F451793
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 477 | 234 | 475 | 297 |
Family's Representative Sequence
| Representative Sequence | 3300049822|Ga0501035_0014644|Ga0501035_0014644_4996_5910 |
| Length | 304 |
| Sequence | MTAAQDRITDRIKGSLTALITPMKDGQVDEAAFRALVSWQIAEGTHGLVPCGTTGESPTLSHAEHRRVIEICIEEAGGRVPVIAGAGSNATTEAISLTRFAKEAGADAVLSVTGYYNKPSQEGMYRHFMAIADAVDIPIILYNIPGRAIVEIAVETMARLSSHPNIIGVKDATANLMRPSRERVAIGTTRQDWLMLSGEDGTALGYMAYGGHGCISVTANVAPRLCAQFQEACLKGDFAAALAIQDKLMPLHDALFCEPSPAPVKYAASLLGLCRADVRLPLVEATGPAQERIRNAMAGAGLPI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 2 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 47 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 48 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 49 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 56 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 57 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 90 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 135 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 139 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 140 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 143 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 144 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 145 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 146 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 147 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 148 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 149 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 151 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 152 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 153 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 155 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 156 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 157 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 158 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 159 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 160 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 161 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 162 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 174 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 175 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 176 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 177 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 180 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 181 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 182 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 183 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 184 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 185 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 186 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 212 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 213 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 214 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 215 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 225 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 226 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 227 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 228 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 229 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 230 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 231 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.53 |
| Metatranscriptomes | 1.05 |
| Isolates | 0.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.5 |
| Nodule | 0 |
| Rhizoplane | 4.82 |
| Rhizosphere | 86.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10000793 | 3300003320 | Bacteria | 9403 |
| 2 | Ga0070658_10066655 | 3300005327 | Bacteria | 2941 |
| 3 | Ga0070658_10100360 | 3300005327 | Bacteria | 2392 |
| 4 | Ga0070658_10123427 | 3300005327 | Bacteria | 2153 |
| 5 | Ga0070658_10123767 | 3300005327 | Bacteria | 2151 |
| 6 | Ga0070658_10135106 | 3300005327 | Bacteria | 2057 |
| 7 | Ga0070658_10156822 | 3300005327 | Bacteria | 1908 |
| 8 | Ga0070658_10291509 | 3300005327 | Bacteria | 1390 |
| 9 | Ga0070683_100418761 | 3300005329 | Bacteria | 1278 |
| 10 | Ga0070670_100160842 | 3300005331 | Bacteria | 1946 |
| 11 | Ga0070670_100440120 | 3300005331 | Bacteria | 1154 |
| 12 | Ga0070666_10005773 | 3300005335 | Bacteria | 7604 |
| 13 | Ga0070680_100006103 | 3300005336 | Bacteria | 9131 |
| 14 | Ga0070680_100297453 | 3300005336 | Bacteria | 1368 |
| 15 | Ga0068868_100318500 | 3300005338 | Bacteria | 1324 |
| 16 | Ga0068868_100451170 | 3300005338 | Bacteria | 1119 |
| 17 | Ga0070660_100008390 | 3300005339 | Bacteria | 7222 |
| 18 | Ga0070660_100023494 | 3300005339 | Bacteria | 4567 |
| 19 | Ga0070660_100025731 | 3300005339 | Bacteria | 4376 |
| 20 | Ga0070660_100146908 | 3300005339 | Bacteria | 1894 |
| 21 | Ga0070691_10003719 | 3300005341 | Bacteria | 6890 |
| 22 | Ga0070661_100096241 | 3300005344 | Bacteria | 2196 |
| 23 | Ga0070692_10000181 | 3300005345 | Bacteria | 16518 |
| 24 | Ga0070668_100034681 | 3300005347 | Bacteria | 3846 |
| 25 | Ga0070671_100181941 | 3300005355 | Bacteria | 1780 |
| 26 | Ga0070659_100002415 | 3300005366 | Bacteria | 13278 |
| 27 | Ga0070667_100057074 | 3300005367 | Bacteria | 3298 |
| 28 | Ga0070667_100324443 | 3300005367 | Bacteria | 1390 |
| 29 | Ga0070709_10000433 | 3300005434 | Bacteria | 25313 |
| 30 | Ga0070714_100114529 | 3300005435 | Bacteria | 2392 |
| 31 | Ga0070713_100000012 | 3300005436 | Bacteria | 137708 |
| 32 | Ga0070710_10141236 | 3300005437 | Bacteria | 1477 |
| 33 | Ga0070711_100175428 | 3300005439 | Bacteria | 1637 |
| 34 | Ga0070694_100018461 | 3300005444 | Bacteria | 4426 |
| 35 | Ga0070663_100223248 | 3300005455 | Bacteria | 1480 |
| 36 | Ga0070678_100007105 | 3300005456 | Bacteria | 6623 |
| 37 | Ga0070678_100023402 | 3300005456 | Bacteria | 4116 |
| 38 | Ga0070681_10000074 | 3300005458 | Bacteria | 74128 |
| 39 | Ga0070681_10050537 | 3300005458 | Bacteria | 4147 |
| 40 | Ga0070681_10147771 | 3300005458 | Bacteria | 2278 |
| 41 | Ga0070706_100338781 | 3300005467 | Bacteria | 1402 |
| 42 | Ga0070679_100000961 | 3300005530 | Bacteria | 25075 |
| 43 | Ga0070679_100029852 | 3300005530 | Bacteria | 5380 |
| 44 | Ga0070679_100049640 | 3300005530 | Bacteria | 4179 |
| 45 | Ga0070684_100184224 | 3300005535 | Bacteria | 1899 |
| 46 | Ga0070684_100390870 | 3300005535 | Bacteria | 1282 |
| 47 | Ga0068853_100000746 | 3300005539 | Bacteria | 22591 |
| 48 | Ga0068853_100136291 | 3300005539 | Bacteria | 2201 |
| 49 | Ga0068853_100268974 | 3300005539 | Bacteria | 1569 |
| 50 | Ga0068853_100440300 | 3300005539 | Bacteria | 1224 |
| 51 | Ga0070695_100063043 | 3300005545 | Bacteria | 2408 |
| 52 | Ga0070693_100140416 | 3300005547 | Bacteria | 1520 |
| 53 | Ga0070665_100002469 | 3300005548 | Bacteria | 20384 |
| 54 | Ga0070665_100029434 | 3300005548 | Bacteria | 5528 |
| 55 | Ga0070665_100041895 | 3300005548 | Bacteria | 4603 |
| 56 | Ga0070665_100163366 | 3300005548 | Bacteria | 2229 |
| 57 | Ga0068855_100026640 | 3300005563 | Bacteria | 6917 |
| 58 | Ga0068855_100046246 | 3300005563 | Bacteria | 5145 |
| 59 | Ga0068857_100107399 | 3300005577 | Bacteria | 2507 |
| 60 | Ga0068854_100044954 | 3300005578 | Bacteria | 3138 |
| 61 | Ga0068856_100001151 | 3300005614 | Bacteria | 27834 |
| 62 | Ga0068856_100068435 | 3300005614 | Bacteria | 3510 |
| 63 | Ga0068852_100209507 | 3300005616 | Bacteria | 1848 |
| 64 | Ga0068859_100354640 | 3300005617 | Bacteria | 1562 |
| 65 | Ga0068864_100146445 | 3300005618 | Bacteria | 2135 |
| 66 | Ga0068861_100127439 | 3300005719 | Bacteria | 2062 |
| 67 | Ga0068863_100170875 | 3300005841 | Bacteria | 2085 |
| 68 | Ga0068858_100027825 | 3300005842 | Bacteria | 5252 |
| 69 | Ga0068860_100067312 | 3300005843 | Bacteria | 3403 |
| 70 | Ga0068860_100159045 | 3300005843 | Bacteria | 2178 |
| 71 | Ga0068860_100370082 | 3300005843 | Bacteria | 1413 |
| 72 | Ga0068860_100474073 | 3300005843 | Bacteria | 1247 |
| 73 | Ga0068862_100116858 | 3300005844 | Bacteria | 2347 |
| 74 | Ga0081455_10006404 | 3300005937 | Bacteria | 12631 |
| 75 | Ga0081455_10073775 | 3300005937 | Bacteria | 2820 |
| 76 | Ga0075365_10022074 | 3300006038 | Bacteria | 3982 |
| 77 | Ga0075365_10080516 | 3300006038 | Bacteria | 2205 |
| 78 | Ga0075368_10000420 | 3300006042 | Bacteria | 12500 |
| 79 | Ga0075368_10062779 | 3300006042 | Bacteria | 1490 |
| 80 | Ga0075363_100021962 | 3300006048 | Bacteria | 3222 |
| 81 | Ga0075363_100058165 | 3300006048 | Bacteria | 2076 |
| 82 | Ga0070712_100000098 | 3300006175 | Bacteria | 44128 |
