F451741

General Info

Members Datasets Scaffolds Average Seq Length
477 269 954 290

Family's Representative Sequence

Representative Sequence 3300035692|Ga0373935_0244439|Ga0373935_0244439_108_1139
Length 343
Sequence VIRTSRPSSDNNSLASGFATGIGYHPTENPIQASPEMLTIGSGAEHLKIYLIDGTYELFRHYYALPSARDAQGREVAAVRGVLASVLGMIKEGATHVAVATDHVIESFRNDLWADYKTSEGVEPDLLAQFPLLEEALSTAGIVVWPMVEFEADDALAAAAIAAAQNATVEQVVICTPDKDLAQCVRGNRIVQLNRRTRVIIDEPGVIAKFGVMPASIPDYLALVGDSADGYPGLSGWGAKSSAAVLAKFGHLESIPKDSREWGVKVTSASTLAETLHRDYDNAILFRQLATLRTEIKLFDDLDKLRWNGPTPAYDAIASQLDAAVTQPAADPRKGRSKRTAGV

Samples

Sample ID Description Type Environment
1 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
103 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
104 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
105 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
156 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
159 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
168 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
177 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
178 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
179 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
180 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
181 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
201 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
213 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
260 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
262 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
263 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
264 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.68
Nodule 0
Rhizoplane 2.94
Rhizosphere 94.34
Stem 0
Stem Tuber 0
Unclassified 8.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373935_0244439 3300035692 Bacteria 1254
2 LJNas_1000897 3300000546 Bacteria 4853
3 rootH1_10113718 3300003316 Bacteria 2068
4 JGI25407J50210_10007866 3300003373 Bacteria 2680
5 Ga0065715_10108071 3300005293 Bacteria 2738
6 Ga0070676_10002640 3300005328 Bacteria 9232
7 Ga0070683_100049005 3300005329 Unclassified 3906
8 Ga0070690_100015700 3300005330 Bacteria 4524
9 Ga0070690_100026385 3300005330 Bacteria 3584
10 Ga0070670_100007650 3300005331 Bacteria 9181
11 Ga0068869_100001584 3300005334 Bacteria 13521
12 Ga0070682_100174042 3300005337 Bacteria 1498
13 Ga0068868_100545715 3300005338 Bacteria 1021
14 Ga0070689_100039331 3300005340 Bacteria 3621
15 Ga0070691_10057038 3300005341 Unclassified 1873
16 Ga0070687_100042245 3300005343 Bacteria 2309
17 Ga0070687_100136043 3300005343 Bacteria 1425
18 Ga0070661_100219860 3300005344 Bacteria 1457
19 Ga0070661_100351179 3300005344 Bacteria 1157
20 Ga0070668_100385426 3300005347 Bacteria 1194
21 Ga0070669_100000264 3300005353 Bacteria 42905
22 Ga0070675_100001452 3300005354 Bacteria 17447
23 Ga0070671_100083463 3300005355 Bacteria 2672
24 Ga0070688_100066390 3300005365 Bacteria 2295
25 Ga0070659_100093406 3300005366 Unclassified 2414
26 Ga0070709_10024772 3300005434 Bacteria 3536
27 Ga0070709_10217363 3300005434 Bacteria 1361
28 Ga0070714_100000417 3300005435 Bacteria 31156
29 Ga0070714_100165190 3300005435 Bacteria 2006
30 Ga0070713_100087683 3300005436 Bacteria 2670
31 Ga0070713_100212880 3300005436 Bacteria 1750
32 Ga0070713_100341784 3300005436 Bacteria 1387
33 Ga0070710_10025175 3300005437 Bacteria 3149
34 Ga0070710_10176154 3300005437 Bacteria 1336
35 Ga0070710_10204581 3300005437 Unclassified 1248
36 Ga0070701_10035763 3300005438 Bacteria 2498
37 Ga0070701_10045571 3300005438 Bacteria 2251
38 Ga0070711_100115526 3300005439 Bacteria 1976
39 Ga0070711_100334871 3300005439 Bacteria 1212
40 Ga0070705_100009513 3300005440 Bacteria 4834
41 Ga0070705_100152604 3300005440 Bacteria 1534
42 Ga0070700_100002527 3300005441 Bacteria 9332
43 Ga0070700_100150955 3300005441 Bacteria 1589
44 Ga0070700_100279783 3300005441 Bacteria 1209
45 Ga0070694_100015482 3300005444 Bacteria 4792
46 Ga0070694_100098237 3300005444 Bacteria 2067
47 Ga0070694_100133187 3300005444 Bacteria 1798
48 Ga0070708_100136844 3300005445 Unclassified 2270
49 Ga0070681_10002705 3300005458 Bacteria 16308
50 Ga0070681_10465367 3300005458 Bacteria 1177
51 Ga0068867_100000379 3300005459 Bacteria 29589
52 Ga0068867_100002337 3300005459 Bacteria 13348
53 Ga0070698_100019858 3300005471 Bacteria 7048
54 Ga0070699_100002167 3300005518 Bacteria 17771
55 Ga0070699_100124881 3300005518 Bacteria 2265
56 Ga0070679_100085306 3300005530 Unclassified 3145
57 Ga0070679_100094886 3300005530 Bacteria 2971
58 Ga0070684_100029274 3300005535 Bacteria 4665
59 Ga0070684_100089472 3300005535 Unclassified 2736
60 Ga0068853_100177452 3300005539 Bacteria 1931
61 Ga0070672_100005182 3300005543 Bacteria 8618
62 Ga0070686_100422460 3300005544 Bacteria 1019
63 Ga0070695_100000153 3300005545 Bacteria 32488
64 Ga0070695_100058698 3300005545 Bacteria 2488
65 Ga0070696_100000606 3300005546 Bacteria 23003
66 Ga0070696_100001125 3300005546 Bacteria 17305
67 Ga0070693_100131159 3300005547 Bacteria 1567
68 Ga0070693_100346651 3300005547 Unclassified 1015
69 Ga0070704_100007048 3300005549 Bacteria 6671
70 Ga0070704_100041130 3300005549 Bacteria 3188
