F451790

General Info

Members Datasets Scaffolds Average Seq Length
477 290 955 187

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0439152|Ga0501047_0439152_155_832
Length 225
Sequence MRVTHGVRGSLCAARVTVQPLPSACIGGRVPDPQARERNVLITHDTRCALDTVVDLVNTAPEDDSAPDGLADVPALAEFVRTHDMSDVGVLSEFDLSAVRRIRSRFAGIFAATDPRAAAGMINELVAGAGTTPRLTDHDGYDWHVHYFAPGASVADHLAADCGMALAFFVVAGEQERLRRCEAPDCRRVFVDLSRNRSRRYCDSRTCGNRLHVAAYRARRKEAAG

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
26 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
27 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
28 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
30 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
31 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
32 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
34 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
35 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
36 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
37 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
38 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
39 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
40 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
41 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
42 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
43 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
44 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
45 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
46 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
47 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
48 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
49 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
50 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
51 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
52 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
53 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
54 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
55 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
56 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
57 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
58 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
59 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
60 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
61 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
62 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
63 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
64 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
65 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
66 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
67 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
68 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
69 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
70 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
82 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
83 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
86 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
89 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
90 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
91 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
92 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
93 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
94 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
95 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
96 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
97 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
98 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
99 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
100 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
101 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
102 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
110 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
111 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
112 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
113 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
114 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
115 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
118 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
121 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
122 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
123 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
132 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
142 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
143 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
152 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
155 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
190 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
196 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
199 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
200 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
201 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
202 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
203 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
204 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
205 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
207 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
208 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
209 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
210 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
211 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
212 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
213 2643221548 Streptomyces sp. Root55 Isolate Unclassified
214 2643221578 Streptomyces sp. Root63 Isolate Unclassified
215 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
216 2643221647 Streptomyces sp. Root369 Isolate Unclassified
217 2643221670 Streptomyces sp. Root431 Isolate Unclassified
218 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
219 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