| 83 | Ga0075367_10001232 | 3300006178 | Bacteria | 10750 |
| 84 | Ga0075367_10007139 | 3300006178 | Bacteria | 5699 |
| 85 | Ga0097621_100001637 | 3300006237 | Bacteria | 15341 |
| 86 | Ga0097621_100035828 | 3300006237 | Bacteria | 3966 |
| 87 | Ga0097621_100057984 | 3300006237 | Bacteria | 3168 |
| 88 | Ga0097621_100094427 | 3300006237 | Bacteria | 2507 |
| 89 | Ga0097621_100339153 | 3300006237 | Bacteria | 1334 |
| 90 | Ga0068871_100006532 | 3300006358 | Bacteria | 8260 |
| 91 | Ga0068871_100034479 | 3300006358 | Bacteria | 4016 |
| 92 | Ga0068871_100092688 | 3300006358 | Bacteria | 2520 |
| 93 | Ga0068871_100098128 | 3300006358 | Bacteria | 2451 |
| 94 | Ga0075428_100164340 | 3300006844 | Bacteria | 2408 |
| 95 | Ga0075431_100112704 | 3300006847 | Bacteria | 2807 |
| 96 | Ga0075431_100429696 | 3300006847 | Bacteria | 1319 |
| 97 | Ga0075431_100452513 | 3300006847 | Bacteria | 1279 |
| 98 | Ga0075434_100026298 | 3300006871 | Bacteria | 5699 |
| 99 | Ga0075434_100039552 | 3300006871 | Bacteria | 4674 |
| 100 | Ga0075434_100052941 | 3300006871 | Bacteria | 4034 |
| 101 | Ga0075429_100235142 | 3300006880 | Bacteria | 1605 |
| 102 | Ga0068865_100009417 | 3300006881 | Bacteria | 6056 |
| 103 | Ga0075436_100000416 | 3300006914 | Bacteria | 27313 |
| 104 | Ga0097620_100354618 | 3300006931 | Bacteria | 1562 |
| 105 | Ga0105240_10007938 | 3300009093 | Bacteria | 15312 |
| 106 | Ga0105240_10017462 | 3300009093 | Bacteria | 9668 |
| 107 | Ga0105240_10065129 | 3300009093 | Bacteria | 4524 |
| 108 | Ga0105240_10157991 | 3300009093 | Bacteria | 2695 |
| 109 | Ga0105240_10159139 | 3300009093 | Bacteria | 2684 |
| 110 | Ga0105240_10223389 | 3300009093 | Bacteria | 2193 |
| 111 | Ga0105240_10423210 | 3300009093 | Bacteria | 1496 |
| 112 | Ga0105240_10457865 | 3300009093 | Bacteria | 1426 |
| 113 | Ga0111539_10001024 | 3300009094 | Bacteria | 36666 |
| 114 | Ga0111539_10077007 | 3300009094 | Bacteria | 3926 |
| 115 | Ga0111539_10482901 | 3300009094 | Bacteria | 1443 |
| 116 | Ga0105245_10041140 | 3300009098 | Bacteria | 4120 |
| 117 | Ga0105245_10047517 | 3300009098 | Bacteria | 3838 |
| 118 | Ga0105245_10169570 | 3300009098 | Bacteria | 2078 |
| 119 | Ga0105245_10690265 | 3300009098 | Bacteria | 1053 |
| 120 | Ga0105247_10110351 | 3300009101 | Bacteria | 1770 |
| 121 | Ga0114129_10090961 | 3300009147 | Bacteria | 4229 |
| 122 | Ga0114129_10188829 | 3300009147 | Bacteria | 2799 |
| 123 | Ga0114129_10716751 | 3300009147 | Bacteria | 1284 |
| 124 | Ga0105243_10006489 | 3300009148 | Bacteria | 9046 |
| 125 | Ga0105243_10226090 | 3300009148 | Bacteria | 1657 |
| 126 | Ga0105241_10009944 | 3300009174 | Bacteria | 6988 |
| 127 | Ga0105241_10025069 | 3300009174 | Bacteria | 4432 |
| 128 | Ga0105241_10386121 | 3300009174 | Bacteria | 1225 |
| 129 | Ga0105248_10000013 | 3300009177 | Bacteria | 328864 |
| 130 | Ga0105248_10700956 | 3300009177 | Bacteria | 1142 |
| 131 | Ga0105237_10077546 | 3300009545 | Bacteria | 3313 |
| 132 | Ga0105237_10227055 | 3300009545 | Bacteria | 1867 |
| 133 | Ga0105237_10304701 | 3300009545 | Bacteria | 1596 |
| 134 | Ga0105237_10313190 | 3300009545 | Bacteria | 1573 |
| 135 | Ga0105238_10011343 | 3300009551 | Bacteria | 8967 |
| 136 | Ga0105238_10071592 | 3300009551 | Bacteria | 3464 |
| 137 | Ga0105238_10149922 | 3300009551 | Bacteria | 2307 |
| 138 | Ga0105249_10613904 | 3300009553 | Bacteria | 1143 |
| 139 | Ga0105239_10006956 | 3300010375 | Bacteria | 13038 |
| 140 | Ga0105239_10031804 | 3300010375 | Bacteria | 5798 |
| 141 | Ga0105239_10095539 | 3300010375 | Bacteria | 3283 |
| 142 | Ga0105246_10004442 | 3300011119 | Bacteria | 8536 |
| 143 | Ga0105246_10200964 | 3300011119 | Bacteria | 1549 |
| 144 | Ga0157373_10035798 | 3300013100 | Bacteria | 3563 |
| 145 | Ga0157370_10081034 | 3300013104 | Bacteria | 3055 |
| 146 | Ga0157369_10009612 | 3300013105 | Bacteria | 11056 |
| 147 | Ga0157369_10027642 | 3300013105 | Bacteria | 6285 |
| 148 | Ga0157369_10160987 | 3300013105 | Bacteria | 2369 |
| 149 | Ga0157374_10110854 | 3300013296 | Bacteria | 2639 |
| 150 | Ga0157378_10004593 | 3300013297 | Bacteria | 12114 |
| 151 | Ga0157378_10060405 | 3300013297 | Bacteria | 3383 |
| 152 | Ga0157378_10205272 | 3300013297 | Bacteria | 1866 |
| 153 | Ga0157378_10215752 | 3300013297 | Bacteria | 1822 |
| 154 | Ga0157378_10313067 | 3300013297 | Bacteria | 1523 |
| 155 | Ga0163162_10037320 | 3300013306 | Bacteria | 4849 |
| 156 | Ga0163162_10058923 | 3300013306 | Bacteria | 3870 |
| 157 | Ga0163162_10202213 | 3300013306 | Bacteria | 2115 |
| 158 | Ga0157372_10002320 | 3300013307 | Bacteria | 20607 |
| 159 | Ga0157372_10005593 | 3300013307 | Bacteria | 13364 |
| 160 | Ga0157372_10206708 | 3300013307 | Bacteria | 2275 |
| 161 | Ga0157372_10327482 | 3300013307 | Bacteria | 1784 |
| 162 | Ga0157372_10365686 | 3300013307 | Bacteria | 1681 |
| 163 | Ga0157372_10852312 | 3300013307 | Bacteria | 1058 |
| 164 | Ga0157375_10035908 | 3300013308 | Bacteria | 4735 |
| 165 | Ga0157375_10386578 | 3300013308 | Bacteria | 1566 |
| 166 | Ga0163163_10002055 | 3300014325 | Bacteria | 16988 |
| 167 | Ga0163163_10080595 | 3300014325 | Bacteria | 3255 |
| 168 | Ga0163163_10339810 | 3300014325 | Bacteria | 1556 |
| 169 | Ga0157380_10193653 | 3300014326 | Bacteria | 1797 |
| 170 | Ga0157380_10224781 | 3300014326 | Bacteria | 1682 |
| 171 | Ga0157379_10005750 | 3300014968 | Bacteria | 10671 |
| 172 | Ga0157379_10369620 | 3300014968 | Bacteria | 1315 |
| 173 | Ga0157376_10014691 | 3300014969 | Bacteria | 5887 |
| 174 | Ga0163161_10013801 | 3300017792 | Bacteria | 5627 |
| 175 | Ga0206356_11052037 | 3300020070 | Bacteria | 1110 |
| 176 | Ga0206353_10470198 | 3300020082 | Bacteria | 1007 |
| 177 | Ga0213876_10000148 | 3300021384 | Bacteria | 75586 |
| 178 | Ga0224712_10073649 | 3300022467 | Bacteria | 1394 |
| 179 | Ga0207427_108016 | 3300025231 | Bacteria | 1202 |
| 180 | Ga0209233_1000013 | 3300025261 | Bacteria | 1013785 |
| 181 | Ga0209675_1002273 | 3300025291 | Bacteria | 10015 |
| 182 | Ga0207692_10051680 | 3300025898 | Bacteria | 2085 |
| 183 | Ga0207642_10112753 | 3300025899 | Bacteria | 1388 |
| 184 | Ga0207710_10110168 | 3300025900 | Bacteria | 1307 |
| 185 | Ga0207699_10000227 | 3300025906 | Bacteria | 32219 |
| 186 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 187 | Ga0207705_10046612 | 3300025909 | Bacteria | 3115 |
| 188 | Ga0207705_10078884 | 3300025909 | Bacteria | 2397 |
| 189 | Ga0207705_10111281 | 3300025909 | Bacteria | 2023 |
| 190 | Ga0207654_10005899 | 3300025911 | Bacteria | 6168 |
| 191 | Ga0207707_10000079 | 3300025912 | Bacteria | 98440 |
| 192 | Ga0207707_10010654 | 3300025912 | Bacteria | 7987 |
| 193 | Ga0207707_10162546 | 3300025912 | Bacteria | 1952 |
| 194 | Ga0207707_10339269 | 3300025912 | Bacteria | 1296 |
| 195 | Ga0207695_10014294 | 3300025913 | Bacteria | 9414 |
| 196 | Ga0207695_10025423 | 3300025913 | Bacteria | 6628 |
| 197 | Ga0207695_10067132 | 3300025913 | Bacteria | 3680 |
| 198 | Ga0207695_10106835 | 3300025913 | Bacteria | 2785 |
| 199 | Ga0207695_10116014 | 3300025913 | Bacteria | 2652 |
| 200 | Ga0207695_10226871 | 3300025913 | Bacteria | 1774 |
| 201 | Ga0207695_10286978 | 3300025913 | Bacteria | 1538 |
| 202 | Ga0207695_10541449 | 3300025913 | Bacteria | 1046 |
| 203 | Ga0207693_10000324 | 3300025915 | Bacteria | 44179 |
| 204 | Ga0207660_10001281 | 3300025917 | Bacteria | 16873 |
| 205 | Ga0207660_10356126 | 3300025917 | Bacteria | 1173 |
| 206 | Ga0207657_10000082 | 3300025919 | Bacteria | 89667 |
| 207 | Ga0207657_10009154 | 3300025919 | Bacteria | 9991 |
| 208 | Ga0207657_10019479 | 3300025919 | Bacteria | 6442 |
| 209 | Ga0207652_10000931 | 3300025921 | Bacteria | 27506 |
| 210 | Ga0207652_10006563 | 3300025921 | Bacteria | 9376 |
| 211 | Ga0207652_10097001 | 3300025921 | Bacteria | 2598 |
| 212 | Ga0207681_10113538 | 3300025923 | Bacteria | 1975 |
| 213 | Ga0207694_10012988 | 3300025924 | Bacteria | 6271 |
| 214 | Ga0207694_10038079 | 3300025924 | Bacteria | 3697 |
| 215 | Ga0207687_10030022 | 3300025927 | Bacteria | 3661 |
| 216 | Ga0207687_10067258 | 3300025927 | Bacteria | 2548 |
| 217 | Ga0207687_10153399 | 3300025927 | Bacteria | 1760 |
| 218 | Ga0207687_10433747 | 3300025927 | Bacteria | 1087 |
| 219 | Ga0207700_10000058 | 3300025928 | Bacteria | 70410 |
| 220 | Ga0207664_10095185 | 3300025929 | Bacteria | 2449 |
| 221 | Ga0207664_10229760 | 3300025929 | Bacteria | 1612 |
| 222 | Ga0207690_10008907 | 3300025932 | Bacteria | 5957 |
| 223 | Ga0207709_10189540 | 3300025935 | Bacteria | 1460 |
| 224 | Ga0207670_10369711 | 3300025936 | Bacteria | 1139 |
| 225 | Ga0207704_10149315 | 3300025938 | Bacteria | 1647 |
