379_103696201 296
304 3300014969 Ga0157376_10014691 Ga0157376_100146915 296
305 3300017792 Ga0163161_10013801 Ga0163161_100138015 296
306 3300025231 Ga0207427_108016 Ga0207427_1080161 296
307 3300025261 Ga0209233_1000013 Ga0209233_1000013686 296
308 3300025898 Ga0207692_10051680 Ga0207692_100516802 296
309 3300025899 Ga0207642_10112753 Ga0207642_101127532 296
310 3300025906 Ga0207699_10000227 Ga0207699_1000022712 296
311 3300025909 Ga0207705_10046612 Ga0207705_100466123 296
312 3300025909 Ga0207705_10078884 Ga0207705_100788842 296
313 3300025909 Ga0207705_10111281 Ga0207705_101112812 296
314 3300025911 Ga0207654_10005899 Ga0207654_100058997 296
315 3300025912 Ga0207707_10000079 Ga0207707_1000007957 296
316 3300025912 Ga0207707_10010654 Ga0207707_100106544 296
317 3300025913 Ga0207695_10025423 Ga0207695_100254237 296
318 3300025913 Ga0207695_10067132 Ga0207695_100671322 296
319 3300025913 Ga0207695_10106835 Ga0207695_101068355 296
320 3300025913 Ga0207695_10116014 Ga0207695_101160144 296
321 3300025913 Ga0207695_10226871 Ga0207695_102268712 296
322 3300025913 Ga0207695_10541449 Ga0207695_105414491 296
323 3300025915 Ga0207693_10000324 Ga0207693_1000032419 296
324 3300025917 Ga0207660_10001281 Ga0207660_1000128111 296
325 3300025917 Ga0207660_10356126 Ga0207660_103561262 296
326 3300025919 Ga0207657_10009154 Ga0207657_1000915410 296
327 3300025919 Ga0207657_10019479 Ga0207657_100194792 296
328 3300025921 Ga0207652_10000931 Ga0207652_1000093114 296
329 3300025921 Ga0207652_10006563 Ga0207652_100065634 296
330 3300025921 Ga0207652_10097001 Ga0207652_100970012 296
331 3300025924 Ga0207694_10012988 Ga0207694_100129886 296
332 3300025924 Ga0207694_10038079 Ga0207694_100380792 296
333 3300025927 Ga0207687_10067258 Ga0207687_100672582 296
334 3300025927 Ga0207687_10153399 Ga0207687_101533992 296
335 3300025928 Ga0207700_10000058 Ga0207700_100000582 296
336 3300025929 Ga0207664_10095185 Ga0207664_100951852 296
337 3300025935 Ga0207709_10189540 Ga0207709_101895402 296
338 3300025938 Ga0207704_10149315 Ga0207704_101493152 296
339 3300025941 Ga0207711_10000003 Ga0207711_1000000331 296
340 3300025941 Ga0207711_10110315 Ga0207711_101103151 296
341 3300025941 Ga0207711_10331946 Ga0207711_103319462 296
342 3300025942 Ga0207689_10059018 Ga0207689_100590181 296
343 3300025944 Ga0207661_10162896 Ga0207661_101628963 296
344 3300025944 Ga0207661_10355610 Ga0207661_103556102 296
345 3300025949 Ga0207667_10007941 Ga0207667_100079417 296
346 3300025949 Ga0207667_10054984 Ga0207667_100549844 296
347 3300025949 Ga0207667_10165545 Ga0207667_101655452 296
348 3300025986 Ga0207658_10190689 Ga0207658_101906893 296
349 3300026023 Ga0207677_10021131 Ga0207677_100211312 296
350 3300026023 Ga0207677_10264046 Ga0207677_102640462 296
351 3300026035 Ga0207703_10031629 Ga0207703_100316292 296
352 3300026041 Ga0207639_10085468 Ga0207639_100854684 296
353 3300026041 Ga0207639_10109722 Ga0207639_101097222 296
354 3300026078 Ga0207702_10002311 Ga0207702_1000231110 296
355 3300026078 Ga0207702_10486424 Ga0207702_104864242 296
356 3300026089 Ga0207648_10015012 Ga0207648_100150128 296
357 3300026089 Ga0207648_10037335 Ga0207648_100373354 296
358 3300026116 Ga0207674_10114849 Ga0207674_101148492 296
359 3300026121 Ga0207683_10014768 Ga0207683_100147684 296
360 3300026142 Ga0207698_10127875 Ga0207698_101278752 296
361 3300028379 Ga0268266_10000871 Ga0268266_1000087121 296
362 3300028379 Ga0268266_10015781 Ga0268266_100157815 296
363 3300028379 Ga0268266_10020164 Ga0268266_100201643 296
364 3300028379 Ga0268266_10041753 Ga0268266_100417534 296