220 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
221 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
222 2643221714 Streptomyces sp. Root264 Isolate Unclassified
223 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
224 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
225 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
226 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
227 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
228 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
229 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
230 2808606448 Streptomyces sp. 193411 Isolate Unclassified
231 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
232 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
233 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
234 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
235 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
236 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
237 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
238 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
239 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
240 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
241 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
242 2862574272 Streptomyces sp. AcE210 Isolate Nodule
243 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
244 2867428634 Streptomyces sp. RP5T Isolate Unclassified
245 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
246 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
247 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
248 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
249 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
250 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
251 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
252 2891562705 Microbispora tritici MT50 Isolate Unclassified
253 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
254 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
255 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
256 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
257 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
258 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
259 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
260 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
261 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
262 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
263 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
264 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
265 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
266 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
267 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
268 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
269 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
270 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
271 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
272 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
273 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
274 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
275 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
276 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
277 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
278 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
279 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
280 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
281 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
282 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
283 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
284 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
285 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
286 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
287 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
288 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
289 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
290 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.97
Metatranscriptomes 0.42
Isolates 17.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.94
Nodule 0.63
Rhizoplane 1.47
Rhizosphere 79.66
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0439152 3300049581 Bacteria 1135
2 JGI24739J22299_10025198 3300001989 Bacteria 2092
3 JGI24737J22298_10022660 3300001990 Bacteria 1996
4 JGI24738J21930_10088974 3300002075 Bacteria 652
5 rootH1_10002248 3300003316 Bacteria 11245
6 rootH2_10163396 3300003320 Bacteria 4384
7 rootH2_10218443 3300003320 Bacteria 1789
8 rootL2_10028498 3300003322 Bacteria 4672
9 rootH1_10124213 3300003316 Bacteria 1781
10 rootH1_10124213 3300003323 Bacteria 2010
11 Ga0006562J51391_1145169 3300003578 Bacteria 1629
12 Ga0070658_10052117 3300005327 Bacteria 3318
13 Ga0070674_101105946 3300005356 Bacteria 700
14 Ga0070659_100314016 3300005366 Bacteria 1309
15 Ga0070701_10112659 3300005438 Bacteria 1522
16 Ga0070700_100000012 3300005441 Bacteria 171410
17 Ga0075368_10003517 3300006042 Bacteria 5242
18 Ga0075363_100065730 3300006048 Bacteria 1961
19 Ga0075367_10056516 3300006178 Bacteria 2331
20 Ga0075428_100098789 3300006844 Bacteria 3183
21 Ga0075430_100428081 3300006846 Bacteria 1092
22 Ga0075431_100684731 3300006847 Bacteria 1004
23 Ga0105238_10825316 3300009551 Bacteria 943
24 Ga0105246_10260068 3300011119 Bacteria 1382
25 Ga0157369_10215611 3300013105 Bacteria 2010
26 Ga0157372_10175135 3300013307 Bacteria 2483
27 Ga0182008_10049977 3300014497 Bacteria 2075
28 Ga0182007_10002455 3300015262 Bacteria 9210
29 Ga0183367_1010 3300015688 Bacteria 416164
30 Ga0206353_11510210 3300020082 Bacteria 1463
31 Ga0213875_10024527 3300021388 Bacteria 2876
32 Ga0209758_1005407 3300025297 Bacteria 9868
33 Ga0207426_1020911 3300025302 Bacteria 2268
34 Ga0207708_10000062 3300026075 Bacteria 89274
35 Ga0307517_10014987 3300028786 Bacteria 10343
36 Ga0307515_10039805 3300028794 Bacteria 7459
37 Ga0307515_10116053 3300028794 Bacteria 3077