| 226 | Ga0207711_10000003 | 3300025941 | Bacteria | 1042791 |
| 227 | Ga0207711_10110315 | 3300025941 | Bacteria | 2446 |
| 228 | Ga0207711_10196199 | 3300025941 | Bacteria | 1841 |
| 229 | Ga0207711_10331946 | 3300025941 | Bacteria | 1406 |
| 230 | Ga0207689_10059018 | 3300025942 | Bacteria | 3156 |
| 231 | Ga0207661_10162896 | 3300025944 | Bacteria | 1936 |
| 232 | Ga0207661_10355610 | 3300025944 | Bacteria | 1322 |
| 233 | Ga0207667_10007941 | 3300025949 | Bacteria | 12666 |
| 234 | Ga0207667_10054984 | 3300025949 | Bacteria | 4186 |
| 235 | Ga0207667_10165545 | 3300025949 | Bacteria | 2273 |
| 236 | Ga0207667_10285102 | 3300025949 | Bacteria | 1688 |
| 237 | Ga0207712_10187465 | 3300025961 | Bacteria | 1630 |
| 238 | Ga0207712_10253776 | 3300025961 | Bacteria | 1423 |
| 239 | Ga0207668_10088261 | 3300025972 | Bacteria | 2271 |
| 240 | Ga0207658_10190689 | 3300025986 | Bacteria | 1703 |
| 241 | Ga0207658_10435993 | 3300025986 | Bacteria | 1158 |
| 242 | Ga0207677_10021131 | 3300026023 | Bacteria | 3971 |
| 243 | Ga0207677_10264046 | 3300026023 | Bacteria | 1405 |
| 244 | Ga0207703_10031629 | 3300026035 | Bacteria | 4186 |
| 245 | Ga0207639_10085468 | 3300026041 | Bacteria | 2509 |
| 246 | Ga0207639_10109722 | 3300026041 | Bacteria | 2246 |
| 247 | Ga0207708_10233717 | 3300026075 | Bacteria | 1477 |
| 248 | Ga0207702_10002311 | 3300026078 | Bacteria | 18241 |
| 249 | Ga0207702_10486424 | 3300026078 | Bacteria | 1202 |
| 250 | Ga0207641_10144191 | 3300026088 | Bacteria | 2152 |
| 251 | Ga0207648_10015012 | 3300026089 | Bacteria | 7134 |
| 252 | Ga0207648_10037335 | 3300026089 | Bacteria | 4279 |
| 253 | Ga0207674_10051280 | 3300026116 | Bacteria | 4211 |
| 254 | Ga0207674_10114849 | 3300026116 | Bacteria | 2664 |
| 255 | Ga0207675_100206678 | 3300026118 | Bacteria | 1887 |
| 256 | Ga0207675_100454884 | 3300026118 | Bacteria | 1269 |
| 257 | Ga0207675_100524300 | 3300026118 | Bacteria | 1181 |
| 258 | Ga0207683_10014768 | 3300026121 | Bacteria | 6648 |
| 259 | Ga0207698_10031680 | 3300026142 | Bacteria | 3820 |
| 260 | Ga0207698_10127875 | 3300026142 | Bacteria | 2165 |
| 261 | Ga0209813_10000849 | 3300027866 | Bacteria | 6904 |
| 262 | Ga0209813_10026833 | 3300027866 | Bacteria | 1668 |
| 263 | Ga0209813_10046760 | 3300027866 | Bacteria | 1338 |
| 264 | Ga0207428_10008580 | 3300027907 | Bacteria | 9222 |
| 265 | Ga0207428_10040559 | 3300027907 | Bacteria | 3775 |
| 266 | Ga0268266_10000871 | 3300028379 | Bacteria | 39260 |
| 267 | Ga0268266_10015781 | 3300028379 | Bacteria | 6467 |
| 268 | Ga0268266_10020164 | 3300028379 | Bacteria | 5683 |
| 269 | Ga0268266_10041753 | 3300028379 | Bacteria | 3915 |
| 270 | Ga0268265_10043329 | 3300028380 | Bacteria | 3345 |
| 271 | Ga0268265_10142204 | 3300028380 | Bacteria | 2010 |
| 272 | Ga0268264_10074136 | 3300028381 | Bacteria | 2890 |
| 273 | Ga0268264_10165562 | 3300028381 | Bacteria | 1995 |
| 274 | Ga0265318_10000348 | 3300028577 | Bacteria | 36746 |
| 275 | Ga0265318_10002134 | 3300028577 | Bacteria | 10758 |
| 276 | Ga0265338_10000017 | 3300028800 | Bacteria | 344481 |
| 277 | Ga0265338_10003940 | 3300028800 | Bacteria | 20451 |
| 278 | Ga0265338_10054623 | 3300028800 | Bacteria | 3559 |
| 279 | Ga0265338_10429915 | 3300028800 | Bacteria | 937 |
| 280 | Ga0265330_10051406 | 3300031235 | Bacteria | 1807 |
| 281 | Ga0265332_10013596 | 3300031238 | Bacteria | 3605 |
| 282 | Ga0265320_10014946 | 3300031240 | Bacteria | 4401 |
| 283 | Ga0265325_10000016 | 3300031241 | Bacteria | 130316 |
| 284 | Ga0265325_10001479 | 3300031241 | Bacteria | 16557 |
| 285 | Ga0265340_10018554 | 3300031247 | Bacteria | 3588 |
| 286 | Ga0265339_10019941 | 3300031249 | Bacteria | 3925 |
| 287 | Ga0265339_10054517 | 3300031249 | Bacteria | 2171 |
| 288 | Ga0265331_10003090 | 3300031250 | Bacteria | 10919 |
| 289 | Ga0265331_10029318 | 3300031250 | Bacteria | 2747 |
| 290 | Ga0265331_10030595 | 3300031250 | Bacteria | 2680 |
| 291 | Ga0265316_10015577 | 3300031344 | Bacteria | 6640 |
| 292 | Ga0265316_10068505 | 3300031344 | Bacteria | 2741 |
| 293 | Ga0265316_10201820 | 3300031344 | Bacteria | 1474 |
| 294 | Ga0265313_10004469 | 3300031595 | Bacteria | 10713 |
| 295 | Ga0265313_10007428 | 3300031595 | Bacteria | 7496 |
| 296 | Ga0265313_10008914 | 3300031595 | Bacteria | 6594 |
| 297 | Ga0265314_10000635 | 3300031711 | Bacteria | 43051 |
| 298 | Ga0265314_10006199 | 3300031711 | Bacteria | 10620 |
| 299 | Ga0265314_10009184 | 3300031711 | Bacteria | 8385 |
| 300 | Ga0265314_10018336 | 3300031711 | Bacteria | 5458 |
| 301 | Ga0265314_10049029 | 3300031711 | Bacteria | 2959 |
| 302 | Ga0265342_10014649 | 3300031712 | Bacteria | 5198 |
| 303 | Ga0265342_10026721 | 3300031712 | Bacteria | 3614 |
| 304 | Ga0265342_10032819 | 3300031712 | Bacteria | 3199 |
| 305 | Ga0316578_10104021 | 3300031728 | Bacteria | 1703 |
| 306 | Ga0316578_10106425 | 3300031728 | Bacteria | 1683 |
| 307 | Ga0307516_10045075 | 3300031730 | Bacteria | 4358 |
| 308 | Ga0373956_0063894 | 3300035119 | Bacteria | 1671 |
| 309 | Ga0373947_0050955 | 3300035725 | Bacteria | 2490 |
| 310 | Ga0316584_0111105 | 3300036712 | Bacteria | 2051 |
| 311 | Ga0395898_0007832 | 3300037466 | Bacteria | 11341 |
| 312 | Ga0436365_0897189 | 3300039437 | Bacteria | 4754 |
| 313 | Ga0436365_1201434 | 3300039437 | Bacteria | 113887 |
| 314 | Ga0436360_1147519 | 3300039438 | Bacteria | 1441 |
| 315 | Ga0436360_1292018 | 3300039438 | Bacteria | 1922 |
| 316 | Ga0436361_0770122 | 3300039447 | Bacteria | 1509 |
| 317 | Ga0466957_0165772 | 3300044842 | Bacteria | 1437 |
| 318 | Ga0466967_0345885 | 3300045976 | Bacteria | 1439 |
| 319 | Ga0495603_0039840 | 3300046455 | Bacteria | 2814 |
| 320 | Ga0495580_0219541 | 3300046472 | Bacteria | 1307 |
| 321 | Ga0495648_0119691 | 3300046524 | Bacteria | 1418 |
| 322 | Ga0495587_0013611 | 3300046536 | Bacteria | 5112 |
| 323 | Ga0495622_0001758 | 3300046557 | Bacteria | 10705 |
| 324 | Ga0495667_0119818 | 3300046559 | Bacteria | 1700 |
| 325 | Ga0495611_0031308 | 3300046648 | Bacteria | 2341 |
| 326 | Ga0495674_0178017 | 3300047319 | Bacteria | 1772 |
| 327 | Ga0495681_0032695 | 3300047470 | Bacteria | 2616 |
| 328 | Ga0496100_0106358 | 3300048903 | Bacteria | 1942 |
| 329 | Ga0496101_0025013 | 3300048904 | Bacteria | 4139 |
| 330 | Ga0496102_0113603 | 3300048905 | Bacteria | 2527 |
| 331 | Ga0496104_0000182 | 3300048907 | Bacteria | 56117 |
| 332 | Ga0496104_0014071 | 3300048907 | Bacteria | 7222 |
| 333 | Ga0496105_0016358 | 3300048908 | Bacteria | 5921 |
| 334 | Ga0496105_0041906 | 3300048908 | Bacteria | 3773 |
| 335 | Ga0496106_0080844 | 3300048909 | Bacteria | 2496 |
| 336 | Ga0496106_0086259 | 3300048909 | Bacteria | 2418 |
| 337 | Ga0496106_0164221 | 3300048909 | Bacteria | 1757 |
| 338 | Ga0496108_0001152 | 3300048911 | Bacteria | 20646 |
| 339 | Ga0496108_0114166 | 3300048911 | Bacteria | 2312 |
| 340 | Ga0496109_0002055 | 3300048912 | Bacteria | 16695 |
| 341 | Ga0496110_0008147 | 3300048913 | Bacteria | 8419 |
| 342 | Ga0496110_0168370 | 3300048913 | Bacteria | 1987 |
| 343 | Ga0496111_0051603 | 3300048914 | Bacteria | 2969 |
| 344 | Ga0496111_0114699 | 3300048914 | Bacteria | 1986 |
| 345 | Ga0496112_0015595 | 3300048915 | Bacteria | 7097 |
| 346 | Ga0496112_0161537 | 3300048915 | Bacteria | 2207 |
| 347 | Ga0496112_0300985 | 3300048915 | Bacteria | 1549 |
| 348 | Ga0496114_0046600 | 3300048917 | Bacteria | 3603 |
| 349 | Ga0496115_0037499 | 3300048918 | Bacteria | 3841 |
| 350 | Ga0496115_0058453 | 3300048918 | Bacteria | 3103 |
| 351 | Ga0496121_0001676 | 3300048924 | Bacteria | 36412 |
| 352 | Ga0496126_0000525 | 3300048929 | Bacteria | 74677 |
| 353 | Ga0496126_0304422 | 3300048929 | Bacteria | 1314 |
| 354 | Ga0495682_0001726 | 3300049460 | Bacteria | 11086 |
| 355 | Ga0495682_0062492 | 3300049460 | Bacteria | 1344 |
| 356 | Ga0501032_0073296 | 3300049569 | Bacteria | 2281 |
| 357 | Ga0501032_0079108 | 3300049569 | Bacteria | 2189 |
| 358 | Ga0501032_0109298 | 3300049569 | Bacteria | 1830 |
| 359 | Ga0501033_0041703 | 3300049570 | Bacteria | 3423 |
| 360 | Ga0501033_0060020 | 3300049570 | Bacteria | 2807 |
| 361 | Ga0501033_0112225 | 3300049570 | Bacteria | 1983 |
| 362 | Ga0501033_0192460 | 3300049570 | Bacteria | 1459 |
| 363 | Ga0501034_0008131 | 3300049571 | Bacteria | 11123 |
| 364 | Ga0501034_0052322 | 3300049571 | Bacteria | 4114 |
| 365 | Ga0501034_0067309 | 3300049571 | Bacteria | 3595 |
| 366 | Ga0501034_0119139 | 3300049571 | Bacteria | 2626 |
| 367 | Ga0501034_0288055 | 3300049571 | Bacteria | 1581 |
| 368 | Ga0501036_0005095 | 3300049572 | Bacteria | 10632 |
| 369 | Ga0501036_0041808 | 3300049572 | Bacteria | 3879 |