365 3300028380 Ga0268265_10142204 Ga0268265_101422042 296
366 3300028381 Ga0268264_10165562 Ga0268264_101655622 296
367 3300028577 Ga0265318_10000348 Ga0265318_1000034810 296
368 3300028800 Ga0265338_10000017 Ga0265338_10000017216 296
369 3300028800 Ga0265338_10003940 Ga0265338_100039406 296
370 3300028800 Ga0265338_10054623 Ga0265338_100546232 296
371 3300028800 Ga0265338_10429915 Ga0265338_104299151 296
372 3300031235 Ga0265330_10051406 Ga0265330_100514061 296
373 3300031238 Ga0265332_10013596 Ga0265332_100135962 296
374 3300031240 Ga0265320_10014946 Ga0265320_100149462 296
375 3300031241 Ga0265325_10000016 Ga0265325_1000001636 296
376 3300031241 Ga0265325_10001479 Ga0265325_1000147916 296
377 3300031247 Ga0265340_10018554 Ga0265340_100185543 296
378 3300031249 Ga0265339_10019941 Ga0265339_100199415 296
379 3300031249 Ga0265339_10054517 Ga0265339_100545172 296
380 3300031250 Ga0265331_10003090 Ga0265331_1000309012 296
381 3300031250 Ga0265331_10029318 Ga0265331_100293184 296
382 3300031344 Ga0265316_10015577 Ga0265316_100155773 296
383 3300031344 Ga0265316_10068505 Ga0265316_100685052 296
384 3300031344 Ga0265316_10201820 Ga0265316_102018202 296
385 3300031595 Ga0265313_10007428 Ga0265313_100074286 296
386 3300031595 Ga0265313_10008914 Ga0265313_100089147 296
387 3300031711 Ga0265314_10000635 Ga0265314_1000063539 296
388 3300031711 Ga0265314_10009184 Ga0265314_100091845 296
389 3300031711 Ga0265314_10018336 Ga0265314_100183364 296
390 3300031711 Ga0265314_10049029 Ga0265314_100490291 296
391 3300031712 Ga0265342_10014649 Ga0265342_100146494 296
392 3300031712 Ga0265342_10026721 Ga0265342_100267214 296
393 3300031712 Ga0265342_10032819 Ga0265342_100328195 296
394 3300031730 Ga0307516_10045075 Ga0307516_100450752 296
395 3300037466 Ga0395898_0007832 Ga0395898_0007832_3572_4465 296
396 3300039438 Ga0436360_1147519 Ga0436360_1147519_361_1254 296
397 3300044842 Ga0466957_0165772 Ga0466957_0165772_180_1073 296
398 3300046455 Ga0495603_0039840 Ga0495603_0039840_905_1882 296
399 3300046524 Ga0495648_0119691 Ga0495648_0119691_377_1270 296
400 3300046536 Ga0495587_0013611 Ga0495587_0013611_2827_3720 296
401 3300046557 Ga0495622_0001758 Ga0495622_0001758_5478_6371 296
402 3300046648 Ga0495611_0031308 Ga0495611_0031308_544_1437 296
403 3300047470 Ga0495681_0032695 Ga0495681_0032695_134_1027 296
404 3300048909 Ga0496106_0164221 Ga0496106_0164221_310_1203 296
405 3300048924 Ga0496121_0001676 Ga0496121_0001676_29044_29937 296
406 3300048929 Ga0496126_0000525 Ga0496126_0000525_697_1590 296
407 3300048929 Ga0496126_0304422 Ga0496126_0304422_283_1179 296
408 3300049460 Ga0495682_0001726 Ga0495682_0001726_4680_5579 296
409 3300049460 Ga0495682_0062492 Ga0495682_0062492_99_992 296
410 3300049569 Ga0501032_0073296 Ga0501032_0073296_993_1883 296
411 3300049569 Ga0501032_0109298 Ga0501032_0109298_290_1192 296
412 3300049570 Ga0501033_0041703 Ga0501033_0041703_1833_2735 296
413 3300049570 Ga0501033_0060020 Ga0501033_0060020_1825_2715 296
414 3300049570 Ga0501033_0112225 Ga0501033_0112225_151_1041 296
415 3300049571 Ga0501034_0008131 Ga0501034_0008131_5576_6478 296
416 3300049572 Ga0501036_0005095 Ga0501036_0005095_3152_4054 296
417 3300049572 Ga0501036_0041808 Ga0501036_0041808_819_1727 296
418 3300049572 Ga0501036_0062114 Ga0501036_0062114_40_942 296
419 3300049573 Ga0501037_0005918 Ga0501037_0005918_1038_1940 296
420 3300049573 Ga0501037_0036213 Ga0501037_0036213_1158_2066 296
421 3300049573 Ga0501037_0046307 Ga0501037_0046307_642_1532 296
422 3300049573 Ga0501037_0143535 Ga0501037_0143535_659_1549 296
423 3300049574 Ga0501038_0083378 Ga0501038_0083378_575_1465 296