71 Ga0070704_100115638 3300005549 Bacteria 2050
72 Ga0068855_100000534 3300005563 Bacteria 46563
73 Ga0068855_100006321 3300005563 Bacteria 14435
74 Ga0070664_100034423 3300005564 Bacteria 4250
75 Ga0068857_100041570 3300005577 Bacteria 4077
76 Ga0068854_100089624 3300005578 Bacteria 2286
77 Ga0068856_100005137 3300005614 Bacteria 12922
78 Ga0068856_100010267 3300005614 Bacteria 9101
79 Ga0068856_100115278 3300005614 Unclassified 2686
80 Ga0070702_100009710 3300005615 Bacteria 4720
81 Ga0068852_100003632 3300005616 Bacteria 10805
82 Ga0068859_100007517 3300005617 Bacteria 11060
83 Ga0068859_100022095 3300005617 Bacteria 6378
84 Ga0068859_100370897 3300005617 Bacteria 1527
85 Ga0068864_100006858 3300005618 Bacteria 9331
86 Ga0068866_10004428 3300005718 Bacteria 5769
87 Ga0068861_100001392 3300005719 Bacteria 15179
88 Ga0068861_100023826 3300005719 Bacteria 4420
89 Ga0068870_10087090 3300005840 Bacteria 1738
90 Ga0068863_100165372 3300005841 Bacteria 2121
91 Ga0068863_100356509 3300005841 Bacteria 1425
92 Ga0068858_100042992 3300005842 Bacteria 4190
93 Ga0068858_100045476 3300005842 Bacteria 4069
94 Ga0068860_100188378 3300005843 Bacteria 1996
95 Ga0068862_100000749 3300005844 Bacteria 32563
96 Ga0081455_10006418 3300005937 Bacteria 12609
97 Ga0081455_10086322 3300005937 Bacteria 2556
98 Ga0081538_10000261 3300005981 Bacteria 59962
99 Ga0081538_10001412 3300005981 Bacteria 24701
100 Ga0081538_10035107 3300005981 Bacteria 3300
101 Ga0070717_10006682 3300006028 Bacteria 8506
102 Ga0070717_10087625 3300006028 Bacteria 2622
103 Ga0075432_10015596 3300006058 Bacteria 2592
104 Ga0070716_100057085 3300006173 Unclassified 2242
105 Ga0070716_100089823 3300006173 Bacteria 1857
106 Ga0070712_100008286 3300006175 Bacteria 6531
107 Ga0075367_10074639 3300006178 Bacteria 2045
108 Ga0097621_100000147 3300006237 Bacteria 42959
109 Ga0097621_100002868 3300006237 Bacteria 11830
110 Ga0097621_100047510 3300006237 Unclassified 3479
111 Ga0068871_100001743 3300006358 Bacteria 14658
112 Ga0068871_100002411 3300006358 Bacteria 12759
113 Ga0068871_100058287 3300006358 Bacteria 3144
114 Ga0068871_100072117 3300006358 Bacteria 2843
115 Ga0075428_100006791 3300006844 Bacteria 12735
116 Ga0075428_100016866 3300006844 Bacteria 8065
117 Ga0075428_100031062 3300006844 Bacteria 5905
118 Ga0075428_100076478 3300006844 Bacteria 3655
119 Ga0075430_100001082 3300006846 Bacteria 21605
120 Ga0075430_100004271 3300006846 Bacteria 12065
121 Ga0075430_100005488 3300006846 Bacteria 10714
122 Ga0075430_100021843 3300006846 Bacteria 5438
123 Ga0075430_100035519 3300006846 Bacteria 4228
124 Ga0075430_100098840 3300006846 Bacteria 2438
125 Ga0075431_100000382 3300006847 Bacteria 35471
126 Ga0075431_100029961 3300006847 Bacteria 5604
127 Ga0075431_100048979 3300006847 Bacteria 4358
128 Ga0075431_100097183 3300006847 Bacteria 3041
129 Ga0075433_10290993 3300006852 Bacteria 1447
130 Ga0075434_100188937 3300006871 Unclassified 2080
131 Ga0075434_100603185 3300006871 Unclassified 1117
132 Ga0075429_100001061 3300006880 Bacteria 21985
133 Ga0075429_100003659 3300006880 Bacteria 13092
134 Ga0075429_100466852 3300006880 Bacteria 1106
135 Ga0068865_100013509 3300006881 Bacteria 5162
136 Ga0068865_100028100 3300006881 Bacteria 3722
137 Ga0075436_100022008 3300006914 Bacteria 4377
138 Ga0097620_100007517 3300006931 Bacteria 11060
139 Ga0097620_100022095 3300006931 Bacteria 6378
140 Ga0097620_100370912 3300006931 Bacteria 1527
141 Ga0075435_100019856 3300007076 Bacteria 5140
142 Ga0075435_100025458 3300007076 Bacteria 4606
143 Ga0075435_100390979 3300007076 Bacteria 1195
144 Ga0105240_10013092 3300009093 Bacteria 11417
145 Ga0105240_10033322 3300009093 Bacteria 6657
146 Ga0111539_10016868 3300009094 Bacteria 9045
147 Ga0111539_10061163 3300009094 Bacteria 4462
148 Ga0111539_10422655 3300009094 Bacteria 1552
149 Ga0105245_10329563 3300009098 Bacteria 1506
150 Ga0114129_10000014 3300009147 Bacteria 130267
151 Ga0114129_10005125 3300009147 Bacteria 18443
152 Ga0114129_10112249 3300009147 Bacteria 3759
153 Ga0114129_10177017 3300009147 Bacteria 2905
154 Ga0114129_10311126 3300009147 Bacteria 2097
155 Ga0114129_10322610 3300009147 Bacteria 2053
156 Ga0105243_10009357 3300009148 Bacteria 7467
157 Ga0105243_10017363 3300009148 Bacteria 5439
158 Ga0105243_10039759 3300009148 Bacteria 3669
159 Ga0105241_10034460 3300009174 Unclassified 3803
160 Ga0105242_10046283 3300009176 Bacteria 3529
161 Ga0105248_10010106 3300009177 Bacteria 10394
162 Ga0105248_10016274 3300009177 Bacteria 8187
163 Ga0105238_10231384 3300009551 Bacteria 1825
164 Ga0105239_10679426 3300010375 Bacteria 1177
165 Ga0105246_10123263 3300011119 Bacteria 1924
166 Ga0157369_10004844 3300013105 Bacteria 15794
167 Ga0157369_10232719 3300013105 Unclassified 1926
168 Ga0157374_10022846 3300013296 Bacteria 5586
169 Ga0157374_10079663 3300013296 Unclassified 3104
170 Ga0157378_10004464 3300013297 Bacteria 12293
171 Ga0157378_10027422 3300013297 Bacteria 5027
172 Ga0157378_10117123 3300013297 Bacteria 2451
173 Ga0157378_10227811 3300013297 Bacteria 1774
174 Ga0157378_10583457 3300013297 Bacteria 1127
175 Ga0163162_10007685 3300013306 Bacteria 10499