| 370 | Ga0501036_0062114 | 3300049572 | Bacteria | 3164 |
| 371 | Ga0501037_0005918 | 3300049573 | Bacteria | 8930 |
| 372 | Ga0501037_0036213 | 3300049573 | Bacteria | 3637 |
| 373 | Ga0501037_0046307 | 3300049573 | Bacteria | 3190 |
| 374 | Ga0501037_0143535 | 3300049573 | Bacteria | 1708 |
| 375 | Ga0501038_0083378 | 3300049574 | Bacteria | 2691 |
| 376 | Ga0501038_0355806 | 3300049574 | Bacteria | 1139 |
| 377 | Ga0501038_0369603 | 3300049574 | Bacteria | 1114 |
| 378 | Ga0501038_0409106 | 3300049574 | Bacteria | 1048 |
| 379 | Ga0501039_0017479 | 3300049575 | Bacteria | 5501 |
| 380 | Ga0501039_0313724 | 3300049575 | Bacteria | 1233 |
| 381 | Ga0501043_0064752 | 3300049579 | Bacteria | 2871 |
| 382 | Ga0501043_0092452 | 3300049579 | Bacteria | 2378 |
| 383 | Ga0501043_0107749 | 3300049579 | Bacteria | 2188 |
| 384 | Ga0501043_0117579 | 3300049579 | Bacteria | 2086 |
| 385 | Ga0501046_0036137 | 3300049580 | Bacteria | 3977 |
| 386 | Ga0501047_0003459 | 3300049581 | Bacteria | 14920 |
| 387 | Ga0501047_0048550 | 3300049581 | Bacteria | 4099 |
| 388 | Ga0501047_0059207 | 3300049581 | Bacteria | 3698 |
| 389 | Ga0501047_0093667 | 3300049581 | Bacteria | 2883 |
| 390 | Ga0501047_0108790 | 3300049581 | Bacteria | 2654 |
| 391 | Ga0501047_0191759 | 3300049581 | Bacteria | 1907 |
| 392 | Ga0501047_0281474 | 3300049581 | Bacteria | 1508 |
| 393 | Ga0501047_0372396 | 3300049581 | Bacteria | 1263 |
| 394 | Ga0501047_0492337 | 3300049581 | Bacteria | 1053 |
| 395 | Ga0501048_0001040 | 3300049582 | Bacteria | 20782 |
| 396 | Ga0501048_0006804 | 3300049582 | Bacteria | 8684 |
| 397 | Ga0501048_0066582 | 3300049582 | Bacteria | 2547 |
| 398 | Ga0501067_0002358 | 3300049583 | Bacteria | 10461 |
| 399 | Ga0501067_0032250 | 3300049583 | Bacteria | 2908 |
| 400 | Ga0501067_0076183 | 3300049583 | Bacteria | 1859 |
| 401 | Ga0501068_0026074 | 3300049584 | Bacteria | 3441 |
| 402 | Ga0501070_0000242 | 3300049586 | Bacteria | 51302 |
| 403 | Ga0501070_0027115 | 3300049586 | Bacteria | 4806 |
| 404 | Ga0501071_0117478 | 3300049587 | Bacteria | 1970 |
| 405 | Ga0501072_0063690 | 3300049588 | Bacteria | 2909 |
| 406 | Ga0501073_0025346 | 3300049589 | Bacteria | 4254 |
| 407 | Ga0501073_0043803 | 3300049589 | Bacteria | 3155 |
| 408 | Ga0501074_0002413 | 3300049590 | Bacteria | 13023 |
| 409 | Ga0501074_0177285 | 3300049590 | Bacteria | 1521 |
| 410 | Ga0501079_0001660 | 3300049741 | Bacteria | 15834 |
| 411 | Ga0501080_0005087 | 3300049742 | Bacteria | 11720 |
| 412 | Ga0501080_0010288 | 3300049742 | Bacteria | 8553 |
| 413 | Ga0501080_0147177 | 3300049742 | Bacteria | 2177 |
| 414 | Ga0501080_0397460 | 3300049742 | Bacteria | 1240 |
| 415 | Ga0501083_0016832 | 3300049744 | Bacteria | 5107 |
| 416 | Ga0501083_0016948 | 3300049744 | Bacteria | 5088 |
| 417 | Ga0501083_0228870 | 3300049744 | Bacteria | 1211 |
| 418 | Ga0501035_0002988 | 3300049822 | Bacteria | 16241 |
| 419 | Ga0501035_0014644 | 3300049822 | Bacteria | 7241 |
| 420 | Ga0501035_0024455 | 3300049822 | Bacteria | 5539 |
| 421 | Ga0501035_0052374 | 3300049822 | Bacteria | 3652 |
| 422 | Ga0501035_0100381 | 3300049822 | Bacteria | 2541 |
| 423 | Ga0501035_0183232 | 3300049822 | Bacteria | 1803 |
| 424 | Ga0501035_0231837 | 3300049822 | Bacteria | 1573 |
| 425 | Ga0501035_0331700 | 3300049822 | Bacteria | 1276 |
| 426 | Ga0501044_0001386 | 3300049823 | Bacteria | 28428 |
| 427 | Ga0501044_0010640 | 3300049823 | Bacteria | 9981 |
| 428 | Ga0501044_0026582 | 3300049823 | Bacteria | 6126 |
| 429 | Ga0501044_0037145 | 3300049823 | Bacteria | 5092 |
| 430 | Ga0501044_0041293 | 3300049823 | Bacteria | 4801 |
| 431 | Ga0501044_0067685 | 3300049823 | Bacteria | 3638 |
| 432 | Ga0501044_0132641 | 3300049823 | Bacteria | 2484 |
| 433 | Ga0501044_0159757 | 3300049823 | Bacteria | 2231 |
| 434 | Ga0501044_0183117 | 3300049823 | Bacteria | 2061 |
| 435 | Ga0501044_0273230 | 3300049823 | Bacteria | 1625 |
| 436 | Ga0501044_0617211 | 3300049823 | Bacteria | 976 |
| 437 | Ga0501045_0052890 | 3300049824 | Bacteria | 2966 |
| 438 | nmdc:mga03n38_17119_c1 | 3300050490 | Bacteria | 2832 |
| 439 | nmdc:mga03n38_9060_c1 | 3300050490 | Bacteria | 3601 |
| 440 | nmdc:mga00v17_10264_c1 | 3300050491 | Bacteria | 5107 |
| 441 | nmdc:mga06z11_113721_c1 | 3300050494 | Bacteria | 1502 |
| 442 | nmdc:mga06z11_1197_c1 | 3300050494 | Bacteria | 9554 |
| 443 | nmdc:mga06z11_4979_c1 | 3300050494 | Bacteria | 5280 |
| 444 | nmdc:mga04h51_33098_c1 | 3300050495 | Bacteria | 1644 |
| 445 | nmdc:mga04h51_4050_c1 | 3300050495 | Bacteria | 3613 |
| 446 | nmdc:mga04h51_54945_c1 | 3300050495 | Bacteria | 1348 |
| 447 | nmdc:mga05p37_116126_c1 | 3300050507 | Bacteria | 3289 |
| 448 | nmdc:mga05p37_142928_c1 | 3300050507 | Bacteria | 2931 |
| 449 | nmdc:mga05p37_440160_c1 | 3300050507 | Bacteria | 1512 |
| 450 | nmdc:mga09592_166517_c1 | 3300050508 | Bacteria | 1905 |
| 451 | nmdc:mga09592_225425_c1 | 3300050508 | Bacteria | 1624 |
| 452 | nmdc:mga06r32_52085_c1 | 3300050510 | Bacteria | 3919 |
| 453 | nmdc:mga06r32_9052_c1 | 3300050510 | Bacteria | 8972 |
| 454 | nmdc:mga08y16_6160_c1 | 3300050511 | Bacteria | 12584 |
| 455 | nmdc:mga08y16_65653_c1 | 3300050511 | Bacteria | 3788 |
| 456 | nmdc:mga0n895_37493_c1 | 3300050512 | Bacteria | 4690 |
| 457 | nmdc:mga0n895_44158_c1 | 3300050512 | Bacteria | 4346 |
| 458 | nmdc:mga0n895_58068_c1 | 3300050512 | Bacteria | 3815 |
| 459 | nmdc:mga0rr50_9776_c1 | 3300050513 | Bacteria | 6053 |
| 460 | nmdc:mga08x19_177_c1 | 3300050514 | Bacteria | 51482 |
| 461 | nmdc:mga0a205_145950_c1 | 3300050515 | Bacteria | 2266 |
| 462 | Ga0495612_0100093 | 3300053078 | Bacteria | 1234 |
| 463 | Ga0500643_000021 | 3300053087 | Bacteria | 284326 |
| 464 | Ga0500646_0088961 | 3300053090 | Bacteria | 953 |
| 465 | Ga0500556_0000669 | 3300053104 | Bacteria | 21370 |
| 466 | Ga0500595_008735 | 3300053119 | Bacteria | 4123 |
| 467 | Ga0500595_014106 | 3300053119 | Bacteria | 3041 |
| 468 | Ga0500655_003247 | 3300053133 | Bacteria | 2943 |
| 469 | Ga0500573_0000050 | 3300053140 | Bacteria | 95598 |
| 470 | Ga0500616_0067198 | 3300053153 | Bacteria | 1839 |
| 471 | Ga0501084_0004597 | 3300054114 | Bacteria | 11281 |
| 472 | Ga0587101_006305 | 3300059623 | Bacteria | 1355 |
| 473 | Ga0587111_0029957 | 3300060346 | Bacteria | 1105 |
| 474 | Ga0501082_0032180 | 3300060353 | Bacteria | 4523 |
| 475 | Ga0501082_0035117 | 3300060353 | Bacteria | 4321 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025961 | Ga0207712_10253776 | Ga0207712_102537763 | 273 |
| 2 | 3300049579 | Ga0501043_0117579 | Ga0501043_0117579_1254_2075 | 273 |
| 3 | 3300049823 | Ga0501044_0617211 | Ga0501044_0617211_13_837 | 273 |
| 4 | 3300009093 | Ga0105240_10017462 | Ga0105240_1001746210 | 278 |
| 5 | 3300009177 | Ga0105248_10000013 | Ga0105248_1000001331 | 278 |
| 6 | 3300013100 | Ga0157373_10035798 | Ga0157373_100357982 | 278 |
| 7 | 3300013307 | Ga0157372_10206708 | Ga0157372_102067082 | 278 |
| 8 | 3300049574 | Ga0501038_0369603 | Ga0501038_0369603_20_856 | 278 |
| 9 | 3300049581 | Ga0501047_0372396 | Ga0501047_0372396_320_1159 | 278 |
| 10 | 3300049590 | Ga0501074_0177285 | Ga0501074_0177285_157_993 | 278 |
| 11 | 3300010375 | Ga0105239_10031804 | Ga0105239_100318044 | 286 |
| 12 | 3300039438 | Ga0436360_1292018 | Ga0436360_1292018_916_1809 | 286 |
| 13 | iso_pu_bacteria | 2597490356 | 2599101182 | 286 |
| 14 | iso_pu_bacteria | 2846952575 | 2846954098 | 286 |
| 15 | 3300009093 | Ga0105240_10007938 | Ga0105240_100079385 | 288 |
| 16 | 3300009545 | Ga0105237_10227055 | Ga0105237_102270552 | 288 |
| 17 | 3300025913 | Ga0207695_10014294 | Ga0207695_1001429412 | 288 |
| 18 | 3300005345 | Ga0070692_10000181 | Ga0070692_100001814 | 289 |
| 19 | 3300005366 | Ga0070659_100002415 | Ga0070659_1000024157 | 289 |
| 20 | 3300005467 | Ga0070706_100338781 | Ga0070706_1003387811 | 289 |
| 21 | 3300005617 | Ga0068859_100354640 | Ga0068859_1003546402 | 289 |
| 22 | 3300005843 | Ga0068860_100067312 | Ga0068860_1000673122 | 289 |
| 23 | 3300005937 | Ga0081455_10073775 | Ga0081455_100737752 | 289 |
| 24 | 3300006931 | Ga0097620_100354618 | Ga0097620_1003546182 | 289 |
| 25 | 3300025909 | Ga0207705_10000002 | Ga0207705_100000021524 | 289 |
| 26 | 3300025919 | Ga0207657_10000082 | Ga0207657_1000008240 | 289 |
| 27 | 3300025932 | Ga0207690_10008907 | Ga0207690_100089075 | 289 |
| 28 | 3300028381 | Ga0268264_10074136 | Ga0268264_100741362 | 289 |
| 29 | 3300005339 | Ga0070660_100023494 | Ga0070660_1000234944 | 290 |
| 30 | 3300005347 | Ga0070668_100034681 | Ga0070668_1000346812 | 290 |
| 31 | 3300005367 | Ga0070667_100324443 | Ga0070667_1003244431 | 290 |