38 Ga0307511_10002263 3300030521 Bacteria 20131
39 Ga0307511_10058058 3300030521 Bacteria 2997
40 Ga0307512_10037890 3300030522 Bacteria 4065
41 Ga0307512_10163853 3300030522 Bacteria 1294
42 Ga0307509_10030969 3300031507 Bacteria 5912
43 Ga0307509_10139130 3300031507 Bacteria 2367
44 Ga0307508_10006070 3300031616 Bacteria 11403
45 Ga0307508_10012004 3300031616 Bacteria 7926
46 Ga0307508_10234249 3300031616 Bacteria 1434
47 Ga0307514_10002184 3300031649 Bacteria 21019
48 Ga0307514_10282607 3300031649 Bacteria 948
49 Ga0307516_10008034 3300031730 Bacteria 12004
50 Ga0307516_10339692 3300031730 Bacteria 1169
51 Ga0307518_10091033 3300031838 Bacteria 2194
52 Ga0307518_10215999 3300031838 Bacteria 1257
53 Ga0307507_10174861 3300033179 Bacteria 1550
54 Ga0307507_10183429 3300033179 Bacteria 1490
55 Ga0307507_10254796 3300033179 Bacteria 1128
56 Ga0307510_10020573 3300033180 Bacteria 7708
57 Ga0307510_10059555 3300033180 Bacteria 3941
58 Ga0307510_10116512 3300033180 Bacteria 2392
59 Ga0395899_0485026 3300037312 Bacteria 804
60 Ga0395899_0525822 3300037312 Bacteria 764
61 Ga0395900_0019613 3300037418 Bacteria 6895
62 Ga0395900_0711663 3300037418 Bacteria 937
63 Ga0395900_0848058 3300037418 Bacteria 839
64 Ga0395898_0003733 3300037466 Bacteria 16895
65 Ga0395898_0026922 3300037466 Bacteria 5778
66 Ga0395898_0042411 3300037466 Bacteria 4489
67 Ga0395905_0362180 3300037471 Bacteria 1343
68 Ga0436364_1143567 3300037853 Bacteria 10303
69 Ga0395901_0004960 3300038443 Bacteria 13429
70 Ga0395901_1128943 3300038443 Bacteria 753
71 Ga0439436_0000578 3300041404 Bacteria 9700
72 Ga0439436_0007787 3300041404 Bacteria 3291
73 Ga0439436_0122267 3300041404 Bacteria 728
74 Ga0439439_0001117 3300041406 Bacteria 5135
75 Ga0439439_0012270 3300041406 Bacteria 2070
76 Ga0451795_0162900 3300041456 Bacteria 629
77 Ga0451841_0842357 3300041498 Bacteria 1438
78 Ga0451853_4009760 3300041512 Bacteria 1508
79 Ga0439433_0037324 3300041999 Bacteria 1124
80 Ga0439433_0051017 3300041999 Bacteria 976
81 Ga0439448_0071348 3300042005 Bacteria 1157
82 Ga0439448_0158734 3300042005 Bacteria 786
83 Ga0439449_0012600 3300042007 Bacteria 3180
84 Ga0439449_0022445 3300042007 Bacteria 2363
85 Ga0439449_0095943 3300042007 Bacteria 1096
86 Ga0439455_0032535 3300042012 Bacteria 1304
87 Ga0439457_002430 3300042014 Bacteria 5329
88 Ga0439457_006112 3300042014 Bacteria 2971
89 Ga0439457_029415 3300042014 Bacteria 1217
90 Ga0439462_0033498 3300042015 Bacteria 1362
91 Ga0439462_0045641 3300042015 Bacteria 1173
92 Ga0450894_002625 3300042131 Bacteria 2392
93 Ga0450898_000686 3300042134 Bacteria 4086
94 Ga0450899_000340 3300042135 Bacteria 5140
95 Ga0450903_000252 3300042138 Bacteria 11823
96 Ga0450903_001107 3300042138 Bacteria 5116
97 Ga0450906_005247 3300042145 Bacteria 2677
98 Ga0439458_0005541 3300042157 Bacteria 2838
99 Ga0450908_002617 3300042184 Bacteria 3530
100 Ga0466972_0036128 3300044658 Bacteria 2418
101 Ga0466972_0212658 3300044658 Bacteria 905
102 Ga0466965_0072768 3300044683 Bacteria 1730
103 Ga0466965_0091165 3300044683 Bacteria 1550
104 Ga0466966_0002952 3300044684 Bacteria 11187
105 Ga0466966_0006347 3300044684 Bacteria 7817
106 Ga0466961_0000223 3300044693 Bacteria 38608
107 Ga0466961_0020450 3300044693 Bacteria 4259
108 Ga0466961_0167930 3300044693 Bacteria 1365
109 Ga0466963_0002808 3300044694 Bacteria 9816
110 Ga0466963_0070953 3300044694 Bacteria 2343
111 Ga0466964_0009791 3300044706 Bacteria 3611
112 Ga0466971_0014630 3300044719 Bacteria 3453
113 Ga0466971_0112273 3300044719 Bacteria 1258
114 Ga0466970_0002506 3300044765 Bacteria 8853
115 Ga0466970_0031048 3300044765 Bacteria 2820
116 Ga0466970_0161002 3300044765 Bacteria 1241
117 Ga0466970_0231349 3300044765 Bacteria 1033
118 Ga0466957_0002550 3300044842 Bacteria 9799
119 Ga0466960_0150613 3300044901 Bacteria 1242
120 Ga0466959_0001124 3300045049 Bacteria 16123
121 Ga0466959_0006110 3300045049 Bacteria 8317
122 Ga0466958_0046805 3300045836 Bacteria 2610
123 Ga0466958_0435831 3300045836 Bacteria 848
124 Ga0466967_0009073 3300045976 Bacteria 7354
125 Ga0466967_0014792 3300045976 Bacteria 6096
126 Ga0466967_0015368 3300045976 Bacteria 5997
127 Ga0466967_0041324 3300045976 Bacteria 3975
128 Ga0466967_0242174 3300045976 Bacteria 1721
129 Ga0466967_0920004 3300045976 Bacteria 870
130 Ga0466967_1705206 3300045976 Bacteria 627
131 Ga0495617_005200 3300046452 Bacteria 4643
132 Ga0495592_0016040 3300046454 Bacteria 5685
133 Ga0495603_0006755 3300046455 Bacteria 6884
134 Ga0495603_0019169 3300046455 Bacteria 4141
135 Ga0495603_0023791 3300046455 Bacteria 3706
136 Ga0495603_0078812 3300046455 Bacteria 1931
137 Ga0495629_0000657 3300046459 Bacteria 27953
138 Ga0495629_0001387 3300046459 Bacteria 19110
139 Ga0495629_0023583 3300046459 Bacteria 4383
140 Ga0495629_0030427 3300046459 Bacteria 3827
141 Ga0495629_0071596 3300046459 Bacteria 2419
142 Ga0495629_0074375 3300046459 Bacteria 2372
143 Ga0495629_0224746 3300046459 Bacteria 1294
144 Ga0495629_0241911 3300046459 Bacteria 1242
145 Ga0495638_0023441 3300046460 Bacteria 4036
146 Ga0495638_0105226 3300046460 Bacteria 1682
147 Ga0495638_0139668 3300046460 Bacteria 1415
148 Ga0495638_0244869 3300046460 Bacteria 991
149 Ga0495641_0282823 3300046461 Bacteria 747
150 Ga0495651_0003316 3300046462 Bacteria 12360
151 Ga0495651_0325921 3300046462 Bacteria 1022
152 Ga0495653_0064430 3300046463 Bacteria 2761
153 Ga0495580_0036674 3300046472 Bacteria 3519
154 Ga0495580_0144543 3300046472 Bacteria 1648
155 Ga0495582_0015985 3300046473 Bacteria 4115
156 Ga0495582_0409895 3300046473 Bacteria 782
157 Ga0495605_0074429 3300046474 Bacteria 1598
158 Ga0495605_0090952 3300046474 Bacteria 1414
159 Ga0495605_0235440 3300046474 Bacteria 787
160 Ga0495639_0082970 3300046475 Bacteria 1495
161 Ga0495662_0005205 3300046476 Bacteria 6519
162 Ga0495662_0005321 3300046476 Bacteria 6447
163 Ga0495662_0051693 3300046476 Bacteria 1983
164 Ga0495662_0104259 3300046476 Bacteria 1387
165 Ga0495664_0000837 3300046477 Bacteria 15783
166 Ga0495664_0185680 3300046477 Bacteria 1260
167 Ga0495584_0183025 3300046491 Bacteria 1065