176 Ga0157372_10014401 3300013307 Bacteria 8457
177 Ga0157375_10012437 3300013308 Bacteria 7553
178 Ga0157375_10059600 3300013308 Bacteria 3783
179 Ga0163163_10035752 3300014325 Bacteria 4821
180 Ga0163163_10223385 3300014325 Bacteria 1932
181 Ga0157380_10006175 3300014326 Bacteria 8405
182 Ga0157380_10132135 3300014326 Bacteria 2131
183 Ga0157377_10103151 3300014745 Bacteria 1703
184 Ga0157377_10258966 3300014745 Bacteria 1131
185 Ga0157376_10010725 3300014969 Bacteria 6719
186 Ga0157376_10526992 3300014969 Unclassified 1165
187 Ga0182006_1051402 3300015261 Bacteria 1585
188 Ga0224570_100859 3300022730 Unclassified 2428
189 Ga0224572_1013414 3300024225 Bacteria 1562
190 Ga0228598_1001698 3300024227 Bacteria 4819
191 Ga0207426_1030926 3300025302 Bacteria 1751
192 Ga0207653_10017713 3300025885 Bacteria 2242
193 Ga0207682_10020517 3300025893 Bacteria 2594
194 Ga0207642_10003863 3300025899 Bacteria 4776
195 Ga0207647_10095375 3300025904 Bacteria 1771
196 Ga0207685_10008558 3300025905 Bacteria 2922
197 Ga0207699_10131741 3300025906 Bacteria 1632
198 Ga0207699_10172749 3300025906 Bacteria 1447
199 Ga0207645_10003772 3300025907 Bacteria 11384
200 Ga0207643_10098421 3300025908 Bacteria 1712
201 Ga0207654_10106018 3300025911 Bacteria 1740
202 Ga0207707_10010632 3300025912 Bacteria 7993
203 Ga0207707_10167091 3300025912 Unclassified 1923
204 Ga0207695_10020880 3300025913 Bacteria 7484
205 Ga0207695_10124109 3300025913 Bacteria 2547
206 Ga0207693_10012200 3300025915 Bacteria 6942
207 Ga0207693_10016248 3300025915 Bacteria 5952
208 Ga0207693_10122091 3300025915 Bacteria 2046
209 Ga0207663_10098206 3300025916 Bacteria 1960
210 Ga0207663_10261071 3300025916 Unclassified 1279
211 Ga0207660_10012563 3300025917 Bacteria 5545
212 Ga0207660_10167011 3300025917 Bacteria 1701
213 Ga0207662_10014431 3300025918 Bacteria 4434
214 Ga0207649_10147540 3300025920 Unclassified 1616
215 Ga0207652_10460608 3300025921 Unclassified 1146
216 Ga0207681_10003916 3300025923 Bacteria 9233
217 Ga0207694_10007897 3300025924 Bacteria 8055
218 Ga0207659_10018755 3300025926 Bacteria 4540
219 Ga0207659_10092736 3300025926 Bacteria 2259
220 Ga0207687_10165975 3300025927 Bacteria 1698
221 Ga0207700_10015870 3300025928 Bacteria 4984
222 Ga0207700_10025046 3300025928 Bacteria 4137
223 Ga0207700_10358327 3300025928 Bacteria 1271
224 Ga0207664_10021327 3300025929 Bacteria 4814
225 Ga0207664_10057415 3300025929 Bacteria 3093
226 Ga0207664_10359871 3300025929 Unclassified 1289
227 Ga0207690_10247270 3300025932 Unclassified 1376
228 Ga0207686_10122377 3300025934 Bacteria 1773
229 Ga0207709_10004016 3300025935 Bacteria 8575
230 Ga0207709_10085249 3300025935 Bacteria 2048
231 Ga0207670_10040514 3300025936 Bacteria 3058
232 Ga0207670_10100500 3300025936 Bacteria 2065
233 Ga0207704_10005650 3300025938 Bacteria 5777
234 Ga0207665_10000188 3300025939 Bacteria 41567
235 Ga0207665_10008458 3300025939 Bacteria 6782
236 Ga0207665_10094133 3300025939 Bacteria 2080
237 Ga0207691_10023368 3300025940 Bacteria 5819
238 Ga0207691_10213007 3300025940 Bacteria 1678
239 Ga0207691_10481250 3300025940 Bacteria 1055
240 Ga0207689_10003455 3300025942 Bacteria 14431
241 Ga0207661_10042410 3300025944 Unclassified 3587
242 Ga0207679_10186829 3300025945 Bacteria 1719
243 Ga0207667_10004865 3300025949 Bacteria 16403
244 Ga0207667_10041801 3300025949 Bacteria 4874
245 Ga0207651_10090672 3300025960 Bacteria 2235
246 Ga0207668_10054593 3300025972 Bacteria 2774
247 Ga0207640_10072884 3300025981 Bacteria 2318
248 Ga0207640_10263769 3300025981 Bacteria 1344
249 Ga0207640_10304690 3300025981 Bacteria 1262
250 Ga0207708_10019030 3300026075 Bacteria 5171
251 Ga0207708_10331426 3300026075 Bacteria 1244
252 Ga0207702_10002899 3300026078 Bacteria 16048
253 Ga0207641_10037419 3300026088 Bacteria 4052
254 Ga0207641_10113299 3300026088 Bacteria 2408
255 Ga0207641_10142384 3300026088 Bacteria 2165
256 Ga0207641_10371369 3300026088 Bacteria 1368
257 Ga0207648_10000344 3300026089 Bacteria 51064
258 Ga0207648_10001511 3300026089 Bacteria 25628
259 Ga0207676_10048006 3300026095 Unclassified 3312
260 Ga0207674_10007099 3300026116 Bacteria 13088
261 Ga0207674_10047945 3300026116 Bacteria 4377
262 Ga0207675_100004132 3300026118 Bacteria 14051
263 Ga0207675_100009513 3300026118 Bacteria 9093
264 Ga0207428_10001905 3300027907 Bacteria 21121
265 Ga0207428_10010696 3300027907 Bacteria 8184
266 Ga0265356_1000506 3300028017 Bacteria 7036
267 Ga0268265_10001361 3300028380 Bacteria 20828
268 Ga0268265_10461567 3300028380 Unclassified 1189
269 Ga0268264_10463375 3300028381 Bacteria 1230
270 Ga0265319_1068389 3300028563 Unclassified 1141
271 Ga0265762_1000577 3300030760 Bacteria 6466
272 Ga0265762_1009155 3300030760 Bacteria 1766
273 Ga0265760_10000154 3300031090 Bacteria 17770
274 Ga0265760_10004368 3300031090 Bacteria 4061
275 Ga0265340_10031781 3300031247 Bacteria 2638
276 Ga0265339_10016905 3300031249 Bacteria 4334
277 Ga0265339_10022883 3300031249 Unclassified 3615
278 Ga0307408_100119577 3300031548 Bacteria 2039
279 Ga0307408_100157994 3300031548 Bacteria 1798
280 Ga0265314_10160116 3300031711 Bacteria 1371