| 32 | 3300005444 | Ga0070694_100018461 | Ga0070694_1000184613 | 290 |
| 33 | 3300005458 | Ga0070681_10050537 | Ga0070681_100505376 | 290 |
| 34 | 3300005530 | Ga0070679_100029852 | Ga0070679_1000298522 | 290 |
| 35 | 3300005545 | Ga0070695_100063043 | Ga0070695_1000630432 | 290 |
| 36 | 3300005548 | Ga0070665_100163366 | Ga0070665_1001633662 | 290 |
| 37 | 3300005577 | Ga0068857_100107399 | Ga0068857_1001073993 | 290 |
| 38 | 3300005841 | Ga0068863_100170875 | Ga0068863_1001708752 | 290 |
| 39 | 3300005843 | Ga0068860_100370082 | Ga0068860_1003700822 | 290 |
| 40 | 3300005843 | Ga0068860_100474073 | Ga0068860_1004740732 | 290 |
| 41 | 3300006038 | Ga0075365_10022074 | Ga0075365_100220742 | 290 |
| 42 | 3300006038 | Ga0075365_10080516 | Ga0075365_100805162 | 290 |
| 43 | 3300006042 | Ga0075368_10000420 | Ga0075368_100004203 | 290 |
| 44 | 3300006042 | Ga0075368_10062779 | Ga0075368_100627791 | 290 |
| 45 | 3300006048 | Ga0075363_100021962 | Ga0075363_1000219622 | 290 |
| 46 | 3300006048 | Ga0075363_100058165 | Ga0075363_1000581653 | 290 |
| 47 | 3300006178 | Ga0075367_10001232 | Ga0075367_100012324 | 290 |
| 48 | 3300006178 | Ga0075367_10007139 | Ga0075367_100071395 | 290 |
| 49 | 3300006844 | Ga0075428_100164340 | Ga0075428_1001643402 | 290 |
| 50 | 3300006847 | Ga0075431_100112704 | Ga0075431_1001127042 | 290 |
| 51 | 3300006847 | Ga0075431_100429696 | Ga0075431_1004296962 | 290 |
| 52 | 3300006847 | Ga0075431_100452513 | Ga0075431_1004525131 | 290 |
| 53 | 3300006871 | Ga0075434_100026298 | Ga0075434_1000262983 | 290 |
| 54 | 3300006871 | Ga0075434_100039552 | Ga0075434_1000395524 | 290 |
| 55 | 3300006880 | Ga0075429_100235142 | Ga0075429_1002351421 | 290 |
| 56 | 3300009093 | Ga0105240_10423210 | Ga0105240_104232101 | 290 |
| 57 | 3300009094 | Ga0111539_10001024 | Ga0111539_100010243 | 290 |
| 58 | 3300009094 | Ga0111539_10077007 | Ga0111539_100770073 | 290 |
| 59 | 3300009094 | Ga0111539_10482901 | Ga0111539_104829012 | 290 |
| 60 | 3300009101 | Ga0105247_10110351 | Ga0105247_101103512 | 290 |
| 61 | 3300009147 | Ga0114129_10090961 | Ga0114129_100909613 | 290 |
| 62 | 3300009147 | Ga0114129_10188829 | Ga0114129_101888293 | 290 |
| 63 | 3300009147 | Ga0114129_10716751 | Ga0114129_107167512 | 290 |
| 64 | 3300009553 | Ga0105249_10613904 | Ga0105249_106139041 | 290 |
| 65 | 3300013105 | Ga0157369_10009612 | Ga0157369_100096125 | 290 |
| 66 | 3300013297 | Ga0157378_10215752 | Ga0157378_102157523 | 290 |
| 67 | 3300013306 | Ga0163162_10202213 | Ga0163162_102022133 | 290 |
| 68 | 3300013307 | Ga0157372_10327482 | Ga0157372_103274824 | 290 |
| 69 | 3300014325 | Ga0163163_10080595 | Ga0163163_100805953 | 290 |
| 70 | 3300014326 | Ga0157380_10193653 | Ga0157380_101936532 | 290 |
| 71 | 3300020070 | Ga0206356_11052037 | Ga0206356_110520371 | 290 |
| 72 | 3300020082 | Ga0206353_10470198 | Ga0206353_104701981 | 290 |
| 73 | 3300022467 | Ga0224712_10073649 | Ga0224712_100736492 | 290 |
| 74 | 3300025291 | Ga0209675_1002273 | Ga0209675_10022733 | 290 |
| 75 | 3300025900 | Ga0207710_10110168 | Ga0207710_101101681 | 290 |
| 76 | 3300025912 | Ga0207707_10162546 | Ga0207707_101625462 | 290 |
| 77 | 3300025912 | Ga0207707_10339269 | Ga0207707_103392692 | 290 |
| 78 | 3300025913 | Ga0207695_10286978 | Ga0207695_102869781 | 290 |
| 79 | 3300025923 | Ga0207681_10113538 | Ga0207681_101135382 | 290 |
| 80 | 3300025927 | Ga0207687_10433747 | Ga0207687_104337472 | 290 |
| 81 | 3300025936 | Ga0207670_10369711 | Ga0207670_103697111 | 290 |
| 82 | 3300025941 | Ga0207711_10196199 | Ga0207711_101961992 | 290 |
| 83 | 3300025949 | Ga0207667_10285102 | Ga0207667_102851021 | 290 |
| 84 | 3300025961 | Ga0207712_10187465 | Ga0207712_101874651 | 290 |
| 85 | 3300025972 | Ga0207668_10088261 | Ga0207668_100882612 | 290 |
| 86 | 3300025986 | Ga0207658_10435993 | Ga0207658_104359932 | 290 |
| 87 | 3300026075 | Ga0207708_10233717 | Ga0207708_102337172 | 290 |
| 88 | 3300026088 | Ga0207641_10144191 | Ga0207641_101441912 | 290 |
| 89 | 3300026116 | Ga0207674_10051280 | Ga0207674_100512806 | 290 |
| 90 | 3300026118 | Ga0207675_100206678 | Ga0207675_1002066782 | 290 |
| 91 | 3300026118 | Ga0207675_100454884 | Ga0207675_1004548841 | 290 |
| 92 | 3300026118 | Ga0207675_100524300 | Ga0207675_1005243001 | 290 |
| 93 | 3300027866 | Ga0209813_10000849 | Ga0209813_100008497 | 290 |
| 94 | 3300027866 | Ga0209813_10026833 | Ga0209813_100268332 | 290 |
| 95 | 3300027866 | Ga0209813_10046760 | Ga0209813_100467602 | 290 |
| 96 | 3300027907 | Ga0207428_10008580 | Ga0207428_100085801 | 290 |
| 97 | 3300027907 | Ga0207428_10040559 | Ga0207428_100405593 | 290 |
| 98 | 3300031728 | Ga0316578_10104021 | Ga0316578_101040211 | 290 |
| 99 | 3300031728 | Ga0316578_10106425 | Ga0316578_101064251 | 290 |
| 100 | 3300035119 | Ga0373956_0063894 | Ga0373956_0063894_773_1648 | 290 |
| 101 | 3300035725 | Ga0373947_0050955 | Ga0373947_0050955_1028_1921 | 290 |
| 102 | 3300036712 | Ga0316584_0111105 | Ga0316584_0111105_717_1592 | 290 |
| 103 | 3300046472 | Ga0495580_0219541 | Ga0495580_0219541_289_1182 | 290 |
| 104 | 3300046559 | Ga0495667_0119818 | Ga0495667_0119818_470_1360 | 290 |
| 105 | 3300048903 | Ga0496100_0106358 | Ga0496100_0106358_829_1722 | 290 |
| 106 | 3300048904 | Ga0496101_0025013 | Ga0496101_0025013_78_971 | 290 |
| 107 | 3300048905 | Ga0496102_0113603 | Ga0496102_0113603_1150_2043 | 290 |
| 108 | 3300048907 | Ga0496104_0000182 | Ga0496104_0000182_22088_22981 | 290 |
| 109 | 3300048907 | Ga0496104_0014071 | Ga0496104_0014071_5166_6059 | 290 |
| 110 | 3300048908 | Ga0496105_0016358 | Ga0496105_0016358_656_1549 | 290 |
| 111 | 3300048908 | Ga0496105_0041906 | Ga0496105_0041906_1084_1977 | 290 |
| 112 | 3300048909 | Ga0496106_0080844 | Ga0496106_0080844_851_1744 | 290 |
| 113 | 3300048909 | Ga0496106_0086259 | Ga0496106_0086259_500_1393 | 290 |
| 114 | 3300048911 | Ga0496108_0001152 | Ga0496108_0001152_17744_18637 | 290 |
| 115 | 3300048911 | Ga0496108_0114166 | Ga0496108_0114166_743_1636 | 290 |
| 116 | 3300048912 | Ga0496109_0002055 | Ga0496109_0002055_4887_5780 | 290 |
| 117 | 3300048913 | Ga0496110_0008147 | Ga0496110_0008147_2419_3312 | 290 |
| 118 | 3300048913 | Ga0496110_0168370 | Ga0496110_0168370_476_1369 | 290 |
| 119 | 3300048914 | Ga0496111_0051603 | Ga0496111_0051603_1354_2247 | 290 |
| 120 | 3300048914 | Ga0496111_0114699 | Ga0496111_0114699_598_1491 | 290 |
| 121 | 3300048915 | Ga0496112_0015595 | Ga0496112_0015595_5575_6468 | 290 |
| 122 | 3300048915 | Ga0496112_0161537 | Ga0496112_0161537_51_944 | 290 |
| 123 | 3300048915 | Ga0496112_0300985 | Ga0496112_0300985_310_1203 | 290 |
| 124 | 3300048917 | Ga0496114_0046600 | Ga0496114_0046600_1407_2300 | 290 |
| 125 | 3300048918 | Ga0496115_0037499 | Ga0496115_0037499_1997_2890 | 290 |
| 126 | 3300048918 | Ga0496115_0058453 | Ga0496115_0058453_876_1751 | 290 |
| 127 | 3300049571 | Ga0501034_0052322 | Ga0501034_0052322_699_1592 | 290 |
| 128 | 3300049571 | Ga0501034_0067309 | Ga0501034_0067309_1810_2685 | 290 |
| 129 | 3300049574 | Ga0501038_0409106 | Ga0501038_0409106_121_996 | 290 |
| 130 | 3300049582 | Ga0501048_0001040 | Ga0501048_0001040_14563_15453 | 290 |
| 131 | 3300049583 | Ga0501067_0076183 | Ga0501067_0076183_399_1292 | 290 |
| 132 | 3300049744 | Ga0501083_0228870 | Ga0501083_0228870_245_1138 | 290 |
| 133 | 3300049823 | Ga0501044_0026582 | Ga0501044_0026582_1666_2580 | 290 |
| 134 | 3300049823 | Ga0501044_0132641 | Ga0501044_0132641_452_1327 | 290 |
| 135 | 3300049823 | Ga0501044_0183117 | Ga0501044_0183117_721_1596 | 290 |
| 136 | 3300050490 | nmdc:mga03n38_17119_c1 | nmdc:mga03n38_17119_c1_1513_2406 | 290 |
| 137 | 3300050490 | nmdc:mga03n38_9060_c1 | nmdc:mga03n38_9060_c1_2530_3423 | 290 |
| 138 | 3300050491 | nmdc:mga00v17_10264_c1 | nmdc:mga00v17_10264_c1_1069_1962 | 290 |
| 139 | 3300050494 | nmdc:mga06z11_113721_c1 | nmdc:mga06z11_113721_c1_451_1344 | 290 |
| 140 | 3300050494 | nmdc:mga06z11_1197_c1 | nmdc:mga06z11_1197_c1_8340_9233 | 290 |
| 141 | 3300050494 | nmdc:mga06z11_4979_c1 | nmdc:mga06z11_4979_c1_2445_3338 | 290 |
| 142 | 3300050495 | nmdc:mga04h51_33098_c1 | nmdc:mga04h51_33098_c1_271_1164 | 290 |
| 143 | 3300050495 | nmdc:mga04h51_4050_c1 | nmdc:mga04h51_4050_c1_2055_2948 | 290 |
| 144 | 3300050495 | nmdc:mga04h51_54945_c1 | nmdc:mga04h51_54945_c1_326_1219 | 290 |
| 145 | 3300050507 | nmdc:mga05p37_116126_c1 | nmdc:mga05p37_116126_c1_268_1161 | 290 |
| 146 | 3300050507 | nmdc:mga05p37_142928_c1 | nmdc:mga05p37_142928_c1_842_1735 | 290 |
| 147 | 3300050507 | nmdc:mga05p37_440160_c1 | nmdc:mga05p37_440160_c1_164_1057 | 290 |
| 148 | 3300050508 | nmdc:mga09592_166517_c1 | nmdc:mga09592_166517_c1_70_963 | 290 |