424 3300049574 Ga0501038_0355806 Ga0501038_0355806_206_1108 296
425 3300049575 Ga0501039_0017479 Ga0501039_0017479_1792_2694 296
426 3300049575 Ga0501039_0313724 Ga0501039_0313724_53_955 296
427 3300049579 Ga0501043_0064752 Ga0501043_0064752_33_923 296
428 3300049579 Ga0501043_0092452 Ga0501043_0092452_491_1393 296
429 3300049579 Ga0501043_0107749 Ga0501043_0107749_179_1081 296
430 3300049580 Ga0501046_0036137 Ga0501046_0036137_1965_2867 296
431 3300049581 Ga0501047_0048550 Ga0501047_0048550_1725_2618 296
432 3300049581 Ga0501047_0059207 Ga0501047_0059207_35_943 296
433 3300049581 Ga0501047_0093667 Ga0501047_0093667_303_1193 296
434 3300049581 Ga0501047_0108790 Ga0501047_0108790_986_1888 296
435 3300049581 Ga0501047_0191759 Ga0501047_0191759_130_1023 296
436 3300049581 Ga0501047_0281474 Ga0501047_0281474_304_1233 296
437 3300049581 Ga0501047_0492337 Ga0501047_0492337_96_989 296
438 3300049582 Ga0501048_0006804 Ga0501048_0006804_6284_7186 296
439 3300049582 Ga0501048_0066582 Ga0501048_0066582_167_1069 296
440 3300049583 Ga0501067_0002358 Ga0501067_0002358_6668_7570 296
441 3300049584 Ga0501068_0026074 Ga0501068_0026074_1042_1944 296
442 3300049586 Ga0501070_0000242 Ga0501070_0000242_38086_38976 296
443 3300049587 Ga0501071_0117478 Ga0501071_0117478_121_1023 296
444 3300049588 Ga0501072_0063690 Ga0501072_0063690_1007_1909 296
445 3300049589 Ga0501073_0025346 Ga0501073_0025346_2150_3043 296
446 3300049589 Ga0501073_0043803 Ga0501073_0043803_293_1195 296
447 3300049590 Ga0501074_0002413 Ga0501074_0002413_2969_3871 296
448 3300049741 Ga0501079_0001660 Ga0501079_0001660_6328_7230 296
449 3300049742 Ga0501080_0005087 Ga0501080_0005087_8078_8968 296
450 3300049742 Ga0501080_0147177 Ga0501080_0147177_983_1885 296
451 3300049742 Ga0501080_0397460 Ga0501080_0397460_176_1078 296
452 3300049744 Ga0501083_0016832 Ga0501083_0016832_2808_3701 296
453 3300049744 Ga0501083_0016948 Ga0501083_0016948_1229_2131 296
454 3300049822 Ga0501035_0002988 Ga0501035_0002988_12193_13083 296
455 3300049822 Ga0501035_0014644 Ga0501035_0014644_4996_5910 296
456 3300049822 Ga0501035_0052374 Ga0501035_0052374_1637_2539 296
457 3300049822 Ga0501035_0100381 Ga0501035_0100381_599_1588 296
458 3300049822 Ga0501035_0183232 Ga0501035_0183232_870_1763 296
459 3300049822 Ga0501035_0331700 Ga0501035_0331700_126_1016 296
460 3300049823 Ga0501044_0001386 Ga0501044_0001386_8328_9218 296
461 3300049823 Ga0501044_0010640 Ga0501044_0010640_8672_9562 296
462 3300049823 Ga0501044_0041293 Ga0501044_0041293_1482_2375 296
463 3300049823 Ga0501044_0067685 Ga0501044_0067685_2165_3055 296
464 3300049823 Ga0501044_0159757 Ga0501044_0159757_556_1470 296
465 3300049823 Ga0501044_0273230 Ga0501044_0273230_106_1008 296
466 3300049824 Ga0501045_0052890 Ga0501045_0052890_1091_1993 296
467 3300050512 nmdc:mga0n895_58068_c1 nmdc:mga0n895_58068_c1_1196_2089 296
468 3300050514 nmdc:mga08x19_177_c1 nmdc:mga08x19_177_c1_47592_48485 296
469 3300053087 Ga0500643_000021 Ga0500643_000021_16077_16970 296
470 3300053090 Ga0500646_0088961 Ga0500646_0088961_46_939 296
471 3300053119 Ga0500595_008735 Ga0500595_008735_1711_2604 296
472 3300053119 Ga0500595_014106 Ga0500595_014106_1252_2145 296
473 3300053133 Ga0500655_003247 Ga0500655_003247_946_1845 296
474 3300053140 Ga0500573_0000050 Ga0500573_0000050_15574_16467 296
475 3300054114 Ga0501084_0004597 Ga0501084_0004597_1747_2649 296
476 3300060353 Ga0501082_0032180 Ga0501082_0032180_1919_2821 296
477 3300060353 Ga0501082_0035117 Ga0501082_0035117_37_930 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00701