168 Ga0495585_0163950 3300046492 Bacteria 1152
169 Ga0495585_0233110 3300046492 Bacteria 924
170 Ga0495594_0003720 3300046499 Bacteria 7827
171 Ga0495594_0425395 3300046499 Bacteria 755
172 Ga0495596_0055805 3300046500 Bacteria 1543
173 Ga0495607_0017006 3300046501 Bacteria 4681
174 Ga0495583_0075644 3300046506 Bacteria 1472
175 Ga0495583_0187851 3300046506 Bacteria 843
176 Ga0495606_0027758 3300046507 Bacteria 4006
177 Ga0495608_0001296 3300046511 Bacteria 17779
178 Ga0495608_0115085 3300046511 Bacteria 1727
179 Ga0495610_0039297 3300046512 Bacteria 2394
180 Ga0495616_0009177 3300046513 Bacteria 5803
181 Ga0495618_0118364 3300046514 Bacteria 1696
182 Ga0495618_0176523 3300046514 Bacteria 1358
183 Ga0495620_0001729 3300046515 Bacteria 12888
184 Ga0495620_0051987 3300046515 Bacteria 1741
185 Ga0495620_0144305 3300046515 Bacteria 930
186 Ga0495620_0278060 3300046515 Bacteria 637
187 Ga0495628_0073510 3300046516 Bacteria 2663
188 Ga0495628_0118991 3300046516 Bacteria 2027
189 Ga0495630_0042848 3300046517 Bacteria 3380
190 Ga0495630_0177940 3300046517 Bacteria 1622
191 Ga0495631_0016133 3300046518 Bacteria 3568
192 Ga0495631_0360833 3300046518 Bacteria 618
193 Ga0495637_0056754 3300046520 Bacteria 1620
194 Ga0495643_0020745 3300046522 Bacteria 3781
195 Ga0495644_0243440 3300046523 Bacteria 698
196 Ga0495644_0315471 3300046523 Bacteria 613
197 Ga0495648_0169465 3300046524 Bacteria 1120
198 Ga0495648_0213268 3300046524 Bacteria 957
199 Ga0495666_0001088 3300046526 Bacteria 12961
200 Ga0495666_0013485 3300046526 Bacteria 4075
201 Ga0495666_0053253 3300046526 Bacteria 1943
202 Ga0495642_0052898 3300046528 Bacteria 1673
203 Ga0495652_0181394 3300046529 Bacteria 1615
204 Ga0495652_0317103 3300046529 Bacteria 1128
205 Ga0495652_0719229 3300046529 Bacteria 670
206 Ga0495654_0033098 3300046530 Bacteria 2617
207 Ga0495665_0077278 3300046531 Bacteria 1752
208 Ga0495665_0139074 3300046531 Bacteria 1270
209 Ga0495640_0004986 3300046533 Bacteria 10545
210 Ga0495640_0048495 3300046533 Bacteria 2934
211 Ga0495640_0256245 3300046533 Bacteria 1094
212 Ga0495586_0355686 3300046535 Bacteria 841
213 Ga0495587_0004266 3300046536 Bacteria 9443
214 Ga0495587_0019115 3300046536 Bacteria 4243
215 Ga0495609_0009304 3300046538 Bacteria 4761
216 Ga0495597_0009053 3300046542 Bacteria 4945
217 Ga0495597_0027887 3300046542 Bacteria 2587
218 Ga0495645_0183702 3300046543 Bacteria 1430
219 Ga0495622_0060162 3300046557 Bacteria 1758
220 Ga0495622_0066729 3300046557 Bacteria 1663
221 Ga0495667_0048349 3300046559 Bacteria 2808
222 Ga0495668_0052457 3300046616 Bacteria 2256
223 Ga0495668_0106511 3300046616 Bacteria 1533
224 Ga0495634_0011414 3300046642 Bacteria 6470
225 Ga0495634_0084383 3300046642 Bacteria 2071
226 Ga0495625_0033876 3300046660 Bacteria 3772
227 Ga0495625_0068547 3300046660 Bacteria 2493
228 Ga0495635_0008046 3300046663 Bacteria 7367
229 Ga0495635_0029848 3300046663 Bacteria 3792
230 Ga0495635_0297250 3300046663 Bacteria 1083
231 Ga0495661_0064266 3300046665 Bacteria 2166
232 Ga0495588_0028456 3300046674 Bacteria 2796
233 Ga0495588_0042146 3300046674 Bacteria 2333
234 Ga0495657_0008061 3300046675 Bacteria 8076
235 Ga0495657_0011738 3300046675 Bacteria 6533
236 Ga0495657_0067357 3300046675 Bacteria 2350
237 Ga0495657_0067389 3300046675 Bacteria 2349
238 Ga0495657_0188540 3300046675 Bacteria 1261
239 Ga0495599_0341579 3300046678 Bacteria 899
240 Ga0495623_0094758 3300046679 Bacteria 1825
241 Ga0495623_0176983 3300046679 Bacteria 1242
242 Ga0495623_0390586 3300046679 Bacteria 750
243 Ga0495646_0066288 3300046680 Bacteria 2135
244 Ga0495646_0176345 3300046680 Bacteria 1175
245 Ga0495658_0069759 3300046683 Bacteria 2038
246 Ga0495658_0726467 3300046683 Bacteria 636
247 Ga0495613_0012000 3300046689 Bacteria 6439
248 Ga0495613_0013206 3300046689 Bacteria 6137
249 Ga0495613_0013522 3300046689 Bacteria 6060
250 Ga0495613_0038725 3300046689 Bacteria 3533
251 Ga0495613_0248595 3300046689 Bacteria 1241
252 Ga0495613_0512487 3300046689 Bacteria 806
253 Ga0495624_0039405 3300046690 Bacteria 3029
254 Ga0495670_0034670 3300046691 Bacteria 2515
255 Ga0495671_0350736 3300046692 Bacteria 708
256 Ga0495649_0119158 3300046694 Bacteria 1396
257 Ga0495589_0011211 3300046794 Bacteria 4652
258 Ga0495589_0032575 3300046794 Bacteria 2620
259 Ga0495589_0034994 3300046794 Bacteria 2519
260 Ga0495589_0081306 3300046794 Bacteria 1576
261 Ga0495589_0303708 3300046794 Bacteria 739
262 Ga0495600_0035922 3300046809 Bacteria 3220
263 Ga0495600_0058355 3300046809 Bacteria 2521
264 Ga0495600_0063112 3300046809 Bacteria 2420
265 Ga0495600_0317358 3300046809 Bacteria 980
266 Ga0495660_0108102 3300046810 Bacteria 1422
267 Ga0495660_0130950 3300046810 Bacteria 1258
268 Ga0495581_0003570 3300047315 Bacteria 8936
269 Ga0495581_0048940 3300047315 Bacteria 2440
270 Ga0495581_0096391 3300047315 Bacteria 1717
271 Ga0495581_0304034 3300047315 Bacteria 932
272 Ga0495604_0001020 3300047317 Bacteria 23351
273 Ga0495604_0057216 3300047317 Bacteria 2998
274 Ga0495604_0240115 3300047317 Bacteria 1239
275 Ga0495636_0004601 3300047318 Bacteria 5408
276 Ga0495636_0033586 3300047318 Bacteria 2109
277 Ga0495636_0060604 3300047318 Bacteria 1599
278 Ga0495636_0095465 3300047318 Bacteria 1295
279 Ga0495636_0115538 3300047318 Bacteria 1184
280 Ga0495636_0352046 3300047318 Bacteria 695
281 Ga0495674_0020370 3300047319 Bacteria 6141
282 Ga0495676_0010759 3300047321 Bacteria 8281
283 Ga0495676_0018210 3300047321 Bacteria 6195
284 Ga0495676_0019263 3300047321 Bacteria 6004
285 Ga0495676_0091880 3300047321 Bacteria 2266
286 Ga0495676_0543759 3300047321 Bacteria 759
287 Ga0495683_0066144 3300047323 Bacteria 1781
288 Ga0495683_0111509 3300047323 Bacteria 1305
289 Ga0495683_0166234 3300047323 Bacteria 1017
290 Ga0495687_005741 3300047443 Bacteria 7801
291 Ga0495687_010976 3300047443 Bacteria 4911
292 Ga0495687_076494 3300047443 Bacteria 1324
293 Ga0495687_125060 3300047443 Bacteria 921
294 Ga0495675_0014210 3300047444 Bacteria 5033
295 Ga0495675_0098502 3300047444 Bacteria 1831
296 Ga0495675_0279587 3300047444 Bacteria 995
297 Ga0495677_0089972 3300047445 Bacteria 1156