| 149 | 3300050508 | nmdc:mga09592_225425_c1 | nmdc:mga09592_225425_c1_591_1484 | 290 |
| 150 | 3300050510 | nmdc:mga06r32_52085_c1 | nmdc:mga06r32_52085_c1_2922_3815 | 290 |
| 151 | 3300050510 | nmdc:mga06r32_9052_c1 | nmdc:mga06r32_9052_c1_4091_4984 | 290 |
| 152 | 3300050511 | nmdc:mga08y16_6160_c1 | nmdc:mga08y16_6160_c1_4254_5147 | 290 |
| 153 | 3300050511 | nmdc:mga08y16_65653_c1 | nmdc:mga08y16_65653_c1_1147_2040 | 290 |
| 154 | 3300050512 | nmdc:mga0n895_37493_c1 | nmdc:mga0n895_37493_c1_735_1628 | 290 |
| 155 | 3300050512 | nmdc:mga0n895_44158_c1 | nmdc:mga0n895_44158_c1_2359_3252 | 290 |
| 156 | 3300050513 | nmdc:mga0rr50_9776_c1 | nmdc:mga0rr50_9776_c1_2235_3128 | 290 |
| 157 | 3300050515 | nmdc:mga0a205_145950_c1 | nmdc:mga0a205_145950_c1_1058_1951 | 290 |
| 158 | 3300053078 | Ga0495612_0100093 | Ga0495612_0100093_128_1018 | 290 |
| 159 | 3300053104 | Ga0500556_0000669 | Ga0500556_0000669_16072_16962 | 290 |
| 160 | 3300053153 | Ga0500616_0067198 | Ga0500616_0067198_421_1314 | 290 |
| 161 | 3300059623 | Ga0587101_006305 | Ga0587101_006305_156_1031 | 290 |
| 162 | 3300060346 | Ga0587111_0029957 | Ga0587111_0029957_99_974 | 290 |
| 163 | 3300031595 | Ga0265313_10004469 | Ga0265313_100044694 | 291 |
| 164 | 3300005937 | Ga0081455_10006404 | Ga0081455_100064042 | 292 |
| 165 | 3300028380 | Ga0268265_10043329 | Ga0268265_100433292 | 292 |
| 166 | 3300025929 | Ga0207664_10229760 | Ga0207664_102297602 | 293 |
| 167 | 3300026142 | Ga0207698_10031680 | Ga0207698_100316802 | 293 |
| 168 | 3300039447 | Ga0436361_0770122 | Ga0436361_0770122_28_915 | 293 |
| 169 | 3300049583 | Ga0501067_0032250 | Ga0501067_0032250_334_1242 | 293 |
| 170 | 3300005331 | Ga0070670_100160842 | Ga0070670_1001608422 | 295 |
| 171 | 3300005331 | Ga0070670_100440120 | Ga0070670_1004401201 | 295 |
| 172 | 3300005547 | Ga0070693_100140416 | Ga0070693_1001404162 | 295 |
| 173 | 3300009098 | Ga0105245_10041140 | Ga0105245_100411402 | 295 |
| 174 | 3300013307 | Ga0157372_10002320 | Ga0157372_1000232014 | 295 |
| 175 | 3300013307 | Ga0157372_10005593 | Ga0157372_100055933 | 295 |
| 176 | 3300021384 | Ga0213876_10000148 | Ga0213876_1000014836 | 295 |
| 177 | 3300025927 | Ga0207687_10030022 | Ga0207687_100300226 | 295 |
| 178 | 3300028577 | Ga0265318_10002134 | Ga0265318_100021344 | 295 |
| 179 | 3300031250 | Ga0265331_10030595 | Ga0265331_100305953 | 295 |
| 180 | 3300031711 | Ga0265314_10006199 | Ga0265314_1000619910 | 295 |
| 181 | 3300039437 | Ga0436365_0897189 | Ga0436365_0897189_255_1145 | 295 |
| 182 | 3300039437 | Ga0436365_1201434 | Ga0436365_1201434_54463_55365 | 295 |
| 183 | 3300045976 | Ga0466967_0345885 | Ga0466967_0345885_435_1325 | 295 |
| 184 | 3300047319 | Ga0495674_0178017 | Ga0495674_0178017_668_1561 | 295 |
| 185 | 3300049569 | Ga0501032_0079108 | Ga0501032_0079108_1187_2092 | 295 |
| 186 | 3300049570 | Ga0501033_0192460 | Ga0501033_0192460_368_1258 | 295 |
| 187 | 3300049571 | Ga0501034_0119139 | Ga0501034_0119139_401_1306 | 295 |
| 188 | 3300049571 | Ga0501034_0288055 | Ga0501034_0288055_242_1207 | 295 |
| 189 | 3300049581 | Ga0501047_0003459 | Ga0501047_0003459_2660_3550 | 295 |
| 190 | 3300049586 | Ga0501070_0027115 | Ga0501070_0027115_1181_2086 | 295 |
| 191 | 3300049742 | Ga0501080_0010288 | Ga0501080_0010288_2963_3853 | 295 |
| 192 | 3300049822 | Ga0501035_0024455 | Ga0501035_0024455_3414_4304 | 295 |
| 193 | 3300049822 | Ga0501035_0231837 | Ga0501035_0231837_260_1186 | 295 |
| 194 | 3300049823 | Ga0501044_0037145 | Ga0501044_0037145_1206_2096 | 295 |
| 195 | 3300003320 | rootH2_10000793 | rootH2_100007938 | 296 |
| 196 | 3300005327 | Ga0070658_10066655 | Ga0070658_100666552 | 296 |
| 197 | 3300005327 | Ga0070658_10100360 | Ga0070658_101003603 | 296 |
| 198 | 3300005327 | Ga0070658_10123427 | Ga0070658_101234272 | 296 |
| 199 | 3300005327 | Ga0070658_10123767 | Ga0070658_101237672 | 296 |
| 200 | 3300005327 | Ga0070658_10135106 | Ga0070658_101351062 | 296 |
| 201 | 3300005327 | Ga0070658_10156822 | Ga0070658_101568222 | 296 |
| 202 | 3300005327 | Ga0070658_10291509 | Ga0070658_102915092 | 296 |
| 203 | 3300005329 | Ga0070683_100418761 | Ga0070683_1004187612 | 296 |
| 204 | 3300005335 | Ga0070666_10005773 | Ga0070666_100057734 | 296 |
| 205 | 3300005336 | Ga0070680_100006103 | Ga0070680_10000610310 | 296 |
| 206 | 3300005336 | Ga0070680_100297453 | Ga0070680_1002974532 | 296 |
| 207 | 3300005338 | Ga0068868_100318500 | Ga0068868_1003185002 | 296 |
| 208 | 3300005338 | Ga0068868_100451170 | Ga0068868_1004511701 | 296 |
| 209 | 3300005339 | Ga0070660_100008390 | Ga0070660_1000083906 | 296 |
| 210 | 3300005339 | Ga0070660_100025731 | Ga0070660_1000257312 | 296 |
| 211 | 3300005339 | Ga0070660_100146908 | Ga0070660_1001469082 | 296 |
| 212 | 3300005341 | Ga0070691_10003719 | Ga0070691_100037192 | 296 |
| 213 | 3300005344 | Ga0070661_100096241 | Ga0070661_1000962412 | 296 |
| 214 | 3300005355 | Ga0070671_100181941 | Ga0070671_1001819412 | 296 |
| 215 | 3300005367 | Ga0070667_100057074 | Ga0070667_1000570742 | 296 |
| 216 | 3300005434 | Ga0070709_10000433 | Ga0070709_100004333 | 296 |
| 217 | 3300005435 | Ga0070714_100114529 | Ga0070714_1001145292 | 296 |
| 218 | 3300005436 | Ga0070713_100000012 | Ga0070713_10000001287 | 296 |
| 219 | 3300005437 | Ga0070710_10141236 | Ga0070710_101412361 | 296 |
| 220 | 3300005439 | Ga0070711_100175428 | Ga0070711_1001754282 | 296 |
| 221 | 3300005455 | Ga0070663_100223248 | Ga0070663_1002232482 | 296 |
| 222 | 3300005456 | Ga0070678_100007105 | Ga0070678_1000071055 | 296 |
| 223 | 3300005456 | Ga0070678_100023402 | Ga0070678_1000234023 | 296 |
| 224 | 3300005458 | Ga0070681_10000074 | Ga0070681_1000007434 | 296 |
| 225 | 3300005458 | Ga0070681_10147771 | Ga0070681_101477713 | 296 |
| 226 | 3300005530 | Ga0070679_100000961 | Ga0070679_10000096112 | 296 |
| 227 | 3300005530 | Ga0070679_100049640 | Ga0070679_1000496402 | 296 |
| 228 | 3300005535 | Ga0070684_100184224 | Ga0070684_1001842242 | 296 |
| 229 | 3300005535 | Ga0070684_100390870 | Ga0070684_1003908701 | 296 |
| 230 | 3300005539 | Ga0068853_100000746 | Ga0068853_1000007462 | 296 |
| 231 | 3300005539 | Ga0068853_100136291 | Ga0068853_1001362912 | 296 |
| 232 | 3300005539 | Ga0068853_100268974 | Ga0068853_1002689742 | 296 |
| 233 | 3300005539 | Ga0068853_100440300 | Ga0068853_1004403001 | 296 |
| 234 | 3300005548 | Ga0070665_100002469 | Ga0070665_1000024695 | 296 |
| 235 | 3300005548 | Ga0070665_100029434 | Ga0070665_1000294344 | 296 |
| 236 | 3300005548 | Ga0070665_100041895 | Ga0070665_1000418954 | 296 |
| 237 | 3300005563 | Ga0068855_100026640 | Ga0068855_1000266407 | 296 |
| 238 | 3300005563 | Ga0068855_100046246 | Ga0068855_1000462462 | 296 |
| 239 | 3300005578 | Ga0068854_100044954 | Ga0068854_1000449543 | 296 |
| 240 | 3300005614 | Ga0068856_100001151 | Ga0068856_10000115129 | 296 |
| 241 | 3300005614 | Ga0068856_100068435 | Ga0068856_1000684353 | 296 |
| 242 | 3300005616 | Ga0068852_100209507 | Ga0068852_1002095072 | 296 |
| 243 | 3300005618 | Ga0068864_100146445 | Ga0068864_1001464452 | 296 |
| 244 | 3300005719 | Ga0068861_100127439 | Ga0068861_1001274392 | 296 |
| 245 | 3300005842 | Ga0068858_100027825 | Ga0068858_1000278252 | 296 |
| 246 | 3300005843 | Ga0068860_100159045 | Ga0068860_1001590452 | 296 |
| 247 | 3300005844 | Ga0068862_100116858 | Ga0068862_1001168583 | 296 |
| 248 | 3300006175 | Ga0070712_100000098 | Ga0070712_10000009828 | 296 |
| 249 | 3300006237 | Ga0097621_100001637 | Ga0097621_10000163717 | 296 |
| 250 | 3300006237 | Ga0097621_100035828 | Ga0097621_1000358286 | 296 |
| 251 | 3300006237 | Ga0097621_100057984 | Ga0097621_1000579843 | 296 |
| 252 | 3300006237 | Ga0097621_100094427 | Ga0097621_1000944271 | 296 |
| 253 | 3300006237 | Ga0097621_100339153 | Ga0097621_1003391532 | 296 |
| 254 | 3300006358 | Ga0068871_100006532 | Ga0068871_1000065325 | 296 |
| 255 | 3300006358 | Ga0068871_100034479 | Ga0068871_1000344792 | 296 |
| 256 | 3300006358 | Ga0068871_100092688 | Ga0068871_1000926881 | 296 |
| 257 | 3300006358 | Ga0068871_100098128 | Ga0068871_1000981284 | 296 |
| 258 | 3300006871 | Ga0075434_100052941 | Ga0075434_1000529412 | 296 |
| 259 | 3300006881 | Ga0068865_100009417 | Ga0068865_1000094172 | 296 |
| 260 | 3300006914 | Ga0075436_100000416 | Ga0075436_1000004164 | 296 |
| 261 | 3300009093 | Ga0105240_10065129 | Ga0105240_100651292 | 296 |
| 262 | 3300009093 | Ga0105240_10157991 | Ga0105240_101579912 | 296 |
| 263 | 3300009093 | Ga0105240_10159139 | Ga0105240_101591391 | 296 |
| 264 | 3300009093 | Ga0105240_10223389 | Ga0105240_102233891 | 296 |
| 265 | 3300009093 | Ga0105240_10457865 | Ga0105240_104578651 | 296 |