DHDPS

Dihydrodipicolinate synthetase family

11

300

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3si9-assembly1.cif.gz_C crystal structure of dihydrodipicolinate synthase from bartonella henselae 0.9841 7 296
6xgs-assembly1.cif.gz_D crystal structure of dihydrodipicolinate synthase (dhdps) from brucella suis 1330 0.9838 7 296
2rfg-assembly1.cif.gz_D crystal structure of dihydrodipicolinate synthase from hahella chejuensis at 1.5a resolution 0.9834 9 291
4i7u-assembly1.cif.gz_A dihydrodipicolinate synthase of agrobacterium tumefaciens 0.9806 8 296
3flu-assembly1.cif.gz_B crystal structure of dihydrodipicolinate synthase from the pathogen neisseria meningitidis 0.98 8 296
ID Description Score Start End Superfamily
2rfgB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9828 9 291 3.20.20.70
6nvaA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9742 6 296 3.20.20.70
2yxgD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9713 8 296 3.20.20.70
2yxgD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.968 8 296 3.20.20.70
3a5fA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9672 9 296 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A520XND3-F1-model_v4 deleted 0.9891 145 296
AF-A0A3M1JGV6-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase 0.9873 155 296 GO:0005829
GO:0008840
AF-A0A6A5KX22-F1-model_v4 deleted 0.9871 3 296
AF-A0A520RXY2-F1-model_v4 Dihydrodipicolinate synthase 0.9868 203 296 GO:0005829
GO:0008840
AF-A0A7I0J6M6-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase 0.9867 186 296 GO:0005829
GO:0008840

Feature Viewer

pLDDT pTM Quality
95.8 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map