281 Ga0265314_10220215 3300031711 Bacteria 1108
282 Ga0307410_10015047 3300031852 Bacteria 4576
283 Ga0307410_10020259 3300031852 Bacteria 4064
284 Ga0307410_10255928 3300031852 Bacteria 1363
285 Ga0307416_100015243 3300032002 Bacteria 5302
286 Ga0307416_100260816 3300032002 Bacteria 1694
287 Ga0307414_10110351 3300032004 Bacteria 2092
288 Ga0307411_10016206 3300032005 Bacteria 4215
289 Ga0307411_10107226 3300032005 Bacteria 1990
290 Ga0307411_10598910 3300032005 Bacteria 947
291 Ga0307415_100080248 3300032126 Bacteria 2327
292 Ga0316214_1001674 3300033545 Unclassified 2631
293 Ga0373936_0080890 3300035113 Bacteria 1352
294 Ga0373943_0031450 3300035170 Bacteria 2518
295 Ga0373931_0114723 3300035691 Bacteria 1533
296 Ga0373935_0008519 3300035692 Bacteria 6138
297 Ga0373927_0142235 3300035695 Bacteria 1569
298 Ga0373947_0021993 3300035725 Bacteria 3696
299 Ga0373937_0181245 3300036401 Bacteria 1978
300 Ga0373925_0004573 3300037068 Bacteria 10455
301 Ga0373925_0013356 3300037068 Bacteria 5943
302 Ga0373925_0016278 3300037068 Bacteria 5383
303 Ga0373925_0028059 3300037068 Unclassified 4123
304 Ga0395898_0253062 3300037466 Bacteria 1680
305 Ga0400483_223030 3300039062 Bacteria 7944
306 Ga0436360_0072150 3300039438 Bacteria 2296
307 Ga0439443_016911 3300042003 Bacteria 1118
308 Ga0439450_032797 3300042008 Bacteria 1174
309 Ga0439463_001828 3300042016 Bacteria 5523
310 Ga0439444_0018080 3300042437 Bacteria 1217
311 Ga0453683_0029870 3300044673 Bacteria 3445
312 Ga0466963_0257456 3300044694 Unclassified 1225
313 Ga0466963_0389568 3300044694 Bacteria 982
314 Ga0466957_0520606 3300044842 Bacteria 826
315 Ga0466959_0181148 3300045049 Bacteria 1473
316 Ga0451576_0527141 3300045051 Bacteria 1241
317 Ga0466967_0001080 3300045976 Bacteria 15092
318 Ga0466967_0116763 3300045976 Bacteria 2459
319 Ga0495603_0009651 3300046455 Bacteria 5837
320 Ga0495651_0021369 3300046462 Bacteria 5030
321 Ga0495580_0002722 3300046472 Bacteria 15271
322 Ga0495580_0003043 3300046472 Bacteria 14356
323 Ga0495580_0057556 3300046472 Unclassified 2736
324 Ga0495580_0165814 3300046472 Bacteria 1528
325 Ga0495582_0000811 3300046473 Bacteria 17357
326 Ga0495585_0019975 3300046492 Bacteria 3854
327 Ga0495594_0000127 3300046499 Bacteria 35752
328 Ga0495596_0023659 3300046500 Bacteria 2491
329 Ga0495618_0023614 3300046514 Bacteria 3804
330 Ga0495630_0027027 3300046517 Bacteria 4253
331 Ga0495630_0050370 3300046517 Bacteria 3117
332 Ga0495644_0000059 3300046523 Bacteria 53320
333 Ga0495665_0014245 3300046531 Bacteria 4290
334 Ga0495665_0129809 3300046531 Bacteria 1319
335 Ga0495640_0030735 3300046533 Bacteria 3842
336 Ga0495586_0032984 3300046535 Bacteria 2778
337 Ga0495621_0007907 3300046539 Bacteria 3165
338 Ga0495667_0020477 3300046559 Bacteria 4463
339 Ga0495668_0019669 3300046616 Bacteria 3890
340 Ga0495634_0005181 3300046642 Bacteria 10073
341 Ga0495625_0057308 3300046660 Bacteria 2771
342 Ga0495669_0040463 3300046684 Bacteria 2067
343 Ga0495613_0002438 3300046689 Bacteria 14034
344 Ga0495589_0123443 3300046794 Bacteria 1246
345 Ga0495600_0166041 3300046809 Bacteria 1426
346 Ga0495581_0068483 3300047315 Bacteria 2052
347 Ga0495604_0067057 3300047317 Bacteria 2728
348 Ga0495636_0070587 3300047318 Bacteria 1490
349 Ga0495636_0113024 3300047318 Unclassified 1196
350 Ga0495677_0023392 3300047445 Bacteria 2243
351 Ga0496102_0076064 3300048905 Unclassified 3087
352 Ga0496104_0240971 3300048907 Bacteria 1721
353 Ga0496104_0563702 3300048907 Bacteria 1050
354 Ga0496106_0137094 3300048909 Bacteria 1923
355 Ga0496108_0000098 3300048911 Bacteria 90200
356 Ga0496108_0396441 3300048911 Bacteria 1205
357 Ga0496109_0359197 3300048912 Bacteria 1376
358 Ga0496110_0171555 3300048913 Bacteria 1968
359 Ga0496110_0357175 3300048913 Bacteria 1331
360 Ga0496112_0004189 3300048915 Bacteria 12150
361 Ga0496112_0106368 3300048915 Unclassified 2776
362 Ga0496113_0173793 3300048916 Bacteria 1706
363 Ga0496114_0462457 3300048917 Bacteria 1123
364 Ga0496115_0315219 3300048918 Bacteria 1280
365 Ga0496126_0000575 3300048929 Bacteria 70082
366 Ga0496126_0002908 3300048929 Bacteria 22313
367 Ga0501031_0094023 3300049568 Bacteria 1956
368 Ga0501031_0306771 3300049568 Bacteria 1028
369 Ga0501033_0009810 3300049570 Bacteria 7350
370 Ga0501036_0001434 3300049572 Bacteria 18324
371 Ga0501036_0005326 3300049572 Bacteria 10409
372 Ga0501037_0142340 3300049573 Bacteria 1716
373 Ga0501038_0110224 3300049574 Bacteria 2281
374 Ga0501039_0016652 3300049575 Bacteria 5631
375 Ga0501039_0042084 3300049575 Bacteria 3530
376 Ga0501039_0043979 3300049575 Bacteria 3450
377 Ga0501039_0137964 3300049575 Bacteria 1915
378 Ga0501040_0009525 3300049576 Bacteria 6336
379 Ga0501040_0009897 3300049576 Bacteria 6224
380 Ga0501040_0039541 3300049576 Bacteria 3208
381 Ga0501040_0183432 3300049576 Bacteria 1484
382 Ga0501041_0045290 3300049577 Bacteria 2674
383 Ga0501041_0046903 3300049577 Bacteria 2629
384 Ga0501042_0004919 3300049578 Bacteria 8555
385 Ga0501042_0027851 3300049578 Bacteria 3975
386 Ga0501043_0198473 3300049579 Bacteria 1558
387 Ga0501046_0033470 3300049580 Bacteria 4152
388 Ga0501046_0068235 3300049580 Bacteria 2768
389 Ga0501046_0085489 3300049580 Bacteria 2432