| 266 | 3300009098 | Ga0105245_10047517 | Ga0105245_100475172 | 296 |
| 267 | 3300009098 | Ga0105245_10169570 | Ga0105245_101695702 | 296 |
| 268 | 3300009098 | Ga0105245_10690265 | Ga0105245_106902651 | 296 |
| 269 | 3300009148 | Ga0105243_10006489 | Ga0105243_100064892 | 296 |
| 270 | 3300009148 | Ga0105243_10226090 | Ga0105243_102260902 | 296 |
| 271 | 3300009174 | Ga0105241_10009944 | Ga0105241_100099444 | 296 |
| 272 | 3300009174 | Ga0105241_10025069 | Ga0105241_100250692 | 296 |
| 273 | 3300009174 | Ga0105241_10386121 | Ga0105241_103861211 | 296 |
| 274 | 3300009177 | Ga0105248_10700956 | Ga0105248_107009561 | 296 |
| 275 | 3300009545 | Ga0105237_10077546 | Ga0105237_100775463 | 296 |
| 276 | 3300009545 | Ga0105237_10304701 | Ga0105237_103047012 | 296 |
| 277 | 3300009545 | Ga0105237_10313190 | Ga0105237_103131902 | 296 |
| 278 | 3300009551 | Ga0105238_10011343 | Ga0105238_100113434 | 296 |
| 279 | 3300009551 | Ga0105238_10071592 | Ga0105238_100715922 | 296 |
| 280 | 3300009551 | Ga0105238_10149922 | Ga0105238_101499222 | 296 |
| 281 | 3300010375 | Ga0105239_10006956 | Ga0105239_100069562 | 296 |
| 282 | 3300010375 | Ga0105239_10095539 | Ga0105239_100955392 | 296 |
| 283 | 3300011119 | Ga0105246_10004442 | Ga0105246_100044426 | 296 |
| 284 | 3300011119 | Ga0105246_10200964 | Ga0105246_102009642 | 296 |
| 285 | 3300013104 | Ga0157370_10081034 | Ga0157370_100810342 | 296 |
| 286 | 3300013105 | Ga0157369_10027642 | Ga0157369_100276424 | 296 |
| 287 | 3300013105 | Ga0157369_10160987 | Ga0157369_101609872 | 296 |
| 288 | 3300013296 | Ga0157374_10110854 | Ga0157374_101108542 | 296 |
| 289 | 3300013297 | Ga0157378_10004593 | Ga0157378_1000459310 | 296 |
| 290 | 3300013297 | Ga0157378_10060405 | Ga0157378_100604055 | 296 |
| 291 | 3300013297 | Ga0157378_10205272 | Ga0157378_102052722 | 296 |
| 292 | 3300013297 | Ga0157378_10313067 | Ga0157378_103130672 | 296 |
| 293 | 3300013306 | Ga0163162_10037320 | Ga0163162_100373206 | 296 |
| 294 | 3300013306 | Ga0163162_10058923 | Ga0163162_100589232 | 296 |
| 295 | 3300013307 | Ga0157372_10365686 | Ga0157372_103656862 | 296 |
| 296 | 3300013307 | Ga0157372_10852312 | Ga0157372_108523121 | 296 |
| 297 | 3300013308 | Ga0157375_10035908 | Ga0157375_100359084 | 296 |
| 298 | 3300013308 | Ga0157375_10386578 | Ga0157375_103865782 | 296 |
| 299 | 3300014325 | Ga0163163_10002055 | Ga0163163_100020555 | 296 |
| 300 | 3300014325 | Ga0163163_10339810 | Ga0163163_103398103 | 296 |
| 301 | 3300014326 | Ga0157380_10224781 | Ga0157380_102247812 | 296 |
| 302 | 3300014968 | Ga0157379_10005750 | Ga0157379_100057506 | 296 |
| 303 | 3300014968 | Ga0157379_10369620 | Ga0157379_103696201 | 296 |
| 304 | 3300014969 | Ga0157376_10014691 | Ga0157376_100146915 | 296 |
| 305 | 3300017792 | Ga0163161_10013801 | Ga0163161_100138015 | 296 |
| 306 | 3300025231 | Ga0207427_108016 | Ga0207427_1080161 | 296 |
| 307 | 3300025261 | Ga0209233_1000013 | Ga0209233_1000013686 | 296 |
| 308 | 3300025898 | Ga0207692_10051680 | Ga0207692_100516802 | 296 |
| 309 | 3300025899 | Ga0207642_10112753 | Ga0207642_101127532 | 296 |
| 310 | 3300025906 | Ga0207699_10000227 | Ga0207699_1000022712 | 296 |
| 311 | 3300025909 | Ga0207705_10046612 | Ga0207705_100466123 | 296 |
| 312 | 3300025909 | Ga0207705_10078884 | Ga0207705_100788842 | 296 |
| 313 | 3300025909 | Ga0207705_10111281 | Ga0207705_101112812 | 296 |
| 314 | 3300025911 | Ga0207654_10005899 | Ga0207654_100058997 | 296 |
| 315 | 3300025912 | Ga0207707_10000079 | Ga0207707_1000007957 | 296 |
| 316 | 3300025912 | Ga0207707_10010654 | Ga0207707_100106544 | 296 |
| 317 | 3300025913 | Ga0207695_10025423 | Ga0207695_100254237 | 296 |
| 318 | 3300025913 | Ga0207695_10067132 | Ga0207695_100671322 | 296 |
| 319 | 3300025913 | Ga0207695_10106835 | Ga0207695_101068355 | 296 |
| 320 | 3300025913 | Ga0207695_10116014 | Ga0207695_101160144 | 296 |
| 321 | 3300025913 | Ga0207695_10226871 | Ga0207695_102268712 | 296 |
| 322 | 3300025913 | Ga0207695_10541449 | Ga0207695_105414491 | 296 |
| 323 | 3300025915 | Ga0207693_10000324 | Ga0207693_1000032419 | 296 |
| 324 | 3300025917 | Ga0207660_10001281 | Ga0207660_1000128111 | 296 |
| 325 | 3300025917 | Ga0207660_10356126 | Ga0207660_103561262 | 296 |
| 326 | 3300025919 | Ga0207657_10009154 | Ga0207657_1000915410 | 296 |
| 327 | 3300025919 | Ga0207657_10019479 | Ga0207657_100194792 | 296 |
| 328 | 3300025921 | Ga0207652_10000931 | Ga0207652_1000093114 | 296 |
| 329 | 3300025921 | Ga0207652_10006563 | Ga0207652_100065634 | 296 |
| 330 | 3300025921 | Ga0207652_10097001 | Ga0207652_100970012 | 296 |
| 331 | 3300025924 | Ga0207694_10012988 | Ga0207694_100129886 | 296 |
| 332 | 3300025924 | Ga0207694_10038079 | Ga0207694_100380792 | 296 |
| 333 | 3300025927 | Ga0207687_10067258 | Ga0207687_100672582 | 296 |
| 334 | 3300025927 | Ga0207687_10153399 | Ga0207687_101533992 | 296 |
| 335 | 3300025928 | Ga0207700_10000058 | Ga0207700_100000582 | 296 |
| 336 | 3300025929 | Ga0207664_10095185 | Ga0207664_100951852 | 296 |
| 337 | 3300025935 | Ga0207709_10189540 | Ga0207709_101895402 | 296 |
| 338 | 3300025938 | Ga0207704_10149315 | Ga0207704_101493152 | 296 |
| 339 | 3300025941 | Ga0207711_10000003 | Ga0207711_1000000331 | 296 |
| 340 | 3300025941 | Ga0207711_10110315 | Ga0207711_101103151 | 296 |
| 341 | 3300025941 | Ga0207711_10331946 | Ga0207711_103319462 | 296 |
| 342 | 3300025942 | Ga0207689_10059018 | Ga0207689_100590181 | 296 |
| 343 | 3300025944 | Ga0207661_10162896 | Ga0207661_101628963 | 296 |
| 344 | 3300025944 | Ga0207661_10355610 | Ga0207661_103556102 | 296 |
| 345 | 3300025949 | Ga0207667_10007941 | Ga0207667_100079417 | 296 |
| 346 | 3300025949 | Ga0207667_10054984 | Ga0207667_100549844 | 296 |
| 347 | 3300025949 | Ga0207667_10165545 | Ga0207667_101655452 | 296 |
| 348 | 3300025986 | Ga0207658_10190689 | Ga0207658_101906893 | 296 |
| 349 | 3300026023 | Ga0207677_10021131 | Ga0207677_100211312 | 296 |
| 350 | 3300026023 | Ga0207677_10264046 | Ga0207677_102640462 | 296 |
| 351 | 3300026035 | Ga0207703_10031629 | Ga0207703_100316292 | 296 |
| 352 | 3300026041 | Ga0207639_10085468 | Ga0207639_100854684 | 296 |
| 353 | 3300026041 | Ga0207639_10109722 | Ga0207639_101097222 | 296 |
| 354 | 3300026078 | Ga0207702_10002311 | Ga0207702_1000231110 | 296 |
| 355 | 3300026078 | Ga0207702_10486424 | Ga0207702_104864242 | 296 |
| 356 | 3300026089 | Ga0207648_10015012 | Ga0207648_100150128 | 296 |
| 357 | 3300026089 | Ga0207648_10037335 | Ga0207648_100373354 | 296 |
| 358 | 3300026116 | Ga0207674_10114849 | Ga0207674_101148492 | 296 |
| 359 | 3300026121 | Ga0207683_10014768 | Ga0207683_100147684 | 296 |
| 360 | 3300026142 | Ga0207698_10127875 | Ga0207698_101278752 | 296 |
| 361 | 3300028379 | Ga0268266_10000871 | Ga0268266_1000087121 | 296 |
| 362 | 3300028379 | Ga0268266_10015781 | Ga0268266_100157815 | 296 |
| 363 | 3300028379 | Ga0268266_10020164 | Ga0268266_100201643 | 296 |
| 364 | 3300028379 | Ga0268266_10041753 | Ga0268266_100417534 | 296 |
| 365 | 3300028380 | Ga0268265_10142204 | Ga0268265_101422042 | 296 |
| 366 | 3300028381 | Ga0268264_10165562 | Ga0268264_101655622 | 296 |
| 367 | 3300028577 | Ga0265318_10000348 | Ga0265318_1000034810 | 296 |
| 368 | 3300028800 | Ga0265338_10000017 | Ga0265338_10000017216 | 296 |
| 369 | 3300028800 | Ga0265338_10003940 | Ga0265338_100039406 | 296 |
| 370 | 3300028800 | Ga0265338_10054623 | Ga0265338_100546232 | 296 |
| 371 | 3300028800 | Ga0265338_10429915 | Ga0265338_104299151 | 296 |
| 372 | 3300031235 | Ga0265330_10051406 | Ga0265330_100514061 | 296 |
| 373 | 3300031238 | Ga0265332_10013596 | Ga0265332_100135962 | 296 |
| 374 | 3300031240 | Ga0265320_10014946 | Ga0265320_100149462 | 296 |
| 375 | 3300031241 | Ga0265325_10000016 | Ga0265325_1000001636 | 296 |
| 376 | 3300031241 | Ga0265325_10001479 | Ga0265325_1000147916 | 296 |
| 377 | 3300031247 | Ga0265340_10018554 | Ga0265340_100185543 | 296 |
| 378 | 3300031249 | Ga0265339_10019941 | Ga0265339_100199415 | 296 |
| 379 | 3300031249 | Ga0265339_10054517 | Ga0265339_100545172 | 296 |
| 380 | 3300031250 | Ga0265331_10003090 | Ga0265331_1000309012 | 296 |
| 381 | 3300031250 | Ga0265331_10029318 | Ga0265331_100293184 | 296 |
| 382 | 3300031344 | Ga0265316_10015577 | Ga0265316_100155773 | 296 |
| 383 | 3300031344 | Ga0265316_10068505 | Ga0265316_100685052 | 296 |
| 384 | 3300031344 | Ga0265316_10201820 | Ga0265316_102018202 | 296 |
| 385 | 3300031595 | Ga0265313_10007428 | Ga0265313_100074286 | 296 |
| 386 | 3300031595 | Ga0265313_10008914 | Ga0265313_100089147 | 296 |
| 387 | 3300031711 | Ga0265314_10000635 | Ga0265314_1000063539 | 296 |