298 Ga0495677_0156068 3300047445 Bacteria 880
299 Ga0495685_003440 3300047447 Bacteria 5056
300 Ga0495685_008442 3300047447 Bacteria 3422
301 Ga0495685_050176 3300047447 Bacteria 1416
302 Ga0495685_080567 3300047447 Bacteria 1084
303 Ga0495681_0006716 3300047470 Bacteria 7510
304 Ga0495681_0071207 3300047470 Bacteria 1575
305 Ga0495684_0285892 3300047471 Bacteria 1188
306 Ga0495684_0418437 3300047471 Bacteria 937
307 Ga0495686_0098280 3300047472 Bacteria 1769
308 Ga0495686_0352582 3300047472 Bacteria 799
309 Ga0495593_0012185 3300047673 Bacteria 4917
310 Ga0495593_0035405 3300047673 Bacteria 2711
311 Ga0495593_0191591 3300047673 Bacteria 1028
312 Ga0495614_0016095 3300048089 Bacteria 3256
313 Ga0495614_0061785 3300048089 Bacteria 1609
314 Ga0495614_0066415 3300048089 Bacteria 1551
315 Ga0495614_0074175 3300048089 Bacteria 1469
316 Ga0495614_0110374 3300048089 Bacteria 1207
317 Ga0496106_0202646 3300048909 Bacteria 1579
318 Ga0496107_0702664 3300048910 Bacteria 744
319 Ga0496108_0724913 3300048911 Bacteria 861
320 Ga0496108_0951476 3300048911 Bacteria 735
321 Ga0496109_0014990 3300048912 Bacteria 6746
322 Ga0496114_0662749 3300048917 Bacteria 917
323 Ga0495678_021542 3300049459 Bacteria 2836
324 Ga0495678_047869 3300049459 Bacteria 1671
325 Ga0501031_0435047 3300049568 Bacteria 847
326 Ga0501032_0013667 3300049569 Bacteria 5767
327 Ga0501032_0049773 3300049569 Bacteria 2827
328 Ga0501033_0056114 3300049570 Bacteria 2911
329 Ga0501033_0087811 3300049570 Bacteria 2275
330 Ga0501034_0014978 3300049571 Bacteria 7976
331 Ga0501034_0026007 3300049571 Bacteria 5962
332 Ga0501034_0335968 3300049571 Bacteria 1441
333 Ga0501034_0504750 3300049571 Bacteria 1123
334 Ga0501036_0008873 3300049572 Bacteria 8256
335 Ga0501036_0524929 3300049572 Bacteria 984
336 Ga0501037_0016175 3300049573 Bacteria 5490
337 Ga0501037_0069259 3300049573 Bacteria 2568
338 Ga0501037_0149113 3300049573 Bacteria 1672
339 Ga0501038_0001319 3300049574 Bacteria 22562
340 Ga0501038_0052098 3300049574 Bacteria 3529
341 Ga0501038_0256828 3300049574 Bacteria 1382
342 Ga0501039_0100742 3300049575 Bacteria 2254
343 Ga0501039_0240679 3300049575 Bacteria 1423
344 Ga0501042_0466989 3300049578 Bacteria 915
345 Ga0501043_0067362 3300049579 Bacteria 2811
346 Ga0501043_0072430 3300049579 Bacteria 2706
347 Ga0501043_0082010 3300049579 Bacteria 2534
348 Ga0501043_0220607 3300049579 Bacteria 1467
349 Ga0501046_0030526 3300049580 Bacteria 4373
350 Ga0501046_0053313 3300049580 Bacteria 3186
351 Ga0501047_0066970 3300049581 Bacteria 3461
352 Ga0501047_0191010 3300049581 Bacteria 1911
353 Ga0501047_0304471 3300049581 Bacteria 1435
354 Ga0501047_0489215 3300049581 Bacteria 1057
355 Ga0501048_0014290 3300049582 Bacteria 5879
356 Ga0501048_0208161 3300049582 Bacteria 1387
357 Ga0501067_0253403 3300049583 Bacteria 980
358 Ga0501069_0568121 3300049585 Bacteria 679
359 Ga0501070_0008734 3300049586 Bacteria 8566
360 Ga0501070_0502564 3300049586 Bacteria 974
361 Ga0501073_0263571 3300049589 Bacteria 1189
362 Ga0501074_0039716 3300049590 Bacteria 3408
363 Ga0501080_0177448 3300049742 Bacteria 1962
364 Ga0501083_0311772 3300049744 Bacteria 1023
365 Ga0501035_0061326 3300049822 Bacteria 3347
366 Ga0501035_0102811 3300049822 Bacteria 2506
367 Ga0501035_0111451 3300049822 Bacteria 2398
368 Ga0501035_0127830 3300049822 Bacteria 2217
369 Ga0501035_0284293 3300049822 Bacteria 1397
370 Ga0501044_0002675 3300049823 Bacteria 20281
371 Ga0501044_0033653 3300049823 Bacteria 5383
372 Ga0501044_0116187 3300049823 Bacteria 2681
373 Ga0501044_0160970 3300049823 Bacteria 2221
374 Ga0501044_0207047 3300049823 Bacteria 1917
375 Ga0501045_0117478 3300049824 Bacteria 1974
376 nmdc:mga03n38_518966_c1 3300050490 Bacteria 670
377 nmdc:mga06z11_40272_c1 3300050494 Bacteria 2331
378 nmdc:mga05p37_399420_c1 3300050507 Bacteria 1605
379 nmdc:mga0qj67_411146_c1 3300050509 Bacteria 1091
380 nmdc:mga06r32_871646_c1 3300050510 Bacteria 858
381 Ga0495601_0530026 3300053077 Bacteria 759
382 Ga0495612_0334394 3300053078 Bacteria 682
383 Ga0495655_0221858 3300053083 Bacteria 626
384 Ga0495619_0078385 3300053085 Bacteria 2221
385 Ga0500644_0160632 3300053088 Bacteria 908
386 Ga0500583_0113539 3300053092 Bacteria 1336
387 Ga0500640_009114 3300053095 Bacteria 3951
388 Ga0500660_100873 3300053100 Bacteria 1259
389 Ga0500560_007449 3300053107 Bacteria 2576
390 Ga0500572_215003 3300053111 Bacteria 629
391 Ga0500600_0205675 3300053149 Bacteria 923
392 Ga0590075_002258 3300059424 Bacteria 4630
393 Ga0466962_0000512 3300061719 Bacteria 16909
394 Ga0466962_0082632 3300061719 Bacteria 1536
395 2547406572 2547132111 Bacteria 8013147
396 2585300429 2582581312 Bacteria 7308206
397 2585303591 2582581313 Bacteria 10042643
398 2585317054 2582581314 Bacteria 11452267
399 2616695666 2616644814 Bacteria 11555299
400 2616900789 2616644941 Bacteria 8510691
401 2643760176 2643221548 Bacteria 8053412
402 2643904521 2643221578 Bacteria 9213798
403 2643946517 2643221587 Bacteria 7586415
404 2644268062 2643221647 Bacteria 10741251
405 2644389134 2643221670 Bacteria 6497041
406 2644406211 2643221673 Bacteria 9196637
407 2644434321 2643221677 Bacteria 7584031
408 2644443733 2643221678 Bacteria 9540101
409 2644460128 2643221682 Bacteria 6743283
410 2644629663 2643221714 Bacteria 9015452
411 2676491660 2675903060 Bacteria 10051191
412 2784586785 2784132148 Bacteria 8627943
413 2785345696 2784746763 Bacteria 9783172
414 2785367194 2784746768 Bacteria 10036182
415 2786668242 2786546132 Bacteria 10419719
416 2808847694 2808606359 Bacteria 9866990
417 2808918434 2808606375 Bacteria 9466072
418 2809230352 2808606448 Bacteria 8656184
419 2811847005 2808606982 Bacteria 7791042
420 2812360270 2811994879 Bacteria 9313447
421 2812482382 2811994917 Bacteria 7761064
422 2819696406 2818991463 Bacteria 7948711
423 2819739124 2818991472 Bacteria 10089953
424 2852637757 2852635781 Bacteria 8251373
425 2856747773 2856741275 Bacteria 8096094
426 2862289620 2862281513 Bacteria 9621493
427 2862290444 2862290372 Bacteria 7471434
428 2862390950 2862382967 Bacteria 10317375
429 2862510451 2862507626 Bacteria 9425308
430 2862583688 2862574272 Bacteria 10567477
431 2863406934 2863404153 Bacteria 9672205
432 2867430929 2867428634 Bacteria 9590268
433 2873157650 2873151551 Bacteria 8625867
434 2873321224 2873314349 Bacteria 8512634
435 2875392725 2875391855 Bacteria 7600475
436 2877683353 2877676314 Bacteria 9512378
437 2884696236 2884693830 Bacteria 11273186
438 2891399697 2891395885 Bacteria 9251614
439 2891557484 2891554331 Bacteria 8812224
440 2891564002 2891562705 Bacteria 8039471
441 2895428199 2895427314 Bacteria 13147766
442 2895449590 2895442618 Bacteria 11027144
443 2912722366 2912715099 Bacteria 9460473
444 2912726075 2912723979 Bacteria 8557534
445 2912758924 2912757875 Bacteria 7940295
446 2918502555 2918501144 Bacteria 8668083
447 2919472157 2919468124 Bacteria 9133025
448 2946051989 2946045630 Bacteria 8527308
449 2946065620 2946064051 Bacteria 8957905
450 2946073969 2946072368 Bacteria 8999607
451 2947231793 2947224130 Bacteria 9938529
452 2954011036 2954002825 Bacteria 9173742
453 2954388600 2954380949 Bacteria 10050426
454 2954674525 2954673503 Bacteria 9685905
455 2954689607 2954682443 Bacteria 9862841
456 2954699390 2954691527 Bacteria 10720516
457 2954702829 2954701450 Bacteria 10834262
458 2954718332 2954711539 Bacteria 10867210
459 2954728301 2954721474 Bacteria 10456478
460 2954733509 2954731030 Bacteria 10243860
461 2954747196 2954740390 Bacteria 10229294
462 2954752391 2954749733 Bacteria 10366972
463 2954766309 2954759201 Bacteria 9358192
464 2966604356 2966598605 Bacteria 7676064
465 2990059537 2990059506 Bacteria 9321252
466 2997605639 2997600082 Bacteria 9896405
467 3006395354 3006393351 Bacteria 6615579
468 3006488690 3006486233 Bacteria 8157040
469 3006495187 3006493962 Bacteria 8825450
470 8008561353 8008558824 Bacteria 10610750
471 8008580718 8008574985 Bacteria 7815457
472 8023628553 8023623736 Bacteria 8593882
473 8025534120 8025530807 Bacteria 8495698
474 8048413600 8048406513 Bacteria 8936924
475 8054166878 8054160619 Bacteria 7783213
476 8055067215 8055066027 Bacteria 9479577
477 8055174245 8055172936 Bacteria 9305943
478 8056835667 8056829672 Bacteria 9045328
479 Ga0501047_0439152
480 JGI24739J22299_10025198
481 JGI24737J22298_10022660
482 JGI24738J21930_10088974
483 rootH1_10002248
484 rootH2_10163396
485 rootH2_10218443
486 rootL2_10028498
487 rootH1_10124213
488 Ga0006562J51391_1145169
489 Ga0070658_10052117
490 Ga0070674_101105946
491 Ga0070659_100314016
492 Ga0070701_10112659
493 Ga0070700_100000012
494 Ga0075368_10003517
495 Ga0075363_100065730
496 Ga0075367_10056516
497 Ga0075428_100098789
498 Ga0075430_100428081
499 Ga0075431_100684731
500 Ga0105238_10825316
501 Ga0105246_10260068
502 Ga0157369_10215611
503 Ga0157372_10175135
504 Ga0182008_10049977
505 Ga0182007_10002455
506 Ga0183367_1010
507 Ga0206353_11510210
508 Ga0213875_10024527
509 Ga0209758_1005407
510 Ga0207426_1020911
511 Ga0207708_10000062
512 Ga0307517_10014987
513 Ga0307515_10039805
514 Ga0307515_10116053
515 Ga0307511_10002263
516 Ga0307511_10058058
517 Ga0307512_10037890
518 Ga0307512_10163853
519 Ga0307509_10030969
520 Ga0307509_10139130
521 Ga0307508_10006070
522 Ga0307508_10012004
523 Ga0307508_10234249
524 Ga0307514_10002184
525 Ga0307514_10282607
526 Ga0307516_10008034
527 Ga0307516_10339692
528 Ga0307518_10091033
529 Ga0307518_10215999
530 Ga0307507_10174861
531 Ga0307507_10183429
532 Ga0307507_10254796
533 Ga0307510_10020573
534 Ga0307510_10059555
535 Ga0307510_10116512
536 Ga0395899_0485026
537 Ga0395899_0525822
538 Ga0395900_0019613
539 Ga0395900_0711663
540 Ga0395900_0848058
541 Ga0395898_0003733
542 Ga0395898_0026922
543 Ga0395898_0042411
544 Ga0395905_0362180
545 Ga0436364_1143567
546 Ga0395901_0004960
547 Ga0395901_1128943
548 Ga0439436_0000578
549 Ga0439436_0007787
550 Ga0439436_0122267
551 Ga0439439_0001117
552 Ga0439439_0012270
553 Ga0451795_0162900
554 Ga0451841_0842357
555 Ga0451853_4009760
556 Ga0439433_0037324
557 Ga0439433_0051017
558 Ga0439448_0071348
559 Ga0439448_0158734
560 Ga0439449_0012600
561 Ga0439449_0022445
562 Ga0439449_0095943
563 Ga0439455_0032535
564 Ga0439457_002430
565 Ga0439457_006112
566 Ga0439457_029415
567 Ga0439462_0033498
568 Ga0439462_0045641
569 Ga0450894_002625
570 Ga0450898_000686
571 Ga0450899_000340
572 Ga0450903_000252
573 Ga0450903_001107
574 Ga0450906_005247
575 Ga0439458_0005541
576 Ga0450908_002617
577 Ga0466972_0036128
578 Ga0466972_0212658
579 Ga0466965_0072768
580 Ga0466965_0091165
581 Ga0466966_0002952
582 Ga0466966_0006347
583 Ga0466961_0000223
584 Ga0466961_0020450
585 Ga0466961_0167930
586 Ga0466963_0002808
587 Ga0466963_0070953
588 Ga0466964_0009791
589 Ga0466971_0014630
590 Ga0466971_0112273
591 Ga0466970_0002506
592 Ga0466970_0031048
593 Ga0466970_0161002
594 Ga0466970_0231349
595 Ga0466957_0002550
596 Ga0466960_0150613
597 Ga0466959_0001124
598 Ga0466959_0006110
599 Ga0466958_0046805
600 Ga0466958_0435831
601 Ga0466967_0009073
602 Ga0466967_0014792
603 Ga0466967_0015368
604 Ga0466967_0041324
605 Ga0466967_0242174
606 Ga0466967_0920004
607 Ga0466967_1705206
608 Ga0495617_005200
609 Ga0495592_0016040
610 Ga0495603_0006755
611 Ga0495603_0019169
612 Ga0495603_0023791
613 Ga0495603_0078812
614 Ga0495629_0000657
615 Ga0495629_0001387
616 Ga0495629_0023583
617 Ga0495629_0030427
618 Ga0495629_0071596
619 Ga0495629_0074375
620 Ga0495629_0224746
621 Ga0495629_0241911
622 Ga0495638_0023441
623 Ga0495638_0105226
624 Ga0495638_0139668
625 Ga0495638_0244869
626 Ga0495641_0282823
627 Ga0495651_0003316
628 Ga0495651_0325921
629 Ga0495653_0064430
630 Ga0495580_0036674
631 Ga0495580_0144543
632 Ga0495582_0015985
633 Ga0495582_0409895
634 Ga0495605_0074429
635 Ga0495605_0090952
636 Ga0495605_0235440
637 Ga0495639_0082970
638 Ga0495662_0005205
639 Ga0495662_0005321
640 Ga0495662_0051693
641 Ga0495662_0104259
642 Ga0495664_0000837
643 Ga0495664_0185680
644 Ga0495584_0183025
645 Ga0495585_0163950
646 Ga0495585_0233110
647 Ga0495594_0003720
648 Ga0495594_0425395
649 Ga0495596_0055805
650 Ga0495607_0017006
651 Ga0495583_0075644
652 Ga0495583_0187851
653 Ga0495606_0027758
654 Ga0495608_0001296
655 Ga0495608_0115085
656 Ga0495610_0039297
657 Ga0495616_0009177
658 Ga0495618_0118364
659 Ga0495618_0176523
660 Ga0495620_0001729
661 Ga0495620_0051987
662 Ga0495620_0144305
663 Ga0495620_0278060
664 Ga0495628_0073510
665 Ga0495628_0118991
666 Ga0495630_0042848
667 Ga0495630_0177940
668 Ga0495631_0016133
669 Ga0495631_0360833
670 Ga0495637_0056754
671 Ga0495643_0020745
672 Ga0495644_0243440
673 Ga0495644_0315471
674 Ga0495648_0169465
675 Ga0495648_0213268
676 Ga0495666_0001088
677 Ga0495666_0013485
678 Ga0495666_0053253
679 Ga0495642_0052898
680 Ga0495652_0181394
681 Ga0495652_0317103
682 Ga0495652_0719229
683 Ga0495654_0033098
684 Ga0495665_0077278
685 Ga0495665_0139074
686 Ga0495640_0004986
687 Ga0495640_0048495
688 Ga0495640_0256245
689 Ga0495586_0355686
690 Ga0495587_0004266
691 Ga0495587_0019115
692 Ga0495609_0009304
693 Ga0495597_0009053
694 Ga0495597_0027887
695 Ga0495645_0183702
696 Ga0495622_0060162
697 Ga0495622_0066729
698 Ga0495667_0048349
699 Ga0495668_0052457
700 Ga0495668_0106511
701 Ga0495634_0011414
702 Ga0495634_0084383
703 Ga0495625_0033876
704 Ga0495625_0068547
705 Ga0495635_0008046
706 Ga0495635_0029848
707 Ga0495635_0297250
708 Ga0495661_0064266
709 Ga0495588_0028456
710 Ga0495588_0042146
711 Ga0495657_0008061
712 Ga0495657_0011738
713 Ga0495657_0067357
714 Ga0495657_0067389
715 Ga0495657_0188540
716 Ga0495599_0341579
717 Ga0495623_0094758
718 Ga0495623_0176983
719 Ga0495623_0390586
720 Ga0495646_0066288
721 Ga0495646_0176345
722 Ga0495658_0069759
723 Ga0495658_0726467
724 Ga0495613_0012000
725 Ga0495613_0013206
726 Ga0495613_0013522
727 Ga0495613_0038725
728 Ga0495613_0248595
729 Ga0495613_0512487
730 Ga0495624_0039405
731 Ga0495670_0034670
732 Ga0495671_0350736
733 Ga0495649_0119158
734 Ga0495589_0011211
735 Ga0495589_0032575
736 Ga0495589_0034994
737 Ga0495589_0081306
738 Ga0495589_0303708
739 Ga0495600_0035922
740 Ga0495600_0058355
741 Ga0495600_0063112
742 Ga0495600_0317358
743 Ga0495660_0108102
744 Ga0495660_0130950
745 Ga0495581_0003570
746 Ga0495581_0048940
747 Ga0495581_0096391
748 Ga0495581_0304034
749 Ga0495604_0001020
750 Ga0495604_0057216
751 Ga0495604_0240115
752 Ga0495636_0004601
753 Ga0495636_0033586
754 Ga0495636_0060604
755 Ga0495636_0095465
756 Ga0495636_0115538
757 Ga0495636_0352046
758 Ga0495674_0020370
759 Ga0495676_0010759
760 Ga0495676_0018210
761 Ga0495676_0019263
762 Ga0495676_0091880
763 Ga0495676_0543759
764 Ga0495683_0066144
765 Ga0495683_0111509
766 Ga0495683_0166234
767 Ga0495687_005741
768 Ga0495687_010976
769 Ga0495687_076494
770 Ga0495687_125060
771 Ga0495675_0014210
772 Ga0495675_0098502
773 Ga0495675_0279587
774 Ga0495677_0089972
775 Ga0495677_0156068
776 Ga0495685_003440
777 Ga0495685_008442
778 Ga0495685_050176
779 Ga0495685_080567
780 Ga0495681_0006716
781 Ga0495681_0071207
782 Ga0495684_0285892
783 Ga0495684_0418437
784 Ga0495686_0098280
785 Ga0495686_0352582
786 Ga0495593_0012185
787 Ga0495593_0035405
788 Ga0495593_0191591
789 Ga0495614_0016095
790 Ga0495614_0061785
791 Ga0495614_0066415
792 Ga0495614_0074175
793 Ga0495614_0110374
794 Ga0496106_0202646
795 Ga0496107_0702664
796 Ga0496108_0724913
797 Ga0496108_0951476
798 Ga0496109_0014990
799 Ga0496114_0662749
800 Ga0495678_021542
801 Ga0495678_047869
802 Ga0501031_0435047
803 Ga0501032_0013667
804 Ga0501032_0049773
805 Ga0501033_0056114
806 Ga0501033_0087811
807 Ga0501034_0014978
808 Ga0501034_0026007
809 Ga0501034_0335968
810 Ga0501034_0504750
811 Ga0501036_0008873
812 Ga0501036_0524929
813 Ga0501037_0016175
814 Ga0501037_0069259
815 Ga0501037_0149113
816 Ga0501038_0001319
817 Ga0501038_0052098
818 Ga0501038_0256828
819 Ga0501039_0100742
820 Ga0501039_0240679
821 Ga0501042_0466989
822 Ga0501043_0067362
823 Ga0501043_0072430
824 Ga0501043_0082010
825 Ga0501043_0220607
826 Ga0501046_0030526
827 Ga0501046_0053313
828 Ga0501047_0066970
829 Ga0501047_0191010
830 Ga0501047_0304471
831 Ga0501047_0489215
832 Ga0501048_0014290
833 Ga0501048_0208161
834 Ga0501067_0253403
835 Ga0501069_0568121
836 Ga0501070_0008734
837 Ga0501070_0502564
838 Ga0501073_0263571
839 Ga0501074_0039716
840 Ga0501080_0177448
841 Ga0501083_0311772
842 Ga0501035_0061326
843 Ga0501035_0102811
844 Ga0501035_0111451
845 Ga0501035_0127830
846 Ga0501035_0284293
847 Ga0501044_0002675
848 Ga0501044_0033653
849 Ga0501044_0116187
850 Ga0501044_0160970
851 Ga0501044_0207047
852 Ga0501045_0117478
853 nmdc:mga03n38_518966_c1
854 nmdc:mga06z11_40272_c1
855 nmdc:mga05p37_399420_c1
856 nmdc:mga0qj67_411146_c1
857 nmdc:mga06r32_871646_c1
858 Ga0495601_0530026
859 Ga0495612_0334394
860 Ga0495655_0221858
861 Ga0495619_0078385
862 Ga0500644_0160632
863 Ga0500583_0113539
864 Ga0500640_009114
865 Ga0500660_100873
866 Ga0500560_007449
867 Ga0500572_215003
868 Ga0500600_0205675
869 Ga0590075_002258
870 Ga0466962_0000512
871 Ga0466962_0082632
872 2547406572
873 2585300429
874 2585303591
875 2585317054
876 2616695666
877 2616900789
878 2643760176
879 2643904521
880 2643946517
881 2644268062
882 2644389134
883 2644406211
884 2644434321
885 2644443733
886 2644460128
887 2644629663
888 2676491660
889 2784586785
890 2785345696
891 2785367194
892 2786668242
893 2808847694
894 2808918434
895 2809230352
896 2811847005
897 2812360270
898 2812482382
899 2819696406
900 2819739124
901 2852637757
902 2856747773
903 2862289620
904 2862290444
905 2862390950
906 2862510451
907 2862583688
908 2863406934
909 2867430929
910 2873157650
911 2873321224
912 2875392725
913 2877683353
914 2884696236
915 2891399697
916 2891557484
917 2891564002
918 2895428199
919 2895449590
920 2912722366
921 2912726075
922 2912758924
923 2918502555
924 2919472157
925 2946051989
926 2946065620
927 2946073969
928 2947231793
929 2954011036
930 2954388600
931 2954674525
932 2954689607
933 2954699390
934 2954702829
935 2954718332
936 2954728301
937 2954733509
938 2954747196
939 2954752391
940 2954766309
941 2966604356
942 2990059537
943 2997605639
944 3006395354
945 3006488690
946 3006495187
947 8008561353
948 8008580718
949 8023628553
950 8025534120
951 8048413600
952 8054166878
953 8055067215
954 8055174245
955 8056835667

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11706

zf-CGNR

CGNR zinc finger

177

220

0.99

PF07336

ABATE

Putative stress-induced transcription regulator

50

173

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h0n-assembly1.cif.gz_A-2 crystal structure of a duf1470 family protein (jann_2411) from jannaschia sp. ccs1 at 1.45 a resolution 0.8007 4 179
3h0n-assembly1.cif.gz_A-2 crystal structure of a duf1470 family protein (jann_2411) from jannaschia sp. ccs1 at 1.45 a resolution 0.7652 4 179
6y2c-assembly1.cif.gz_A crystal structure of the third kh domain of fubp1 0.3947 81 134
3j6d-assembly1.cif.gz_a model of the prgh-prgk periplasmic rings 0.3819 83 133
2hh3-assembly1.cif.gz_A solution structure of the third kh domain of ksrp 0.3575 81 130
ID Description Score Start End Superfamily
3h0nA00 Mainly Alpha;Orthogonal Bundle;Jann2411-like fold;Jann2411-like domain 0.7955 4 179 1.10.3300.10
3h0nA00 Mainly Alpha;Orthogonal Bundle;Jann2411-like fold;Jann2411-like domain 0.7678 4 179 1.10.3300.10
4l9hA00 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A; 0.4821 73 102 3.40.1000.30
af_P34298_11_298_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4785 54 133 1.20.140.150
2rldC00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.4761 6 90 1.20.1440.60
ID Description Score Start End GO Terms
AF-A0A370RHI8-F1-model_v4 deleted 0.9587 1 156
AF-A0A1S8CAH2-F1-model_v4 RNA-binding protein 0.9563 1 152
AF-A0A6B3G920-F1-model_v4 Uncharacterized protein 0.9553 1 134
AF-A0A1S8CAH2-F1-model_v4 RNA-binding protein 0.944 1 152
AF-A0A0K8PXJ6-F1-model_v4 DUF1470 domain-containing protein 0.9381 1 186

Map