390 Ga0501048_0009000 3300049582 Bacteria 7516
391 Ga0501048_0088273 3300049582 Bacteria 2187
392 Ga0501048_0107775 3300049582 Bacteria 1967
393 Ga0501070_0262743 3300049586 Bacteria 1411
394 Ga0501070_0316413 3300049586 Bacteria 1270
395 Ga0501071_0098649 3300049587 Bacteria 2152
396 Ga0501072_0018729 3300049588 Bacteria 5337
397 Ga0501072_0019359 3300049588 Bacteria 5261
398 Ga0501072_0189195 3300049588 Bacteria 1642
399 Ga0501072_0210475 3300049588 Bacteria 1549
400 Ga0501072_0329183 3300049588 Bacteria 1214
401 Ga0501075_0034462 3300049591 Bacteria 3770
402 Ga0501075_0037802 3300049591 Bacteria 3608
403 Ga0501075_0052686 3300049591 Bacteria 3059
404 Ga0501075_0098002 3300049591 Bacteria 2225
405 Ga0501075_0286805 3300049591 Bacteria 1254
406 Ga0501076_0015150 3300049592 Bacteria 5822
407 Ga0501076_0025031 3300049592 Unclassified 4617
408 Ga0501076_0051913 3300049592 Bacteria 3246
409 Ga0501076_0143988 3300049592 Bacteria 1937
410 Ga0501077_0040821 3300049593 Bacteria 2954
411 Ga0501077_0041383 3300049593 Bacteria 2933
412 Ga0501079_0002044 3300049741 Bacteria 14455
413 Ga0501079_0012891 3300049741 Bacteria 6380
414 Ga0501079_0036381 3300049741 Bacteria 3793
415 Ga0501079_0064513 3300049741 Unclassified 2825
416 Ga0501080_0236660 3300049742 Bacteria 1668
417 Ga0501080_0260849 3300049742 Bacteria 1579
418 Ga0501081_0004219 3300049743 Bacteria 9213
419 Ga0501083_0350499 3300049744 Bacteria 960
420 Ga0501044_0061610 3300049823 Bacteria 3838
421 Ga0501045_0004936 3300049824 Bacteria 9240
422 Ga0501045_0011568 3300049824 Bacteria 6197
423 Ga0501045_0098220 3300049824 Bacteria 2166
424 nmdc:mga06z11_115837_c1 3300050494 Bacteria 1489
425 nmdc:mga06z11_24489_c1 3300050494 Bacteria 2848
426 nmdc:mga05p37_159946_c1 3300050507 Bacteria 2751
427 nmdc:mga05p37_257_c1 3300050507 Bacteria 54851
428 nmdc:mga05p37_280725_c1 3300050507 Bacteria 1986
429 nmdc:mga05p37_409287_c1 3300050507 Bacteria 1581
430 nmdc:mga09592_122513_c1 3300050508 Bacteria 2234
431 nmdc:mga09592_231674_c1 3300050508 Bacteria 1600
432 nmdc:mga09592_291228_c1 3300050508 Bacteria 1415
433 nmdc:mga09592_537033_c1 3300050508 Bacteria 1005
434 nmdc:mga09592_8206_c1 3300050508 Bacteria 8490
435 nmdc:mga09592_961_c1 3300050508 Bacteria 22726
436 nmdc:mga0qj67_21855_c1 3300050509 Bacteria 4909
437 nmdc:mga0qj67_249888_c1 3300050509 Bacteria 1439
438 nmdc:mga0qj67_289_c1 3300050509 Bacteria 35087
439 nmdc:mga0qj67_4031_c1 3300050509 Bacteria 10633
440 nmdc:mga0qj67_49534_c1 3300050509 Bacteria 3320
441 nmdc:mga06r32_107915_c1 3300050510 Bacteria 2737
442 nmdc:mga06r32_2804_c1 3300050510 Bacteria 15615
443 nmdc:mga06r32_556648_c1 3300050510 Bacteria 1120
444 nmdc:mga06r32_58495_c1 3300050510 Bacteria 3704
445 nmdc:mga06r32_681457_c1 3300050510 Bacteria 995
446 nmdc:mga06r32_735_c1 3300050510 Bacteria 28720
447 nmdc:mga08y16_12291_c1 3300050511 Bacteria 9001
448 nmdc:mga08y16_298035_c1 3300050511 Bacteria 1662
449 nmdc:mga08y16_3479_c1 3300050511 Bacteria 16338
450 nmdc:mga08y16_63262_c1 3300050511 Bacteria 3864
451 nmdc:mga0n895_279690_c1 3300050512 Unclassified 1692
452 nmdc:mga0n895_689926_c1 3300050512 Unclassified 1018
453 nmdc:mga0rr50_23342_c1 3300050513 Bacteria 4264
454 nmdc:mga0rr50_57131_c1 3300050513 Bacteria 2918
455 nmdc:mga08x19_54952_c1 3300050514 Bacteria 2565
456 nmdc:mga0a205_384305_c1 3300050515 Bacteria 1269
457 nmdc:mga0a205_396940_c1 3300050515 Bacteria 1243
458 nmdc:mga0a205_7085_c1 3300050515 Bacteria 6593
459 Ga0495612_0121443 3300053078 Bacteria 1124
460 Ga0495595_0015041 3300053084 Bacteria 3294
461 Ga0495619_0019539 3300053085 Bacteria 4309
462 Ga0495619_0169519 3300053085 Bacteria 1509
463 Ga0500555_000212 3300053103 Bacteria 27048
464 Ga0500616_0003378 3300053153 Bacteria 12258
465 Ga0500616_0007181 3300053153 Bacteria 7122
466 Ga0500645_000201 3300053730 Bacteria 46162
467 Ga0501084_0009142 3300054114 Bacteria 8197
468 Ga0501084_0019855 3300054114 Bacteria 5600
469 Ga0590075_020221 3300059424 Bacteria 1657
470 Ga0590077_007909 3300059426 Bacteria 2174
471 Ga0501082_0008031 3300060353 Bacteria 9109
472 Ga0501082_0041152 3300060353 Bacteria 3984
473 Ga0530510_0002383 3300061734 Bacteria 12930
474 Ga0530510_0013520 3300061734 Bacteria 5740
475 Ga0530510_0072784 3300061734 Bacteria 2494
476 Ga0530510_0084531 3300061734 Bacteria 2311
477 Ga0530510_0352656 3300061734 Bacteria 1105
478 Ga0373935_0244439
479 LJNas_1000897
480 rootH1_10113718
481 JGI25407J50210_10007866
482 Ga0065715_10108071
483 Ga0070676_10002640
484 Ga0070683_100049005
485 Ga0070690_100015700
486 Ga0070690_100026385
487 Ga0070670_100007650
488 Ga0068869_100001584
489 Ga0070682_100174042
490 Ga0068868_100545715
491 Ga0070689_100039331
492 Ga0070691_10057038
493 Ga0070687_100042245
494 Ga0070687_100136043
495 Ga0070661_100219860
496 Ga0070661_100351179
497 Ga0070668_100385426
498 Ga0070669_100000264
499 Ga0070675_100001452
500 Ga0070671_100083463
501 Ga0070688_100066390
502 Ga0070659_100093406
503 Ga0070709_10024772
504 Ga0070709_10217363
505 Ga0070714_100000417
506 Ga0070714_100165190
507 Ga0070713_100087683
508 Ga0070713_100212880
509 Ga0070713_100341784
510 Ga0070710_10025175
511 Ga0070710_10176154
512 Ga0070710_10204581
513 Ga0070701_10035763
514 Ga0070701_10045571
515 Ga0070711_100115526
516 Ga0070711_100334871
517 Ga0070705_100009513
518 Ga0070705_100152604
519 Ga0070700_100002527
520 Ga0070700_100150955
521 Ga0070700_100279783
522 Ga0070694_100015482
523 Ga0070694_100098237
524 Ga0070694_100133187
525 Ga0070708_100136844
526 Ga0070681_10002705
527 Ga0070681_10465367
528 Ga0068867_100000379
529 Ga0068867_100002337
530 Ga0070698_100019858
531 Ga0070699_100002167
532 Ga0070699_100124881
533 Ga0070679_100085306
534 Ga0070679_100094886
535 Ga0070684_100029274
536 Ga0070684_100089472
537 Ga0068853_100177452
538 Ga0070672_100005182
539 Ga0070686_100422460
540 Ga0070695_100000153
541 Ga0070695_100058698
542 Ga0070696_100000606
543 Ga0070696_100001125
544 Ga0070693_100131159
545 Ga0070693_100346651
546 Ga0070704_100007048
547 Ga0070704_100041130
548 Ga0070704_100115638
549 Ga0068855_100000534
550 Ga0068855_100006321
551 Ga0070664_100034423
552 Ga0068857_100041570
553 Ga0068854_100089624
554 Ga0068856_100005137
555 Ga0068856_100010267
556 Ga0068856_100115278
557 Ga0070702_100009710
558 Ga0068852_100003632
559 Ga0068859_100007517
560 Ga0068859_100022095
561 Ga0068859_100370897
562 Ga0068864_100006858
563 Ga0068866_10004428
564 Ga0068861_100001392
565 Ga0068861_100023826
566 Ga0068870_10087090
567 Ga0068863_100165372
568 Ga0068863_100356509
569 Ga0068858_100042992
570 Ga0068858_100045476
571 Ga0068860_100188378
572 Ga0068862_100000749
573 Ga0081455_10006418
574 Ga0081455_10086322
575 Ga0081538_10000261
576 Ga0081538_10001412
577 Ga0081538_10035107
578 Ga0070717_10006682
579 Ga0070717_10087625
580 Ga0075432_10015596
581 Ga0070716_100057085
582 Ga0070716_100089823
583 Ga0070712_100008286
584 Ga0075367_10074639
585 Ga0097621_100000147
586 Ga0097621_100002868
587 Ga0097621_100047510
588 Ga0068871_100001743
589 Ga0068871_100002411
590 Ga0068871_100058287
591 Ga0068871_100072117
592 Ga0075428_100006791
593 Ga0075428_100016866
594 Ga0075428_100031062
595 Ga0075428_100076478
596 Ga0075430_100001082
597 Ga0075430_100004271
598 Ga0075430_100005488
599 Ga0075430_100021843
600 Ga0075430_100035519
601 Ga0075430_100098840
602 Ga0075431_100000382
603 Ga0075431_100029961
604 Ga0075431_100048979
605 Ga0075431_100097183
606 Ga0075433_10290993
607 Ga0075434_100188937
608 Ga0075434_100603185
609 Ga0075429_100001061
610 Ga0075429_100003659
611 Ga0075429_100466852
612 Ga0068865_100013509
613 Ga0068865_100028100
614 Ga0075436_100022008
615 Ga0097620_100007517
616 Ga0097620_100022095
617 Ga0097620_100370912
618 Ga0075435_100019856
619 Ga0075435_100025458
620 Ga0075435_100390979
621 Ga0105240_10013092
622 Ga0105240_10033322
623 Ga0111539_10016868
624 Ga0111539_10061163
625 Ga0111539_10422655
626 Ga0105245_10329563
627 Ga0114129_10000014
628 Ga0114129_10005125
629 Ga0114129_10112249
630 Ga0114129_10177017
631 Ga0114129_10311126
632 Ga0114129_10322610
633 Ga0105243_10009357
634 Ga0105243_10017363
635 Ga0105243_10039759
636 Ga0105241_10034460
637 Ga0105242_10046283
638 Ga0105248_10010106
639 Ga0105248_10016274
640 Ga0105238_10231384
641 Ga0105239_10679426
642 Ga0105246_10123263
643 Ga0157369_10004844
644 Ga0157369_10232719
645 Ga0157374_10022846
646 Ga0157374_10079663
647 Ga0157378_10004464
648 Ga0157378_10027422
649 Ga0157378_10117123
650 Ga0157378_10227811
651 Ga0157378_10583457
652 Ga0163162_10007685
653 Ga0157372_10014401
654 Ga0157375_10012437
655 Ga0157375_10059600
656 Ga0163163_10035752
657 Ga0163163_10223385
658 Ga0157380_10006175
659 Ga0157380_10132135
660 Ga0157377_10103151
661 Ga0157377_10258966
662 Ga0157376_10010725
663 Ga0157376_10526992
664 Ga0182006_1051402
665 Ga0224570_100859
666 Ga0224572_1013414
667 Ga0228598_1001698
668 Ga0207426_1030926
669 Ga0207653_10017713
670 Ga0207682_10020517
671 Ga0207642_10003863
672 Ga0207647_10095375
673 Ga0207685_10008558
674 Ga0207699_10131741
675 Ga0207699_10172749
676 Ga0207645_10003772
677 Ga0207643_10098421
678 Ga0207654_10106018
679 Ga0207707_10010632
680 Ga0207707_10167091
681 Ga0207695_10020880
682 Ga0207695_10124109
683 Ga0207693_10012200
684 Ga0207693_10016248
685 Ga0207693_10122091
686 Ga0207663_10098206
687 Ga0207663_10261071
688 Ga0207660_10012563
689 Ga0207660_10167011
690 Ga0207662_10014431
691 Ga0207649_10147540
692 Ga0207652_10460608
693 Ga0207681_10003916
694 Ga0207694_10007897
695 Ga0207659_10018755
696 Ga0207659_10092736
697 Ga0207687_10165975
698 Ga0207700_10015870
699 Ga0207700_10025046
700 Ga0207700_10358327
701 Ga0207664_10021327
702 Ga0207664_10057415
703 Ga0207664_10359871
704 Ga0207690_10247270
705 Ga0207686_10122377
706 Ga0207709_10004016
707 Ga0207709_10085249
708 Ga0207670_10040514
709 Ga0207670_10100500
710 Ga0207704_10005650
711 Ga0207665_10000188
712 Ga0207665_10008458
713 Ga0207665_10094133
714 Ga0207691_10023368
715 Ga0207691_10213007
716 Ga0207691_10481250
717 Ga0207689_10003455
718 Ga0207661_10042410
719 Ga0207679_10186829
720 Ga0207667_10004865
721 Ga0207667_10041801
722 Ga0207651_10090672
723 Ga0207668_10054593
724 Ga0207640_10072884
725 Ga0207640_10263769
726 Ga0207640_10304690
727 Ga0207708_10019030
728 Ga0207708_10331426
729 Ga0207702_10002899
730 Ga0207641_10037419
731 Ga0207641_10113299
732 Ga0207641_10142384
733 Ga0207641_10371369
734 Ga0207648_10000344
735 Ga0207648_10001511
736 Ga0207676_10048006
737 Ga0207674_10007099
738 Ga0207674_10047945
739 Ga0207675_100004132
740 Ga0207675_100009513
741 Ga0207428_10001905
742 Ga0207428_10010696
743 Ga0265356_1000506
744 Ga0268265_10001361
745 Ga0268265_10461567
746 Ga0268264_10463375
747 Ga0265319_1068389
748 Ga0265762_1000577
749 Ga0265762_1009155
750 Ga0265760_10000154
751 Ga0265760_10004368
752 Ga0265340_10031781
753 Ga0265339_10016905
754 Ga0265339_10022883
755 Ga0307408_100119577
756 Ga0307408_100157994
757 Ga0265314_10160116
758 Ga0265314_10220215
759 Ga0307410_10015047
760 Ga0307410_10020259
761 Ga0307410_10255928
762 Ga0307416_100015243
763 Ga0307416_100260816
764 Ga0307414_10110351
765 Ga0307411_10016206
766 Ga0307411_10107226
767 Ga0307411_10598910
768 Ga0307415_100080248
769 Ga0316214_1001674
770 Ga0373936_0080890
771 Ga0373943_0031450
772 Ga0373931_0114723
773 Ga0373935_0008519
774 Ga0373927_0142235
775 Ga0373947_0021993
776 Ga0373937_0181245
777 Ga0373925_0004573
778 Ga0373925_0013356
779 Ga0373925_0016278
780 Ga0373925_0028059
781 Ga0395898_0253062
782 Ga0400483_223030
783 Ga0436360_0072150
784 Ga0439443_016911
785 Ga0439450_032797
786 Ga0439463_001828
787 Ga0439444_0018080
788 Ga0453683_0029870
789 Ga0466963_0257456
790 Ga0466963_0389568
791 Ga0466957_0520606
792 Ga0466959_0181148
793 Ga0451576_0527141
794 Ga0466967_0001080
795 Ga0466967_0116763
796 Ga0495603_0009651
797 Ga0495651_0021369
798 Ga0495580_0002722
799 Ga0495580_0003043
800 Ga0495580_0057556
801 Ga0495580_0165814
802 Ga0495582_0000811
803 Ga0495585_0019975
804 Ga0495594_0000127
805 Ga0495596_0023659
806 Ga0495618_0023614
807 Ga0495630_0027027
808 Ga0495630_0050370
809 Ga0495644_0000059
810 Ga0495665_0014245
811 Ga0495665_0129809
812 Ga0495640_0030735
813 Ga0495586_0032984
814 Ga0495621_0007907
815 Ga0495667_0020477
816 Ga0495668_0019669
817 Ga0495634_0005181
818 Ga0495625_0057308
819 Ga0495669_0040463
820 Ga0495613_0002438
821 Ga0495589_0123443
822 Ga0495600_0166041
823 Ga0495581_0068483
824 Ga0495604_0067057
825 Ga0495636_0070587
826 Ga0495636_0113024
827 Ga0495677_0023392
828 Ga0496102_0076064
829 Ga0496104_0240971
830 Ga0496104_0563702
831 Ga0496106_0137094
832 Ga0496108_0000098
833 Ga0496108_0396441
834 Ga0496109_0359197
835 Ga0496110_0171555
836 Ga0496110_0357175
837 Ga0496112_0004189
838 Ga0496112_0106368
839 Ga0496113_0173793
840 Ga0496114_0462457
841 Ga0496115_0315219
842 Ga0496126_0000575
843 Ga0496126_0002908
844 Ga0501031_0094023
845 Ga0501031_0306771
846 Ga0501033_0009810
847 Ga0501036_0001434
848 Ga0501036_0005326
849 Ga0501037_0142340
850 Ga0501038_0110224
851 Ga0501039_0016652
852 Ga0501039_0042084
853 Ga0501039_0043979
854 Ga0501039_0137964
855 Ga0501040_0009525
856 Ga0501040_0009897
857 Ga0501040_0039541
858 Ga0501040_0183432
859 Ga0501041_0045290
860 Ga0501041_0046903
861 Ga0501042_0004919
862 Ga0501042_0027851
863 Ga0501043_0198473
864 Ga0501046_0033470
865 Ga0501046_0068235
866 Ga0501046_0085489
867 Ga0501048_0009000
868 Ga0501048_0088273
869 Ga0501048_0107775
870 Ga0501070_0262743
871 Ga0501070_0316413
872 Ga0501071_0098649
873 Ga0501072_0018729
874 Ga0501072_0019359
875 Ga0501072_0189195
876 Ga0501072_0210475
877 Ga0501072_0329183
878 Ga0501075_0034462
879 Ga0501075_0037802
880 Ga0501075_0052686
881 Ga0501075_0098002
882 Ga0501075_0286805
883 Ga0501076_0015150
884 Ga0501076_0025031
885 Ga0501076_0051913
886 Ga0501076_0143988
887 Ga0501077_0040821
888 Ga0501077_0041383
889 Ga0501079_0002044
890 Ga0501079_0012891
891 Ga0501079_0036381
892 Ga0501079_0064513
893 Ga0501080_0236660
894 Ga0501080_0260849
895 Ga0501081_0004219
896 Ga0501083_0350499
897 Ga0501044_0061610
898 Ga0501045_0004936
899 Ga0501045_0011568
900 Ga0501045_0098220
901 nmdc:mga06z11_115837_c1
902 nmdc:mga06z11_24489_c1
903 nmdc:mga05p37_159946_c1
904 nmdc:mga05p37_257_c1
905 nmdc:mga05p37_280725_c1
906 nmdc:mga05p37_409287_c1
907 nmdc:mga09592_122513_c1
908 nmdc:mga09592_231674_c1
909 nmdc:mga09592_291228_c1
910 nmdc:mga09592_537033_c1
911 nmdc:mga09592_8206_c1
912 nmdc:mga09592_961_c1
913 nmdc:mga0qj67_21855_c1
914 nmdc:mga0qj67_249888_c1
915 nmdc:mga0qj67_289_c1
916 nmdc:mga0qj67_4031_c1
917 nmdc:mga0qj67_49534_c1
918 nmdc:mga06r32_107915_c1
919 nmdc:mga06r32_2804_c1
920 nmdc:mga06r32_556648_c1
921 nmdc:mga06r32_58495_c1
922 nmdc:mga06r32_681457_c1
923 nmdc:mga06r32_735_c1
924 nmdc:mga08y16_12291_c1
925 nmdc:mga08y16_298035_c1
926 nmdc:mga08y16_3479_c1
927 nmdc:mga08y16_63262_c1
928 nmdc:mga0n895_279690_c1
929 nmdc:mga0n895_689926_c1
930 nmdc:mga0rr50_23342_c1
931 nmdc:mga0rr50_57131_c1
932 nmdc:mga08x19_54952_c1
933 nmdc:mga0a205_384305_c1
934 nmdc:mga0a205_396940_c1
935 nmdc:mga0a205_7085_c1
936 Ga0495612_0121443
937 Ga0495595_0015041
938 Ga0495619_0019539
939 Ga0495619_0169519
940 Ga0500555_000212
941 Ga0500616_0003378
942 Ga0500616_0007181
943 Ga0500645_000201
944 Ga0501084_0009142
945 Ga0501084_0019855
946 Ga0590075_020221
947 Ga0590077_007909
948 Ga0501082_0008031
949 Ga0501082_0041152
950 Ga0530510_0002383
951 Ga0530510_0013520
952 Ga0530510_0072784
953 Ga0530510_0084531
954 Ga0530510_0352656

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01367

5_3_exonuc

5'-3' exonuclease, C-terminal SAM fold

212

313

0.91

PF02739

5_3_exonuc_N

5'-3' exonuclease, N-terminal resolvase-like domain

48

211

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zde-assembly1.cif.gz_A potassium free structure of e. coli exoix 0.862 1 261
3zdc-assembly1.cif.gz_A structure of e. coli exoix in complex with the palindromic 5ov4 dna oligonucleotide, potassium and calcium 0.8553 1 260
3zdb-assembly1.cif.gz_A-2 structure of e. coli exoix in complex with the palindromic 5ov4 dna oligonucleotide, di-magnesium and potassium 0.8528 1 261
3zda-assembly1.cif.gz_A structure of e. coli exoix in complex with a fragment of the flap1 dna oligonucleotide, potassium and magnesium 0.8515 1 261
3zd8-assembly2.cif.gz_B potassium bound structure of e. coli exoix in p1 0.8496 1 260
ID Description Score Start End Superfamily
af_P00582_2_172_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9066 3 167 3.40.50.1010
af_Q8I7W9_262_459_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8683 2 165 3.40.50.1010
af_P00582_2_172_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8666 3 167 3.40.50.1010
af_Q2FYJ1_1_174_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8634 2 166 3.40.50.1010
af_Q2FXN9_173_262_1.10.150.20 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.8437 170 258 1.10.150.20
ID Description Score Start End GO Terms
AF-A0A2V8I4R1-F1-model_v4 Flap endonuclease 0.9916 1 147 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A1Q7XPG7-F1-model_v4 Flap endonuclease 0.9909 35 264 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A7V8YLT2-F1-model_v4 Flap endonuclease 0.9906 1 205 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A537H256-F1-model_v4 Flap endonuclease 0.9902 1 172 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A6N8WWV0-F1-model_v4 Flap endonuclease 0.9895 1 277 GO:0003677
GO:0008409
GO:0017108
GO:0033567

Map