| 388 | 3300031711 | Ga0265314_10009184 | Ga0265314_100091845 | 296 |
| 389 | 3300031711 | Ga0265314_10018336 | Ga0265314_100183364 | 296 |
| 390 | 3300031711 | Ga0265314_10049029 | Ga0265314_100490291 | 296 |
| 391 | 3300031712 | Ga0265342_10014649 | Ga0265342_100146494 | 296 |
| 392 | 3300031712 | Ga0265342_10026721 | Ga0265342_100267214 | 296 |
| 393 | 3300031712 | Ga0265342_10032819 | Ga0265342_100328195 | 296 |
| 394 | 3300031730 | Ga0307516_10045075 | Ga0307516_100450752 | 296 |
| 395 | 3300037466 | Ga0395898_0007832 | Ga0395898_0007832_3572_4465 | 296 |
| 396 | 3300039438 | Ga0436360_1147519 | Ga0436360_1147519_361_1254 | 296 |
| 397 | 3300044842 | Ga0466957_0165772 | Ga0466957_0165772_180_1073 | 296 |
| 398 | 3300046455 | Ga0495603_0039840 | Ga0495603_0039840_905_1882 | 296 |
| 399 | 3300046524 | Ga0495648_0119691 | Ga0495648_0119691_377_1270 | 296 |
| 400 | 3300046536 | Ga0495587_0013611 | Ga0495587_0013611_2827_3720 | 296 |
| 401 | 3300046557 | Ga0495622_0001758 | Ga0495622_0001758_5478_6371 | 296 |
| 402 | 3300046648 | Ga0495611_0031308 | Ga0495611_0031308_544_1437 | 296 |
| 403 | 3300047470 | Ga0495681_0032695 | Ga0495681_0032695_134_1027 | 296 |
| 404 | 3300048909 | Ga0496106_0164221 | Ga0496106_0164221_310_1203 | 296 |
| 405 | 3300048924 | Ga0496121_0001676 | Ga0496121_0001676_29044_29937 | 296 |
| 406 | 3300048929 | Ga0496126_0000525 | Ga0496126_0000525_697_1590 | 296 |
| 407 | 3300048929 | Ga0496126_0304422 | Ga0496126_0304422_283_1179 | 296 |
| 408 | 3300049460 | Ga0495682_0001726 | Ga0495682_0001726_4680_5579 | 296 |
| 409 | 3300049460 | Ga0495682_0062492 | Ga0495682_0062492_99_992 | 296 |
| 410 | 3300049569 | Ga0501032_0073296 | Ga0501032_0073296_993_1883 | 296 |
| 411 | 3300049569 | Ga0501032_0109298 | Ga0501032_0109298_290_1192 | 296 |
| 412 | 3300049570 | Ga0501033_0041703 | Ga0501033_0041703_1833_2735 | 296 |
| 413 | 3300049570 | Ga0501033_0060020 | Ga0501033_0060020_1825_2715 | 296 |
| 414 | 3300049570 | Ga0501033_0112225 | Ga0501033_0112225_151_1041 | 296 |
| 415 | 3300049571 | Ga0501034_0008131 | Ga0501034_0008131_5576_6478 | 296 |
| 416 | 3300049572 | Ga0501036_0005095 | Ga0501036_0005095_3152_4054 | 296 |
| 417 | 3300049572 | Ga0501036_0041808 | Ga0501036_0041808_819_1727 | 296 |
| 418 | 3300049572 | Ga0501036_0062114 | Ga0501036_0062114_40_942 | 296 |
| 419 | 3300049573 | Ga0501037_0005918 | Ga0501037_0005918_1038_1940 | 296 |
| 420 | 3300049573 | Ga0501037_0036213 | Ga0501037_0036213_1158_2066 | 296 |
| 421 | 3300049573 | Ga0501037_0046307 | Ga0501037_0046307_642_1532 | 296 |
| 422 | 3300049573 | Ga0501037_0143535 | Ga0501037_0143535_659_1549 | 296 |
| 423 | 3300049574 | Ga0501038_0083378 | Ga0501038_0083378_575_1465 | 296 |
| 424 | 3300049574 | Ga0501038_0355806 | Ga0501038_0355806_206_1108 | 296 |
| 425 | 3300049575 | Ga0501039_0017479 | Ga0501039_0017479_1792_2694 | 296 |
| 426 | 3300049575 | Ga0501039_0313724 | Ga0501039_0313724_53_955 | 296 |
| 427 | 3300049579 | Ga0501043_0064752 | Ga0501043_0064752_33_923 | 296 |
| 428 | 3300049579 | Ga0501043_0092452 | Ga0501043_0092452_491_1393 | 296 |
| 429 | 3300049579 | Ga0501043_0107749 | Ga0501043_0107749_179_1081 | 296 |
| 430 | 3300049580 | Ga0501046_0036137 | Ga0501046_0036137_1965_2867 | 296 |
| 431 | 3300049581 | Ga0501047_0048550 | Ga0501047_0048550_1725_2618 | 296 |
| 432 | 3300049581 | Ga0501047_0059207 | Ga0501047_0059207_35_943 | 296 |
| 433 | 3300049581 | Ga0501047_0093667 | Ga0501047_0093667_303_1193 | 296 |
| 434 | 3300049581 | Ga0501047_0108790 | Ga0501047_0108790_986_1888 | 296 |
| 435 | 3300049581 | Ga0501047_0191759 | Ga0501047_0191759_130_1023 | 296 |
| 436 | 3300049581 | Ga0501047_0281474 | Ga0501047_0281474_304_1233 | 296 |
| 437 | 3300049581 | Ga0501047_0492337 | Ga0501047_0492337_96_989 | 296 |
| 438 | 3300049582 | Ga0501048_0006804 | Ga0501048_0006804_6284_7186 | 296 |
| 439 | 3300049582 | Ga0501048_0066582 | Ga0501048_0066582_167_1069 | 296 |
| 440 | 3300049583 | Ga0501067_0002358 | Ga0501067_0002358_6668_7570 | 296 |
| 441 | 3300049584 | Ga0501068_0026074 | Ga0501068_0026074_1042_1944 | 296 |
| 442 | 3300049586 | Ga0501070_0000242 | Ga0501070_0000242_38086_38976 | 296 |
| 443 | 3300049587 | Ga0501071_0117478 | Ga0501071_0117478_121_1023 | 296 |
| 444 | 3300049588 | Ga0501072_0063690 | Ga0501072_0063690_1007_1909 | 296 |
| 445 | 3300049589 | Ga0501073_0025346 | Ga0501073_0025346_2150_3043 | 296 |
| 446 | 3300049589 | Ga0501073_0043803 | Ga0501073_0043803_293_1195 | 296 |
| 447 | 3300049590 | Ga0501074_0002413 | Ga0501074_0002413_2969_3871 | 296 |
| 448 | 3300049741 | Ga0501079_0001660 | Ga0501079_0001660_6328_7230 | 296 |
| 449 | 3300049742 | Ga0501080_0005087 | Ga0501080_0005087_8078_8968 | 296 |
| 450 | 3300049742 | Ga0501080_0147177 | Ga0501080_0147177_983_1885 | 296 |
| 451 | 3300049742 | Ga0501080_0397460 | Ga0501080_0397460_176_1078 | 296 |
| 452 | 3300049744 | Ga0501083_0016832 | Ga0501083_0016832_2808_3701 | 296 |
| 453 | 3300049744 | Ga0501083_0016948 | Ga0501083_0016948_1229_2131 | 296 |
| 454 | 3300049822 | Ga0501035_0002988 | Ga0501035_0002988_12193_13083 | 296 |
| 455 | 3300049822 | Ga0501035_0014644 | Ga0501035_0014644_4996_5910 | 296 |
| 456 | 3300049822 | Ga0501035_0052374 | Ga0501035_0052374_1637_2539 | 296 |
| 457 | 3300049822 | Ga0501035_0100381 | Ga0501035_0100381_599_1588 | 296 |
| 458 | 3300049822 | Ga0501035_0183232 | Ga0501035_0183232_870_1763 | 296 |
| 459 | 3300049822 | Ga0501035_0331700 | Ga0501035_0331700_126_1016 | 296 |
| 460 | 3300049823 | Ga0501044_0001386 | Ga0501044_0001386_8328_9218 | 296 |
| 461 | 3300049823 | Ga0501044_0010640 | Ga0501044_0010640_8672_9562 | 296 |
| 462 | 3300049823 | Ga0501044_0041293 | Ga0501044_0041293_1482_2375 | 296 |
| 463 | 3300049823 | Ga0501044_0067685 | Ga0501044_0067685_2165_3055 | 296 |
| 464 | 3300049823 | Ga0501044_0159757 | Ga0501044_0159757_556_1470 | 296 |
| 465 | 3300049823 | Ga0501044_0273230 | Ga0501044_0273230_106_1008 | 296 |
| 466 | 3300049824 | Ga0501045_0052890 | Ga0501045_0052890_1091_1993 | 296 |
| 467 | 3300050512 | nmdc:mga0n895_58068_c1 | nmdc:mga0n895_58068_c1_1196_2089 | 296 |
| 468 | 3300050514 | nmdc:mga08x19_177_c1 | nmdc:mga08x19_177_c1_47592_48485 | 296 |
| 469 | 3300053087 | Ga0500643_000021 | Ga0500643_000021_16077_16970 | 296 |
| 470 | 3300053090 | Ga0500646_0088961 | Ga0500646_0088961_46_939 | 296 |
| 471 | 3300053119 | Ga0500595_008735 | Ga0500595_008735_1711_2604 | 296 |
| 472 | 3300053119 | Ga0500595_014106 | Ga0500595_014106_1252_2145 | 296 |
| 473 | 3300053133 | Ga0500655_003247 | Ga0500655_003247_946_1845 | 296 |
| 474 | 3300053140 | Ga0500573_0000050 | Ga0500573_0000050_15574_16467 | 296 |
| 475 | 3300054114 | Ga0501084_0004597 | Ga0501084_0004597_1747_2649 | 296 |
| 476 | 3300060353 | Ga0501082_0032180 | Ga0501082_0032180_1919_2821 | 296 |
| 477 | 3300060353 | Ga0501082_0035117 | Ga0501082_0035117_37_930 | 296 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3si9-assembly1.cif.gz_C | crystal structure of dihydrodipicolinate synthase from bartonella henselae | 0.9841 | 7 | 296 |
| 6xgs-assembly1.cif.gz_D | crystal structure of dihydrodipicolinate synthase (dhdps) from brucella suis 1330 | 0.9838 | 7 | 296 |
| 2rfg-assembly1.cif.gz_D | crystal structure of dihydrodipicolinate synthase from hahella chejuensis at 1.5a resolution | 0.9834 | 9 | 291 |
| 4i7u-assembly1.cif.gz_A | dihydrodipicolinate synthase of agrobacterium tumefaciens | 0.9806 | 8 | 296 |
| 3flu-assembly1.cif.gz_B | crystal structure of dihydrodipicolinate synthase from the pathogen neisseria meningitidis | 0.98 | 8 | 296 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2rfgB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9828 | 9 | 291 | 3.20.20.70 |
| 6nvaA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9742 | 6 | 296 | 3.20.20.70 |
| 2yxgD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9713 | 8 | 296 | 3.20.20.70 |
| 2yxgD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.968 | 8 | 296 | 3.20.20.70 |
| 3a5fA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9672 | 9 | 296 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520XND3-F1-model_v4 | deleted | 0.9891 | 145 | 296 |
|
| AF-A0A3M1JGV6-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate synthase | 0.9873 | 155 | 296 |
GO:0005829
GO:0008840 |
| AF-A0A6A5KX22-F1-model_v4 | deleted | 0.9871 | 3 | 296 |
|
| AF-A0A520RXY2-F1-model_v4 | Dihydrodipicolinate synthase | 0.9868 | 203 | 296 |
GO:0005829
GO:0008840 |
| AF-A0A7I0J6M6-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate synthase | 0.9867 | 186 | 296 |
GO:0005829
GO:0008840 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar