F451725

General Info

Members Datasets Scaffolds Average Seq Length
477 272 477 197

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100379021|Ga0207675_1003790212
Length 228
Sequence MFPASCGAMGRRRYYSPPMEAHERTEKLAASPPLFKSEFLNFFSRVHPAVPAVIFVPVVVAMEWLGVDRGYGVLSTILLTLAGIGIWTLTEYWLHRLVFHWEPDNALGRRMHFIIHGIHHDHPNDKLRLVMPPSVSIPLAAIFFFGFWAILGDAAFPVFAGFILGYLFYDYTHYYVHHFVPRTDFGKRLREHHMRXXXQDHRYGYGVSSPLWDHVFRTYPRKRSKYRQ

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
135 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
136 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
137 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
138 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
141 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
142 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
143 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
189 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
190 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
201 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
209 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
263 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
264 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
265 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
268 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
269 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
272 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.94
Nodule 0
Rhizoplane 9.64
Rhizosphere 85.95
Stem 0
Stem Tuber 0
Unclassified 1.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004061 3300001979 Bacteria 6334
2 JGI24744J21845_10043465 3300002077 Bacteria 837
3 JGI25404J52841_10020320 3300003659 Unclassified 1438
4 Ga0070683_100005990 3300005329 Bacteria 10184
5 Ga0070683_100006807 3300005329 Bacteria 9604
6 Ga0070683_100053256 3300005329 Bacteria 3750
7 Ga0070690_100039142 3300005330 Bacteria 2995
8 Ga0070677_10000013 3300005333 Bacteria 53677
9 Ga0070666_10140581 3300005335 Bacteria 1681
10 Ga0070680_100224500 3300005336 Bacteria 1586
11 Ga0070682_100000077 3300005337 Bacteria 89055
12 Ga0070682_100001703 3300005337 Bacteria 12223
13 Ga0070682_100178220 3300005337 Bacteria 1482
14 Ga0070682_100369028 3300005337 Bacteria 1076
15 Ga0068868_100001566 3300005338 Bacteria 15608
16 Ga0070691_10000014 3300005341 Bacteria 50487
17 Ga0070661_100000005 3300005344 Bacteria 220455
18 Ga0070668_100024702 3300005347 Bacteria 4554
19 Ga0070669_100134435 3300005353 Bacteria 1901
20 Ga0070675_100000008 3300005354 Bacteria 250004
21 Ga0070674_100000001 3300005356 Bacteria 277173
22 Ga0070674_100000063 3300005356 Bacteria 47714
23 Ga0070673_100002647 3300005364 Bacteria 10955
24 Ga0070673_100311210 3300005364 Bacteria 1389
25 Ga0070688_100000022 3300005365 Bacteria 71190
26 Ga0070688_100000209 3300005365 Bacteria 30882
27 Ga0070688_100154740 3300005365 Unclassified 1570
28 Ga0070688_100337361 3300005365 Bacteria 1100
29 Ga0070667_100017503 3300005367 Bacteria 5940
30 Ga0070667_100489797 3300005367 Bacteria 1126
31 Ga0070703_10030567 3300005406 Bacteria 1623
32 Ga0070713_100000022 3300005436 Bacteria 102527
33 Ga0070713_100178874 3300005436 Bacteria 1905
34 Ga0070701_10617311 3300005438 Unclassified 720
35 Ga0070711_100142328 3300005439 Bacteria 1799
36 Ga0070705_100343305 3300005440 Bacteria 1086
37 Ga0070708_100608365 3300005445 Bacteria 1030
38 Ga0070678_100016588 3300005456 Bacteria 4717
39 Ga0070678_100040663 3300005456 Bacteria 3291
40 Ga0070662_100000038 3300005457 Bacteria 75003
41 Ga0068867_100000814 3300005459 Bacteria 21051
42 Ga0070685_10000037 3300005466 Bacteria 80557
43 Ga0070685_10000047 3300005466 Bacteria 72690
44 Ga0070685_10161879 3300005466 Bacteria 1427
45 Ga0070706_100248144 3300005467 Unclassified 1662
46 Ga0070679_100000069 3300005530 Bacteria 76557
47 Ga0070684_100025703 3300005535 Bacteria 4952
48 Ga0070684_100234554 3300005535 Bacteria 1676
49 Ga0070684_100314218 3300005535 Bacteria 1439
50 Ga0070684_100466192 3300005535 Bacteria 1168
51 Ga0068853_100003809 3300005539 Bacteria 11559
52 Ga0070672_100000058 3300005543 Bacteria 49964
53 Ga0070686_100020781 3300005544 Bacteria 3891
54 Ga0070693_100004639 3300005547 Bacteria 6523
55 Ga0070665_100000068 3300005548 Bacteria 204531
56 Ga0070704_100086849 3300005549 Bacteria 2320
57 Ga0070704_100217293 3300005549 Bacteria 1552
58 Ga0070704_100489799 3300005549 Bacteria 1065
59 Ga0070664_100198880 3300005564 Bacteria 1788
60 Ga0068854_100065024 3300005578 Bacteria 2651
61 Ga0068856_100000210 3300005614 Bacteria 63036
62 Ga0068856_100074401 3300005614 Bacteria 3363
63 Ga0068852_100000005 3300005616 Bacteria 173127
64 Ga0068852_100197098 3300005616 Bacteria 1904
65 Ga0068866_10000011 3300005718 Bacteria 97191
66 Ga0068866_10000149 3300005718 Bacteria 31747
67 Ga0068861_100226467 3300005719 Bacteria 1583
68 Ga0068861_100258079 3300005719 Unclassified 1491
69 Ga0068851_10003257 3300005834 Bacteria 7201
70 Ga0068870_10155222 3300005840 Bacteria 1352
71 Ga0068863_100000004 3300005841 Bacteria 272478
72 Ga0068863_100008789 3300005841 Bacteria 9864
73 Ga0068863_101264374 3300005841 Unclassified 744
74 Ga0068858_100000012 3300005842 Bacteria 216931
75 Ga0068860_100209489 3300005843 Bacteria 1890
76 Ga0068862_100002681 3300005844 Bacteria 15654
77 Ga0081455_10019034 3300005937 Bacteria 6512
78 Ga0081455_10205275 3300005937 Bacteria 1472
79 Ga0081540_1000358 3300005983 Bacteria 46046
80 Ga0081540_1001283 3300005983 Bacteria 21922
81 Ga0081539_10001387 3300005985 Bacteria 41711
82 Ga0075365_10000493 3300006038 Bacteria 15046
83 Ga0075365_10122436 3300006038 Bacteria 1795
84 Ga0075363_100059520 3300006048 Bacteria 2054
85 Ga0075364_10002586 3300006051 Bacteria 10144
86 Ga0075364_10054383 3300006051 Bacteria 2618
87 Ga0070716_100135535 3300006173 Bacteria 1563
88 Ga0070712_100000820 3300006175 Bacteria 18444
89 Ga0070712_100042651 3300006175 Bacteria 3120
90 Ga0075367_10024128 3300006178 Bacteria 3429
91 Ga0097621_100047803 3300006237 Bacteria 3468
92 Ga0075428_100307103 3300006844 Unclassified 1705
93 Ga0075430_100023632 3300006846 Bacteria 5234
94 Ga0075431_100004630 3300006847 Bacteria 13508
95 Ga0075433_10000647 3300006852 Bacteria 23411
96 Ga0075433_10206692 3300006852 Bacteria 1745
97 Ga0075434_100041572 3300006871 Bacteria 4554
98 Ga0068865_100161823 3300006881 Bacteria 1708
99 Ga0075435_100465117 3300007076 Bacteria 1091
100 Ga0075435_100558977 3300007076 Unclassified 991
101 Ga0105251_10196945 3300009011 Bacteria 908
102 Ga0111539_10031246 3300009094 Bacteria 6470
103 Ga0105245_10000012 3300009098 Bacteria 267151
104 Ga0105245_10000147 3300009098 Bacteria 66496
105 Ga0105245_10002356 3300009098 Bacteria 17078
106 Ga0105245_10005525 3300009098 Bacteria 11105
107 Ga0105245_10627298 3300009098 Bacteria 1103
108 Ga0105247_10000516 3300009101 Bacteria 31677
109 Ga0105247_10043232 3300009101 Bacteria 2760
110 Ga0105247_10207528 3300009101 Bacteria 1320
111 Ga0114129_10154171 3300009147 Bacteria 3143
112 Ga0114129_10337592 3300009147 Bacteria 1999
113 Ga0114129_10441170 3300009147 Bacteria 1709
114 Ga0105243_10034255 3300009148 Bacteria 3929
115 Ga0105243_10102617 3300009148 Bacteria 2377
116 Ga0105243_10244111 3300009148 Bacteria 1600
117 Ga0105242_10002409 3300009176 Bacteria 14698
118 Ga0105242_10002566 3300009176 Bacteria 14216
119 Ga0105242_10096155 3300009176 Bacteria 2501
120 Ga0105242_10182191 3300009176 Bacteria 1854
121 Ga0105242_10269972 3300009176 Bacteria 1540
122 Ga0105248_10000134 3300009177 Bacteria 86132
123 Ga0105248_10175674 3300009177 Bacteria 2414
124 Ga0105237_10433925 3300009545 Unclassified 1319
125 Ga0105249_10000235 3300009553 Bacteria 62630
126 Ga0105249_10003553 3300009553 Bacteria 13485
127 Ga0105249_10263968 3300009553 Bacteria 1712
128 Ga0157371_10028965 3300013102 Bacteria 4009
129 Ga0157370_10031894 3300013104 Bacteria 5150
130 Ga0157370_10140095 3300013104 Bacteria 2253
131 Ga0157369_10000130 3300013105 Bacteria 108193
132 Ga0157374_10184028 3300013296 Bacteria 2042
133 Ga0157374_10246573 3300013296 Bacteria 1757
134 Ga0157378_10005134 3300013297 Bacteria 11498
135 Ga0157378_10009732 3300013297 Bacteria 8375
136 Ga0157375_10026644 3300013308 Bacteria 5392
137 Ga0163163_10193126 3300014325 Bacteria 2084
138 Ga0163163_10416520 3300014325 Bacteria 1402
139 Ga0157380_10001764 3300014326 Bacteria 14277
140 Ga0157380_10005377 3300014326 Bacteria 8949
141 Ga0157379_10035211 3300014968 Bacteria 4464
142 Ga0157379_10055580 3300014968 Bacteria 3536
143 Ga0163161_10000018 3300017792 Bacteria 228801
144 Ga0163161_10011427 3300017792 Bacteria 6158
145 Ga0207656_10005080 3300025321 Bacteria 4627
146 Ga0207653_10053313 3300025885 Bacteria 1351
147 Ga0207682_10000038 3300025893 Bacteria 53885
148 Ga0207642_10000010 3300025899 Bacteria 99207
149 Ga0207642_10000044 3300025899 Bacteria 35749
150 Ga0207642_10117913 3300025899 Unclassified 1364
151 Ga0207710_10000276 3300025900 Bacteria 41913
152 Ga0207680_10519132 3300025903 Bacteria 849
153 Ga0207645_10279718 3300025907 Bacteria 1108
154 Ga0207643_10157908 3300025908 Bacteria 1363
155 Ga0207707_10067539 3300025912 Bacteria 3114
156 Ga0207693_10004891 3300025915 Bacteria 11259
157 Ga0207693_10060574 3300025915 Bacteria 2965
158 Ga0207663_10040308 3300025916 Bacteria 2838
159 Ga0207660_10193300 3300025917 Bacteria 1586
160 Ga0207649_10000005 3300025920 Bacteria 356179
161 Ga0207652_10000142 3300025921 Bacteria 76696
162 Ga0207681_10047406 3300025923 Bacteria 2895
163 Ga0207694_10000004 3300025924 Bacteria 967075
164 Ga0207659_10000014 3300025926 Bacteria 168481
165 Ga0207687_10000011 3300025927 Bacteria 388349
166 Ga0207687_10000026 3300025927 Bacteria 173968
167 Ga0207687_10000133 3300025927 Bacteria 49874
168 Ga0207687_10074846 3300025927 Bacteria 2428
169 Ga0207700_10000008 3300025928 Bacteria 341717
170 Ga0207700_10080838 3300025928 Bacteria 2536
171 Ga0207664_10367286 3300025929 Bacteria 1276
172 Ga0207690_10007967 3300025932 Bacteria 6290
173 Ga0207706_10000026 3300025933 Bacteria 149379
174 Ga0207686_10000032 3300025934 Bacteria 150341
175 Ga0207686_10002705 3300025934 Bacteria 9616
176 Ga0207686_10189257 3300025934 Bacteria 1466
177 Ga0207686_10310618 3300025934 Bacteria 1174
178 Ga0207709_10002024 3300025935 Bacteria 13140
179 Ga0207709_10494063 3300025935 Bacteria 954
180 Ga0207669_10000002 3300025937 Bacteria 377651
181 Ga0207669_10000025 3300025937 Bacteria 93633
182 Ga0207669_10129696 3300025937 Bacteria 1730
183 Ga0207704_10000045 3300025938 Bacteria 86589
184 Ga0207711_10000024 3300025941 Bacteria 293596
185 Ga0207711_10392840 3300025941 Unclassified 1288
186 Ga0207661_10004059 3300025944 Bacteria 10225
187 Ga0207661_10025349 3300025944 Bacteria 4505
188 Ga0207661_10035113 3300025944 Bacteria 3904
189 Ga0207661_10074488 3300025944 Bacteria 2782
190 Ga0207679_10083871 3300025945 Bacteria 2444
191 Ga0207679_10169117 3300025945 Bacteria 1798
192 Ga0207651_10010018 3300025960 Bacteria 5226
193 Ga0207651_10037162 3300025960 Bacteria 3188
194 Ga0207712_10000037 3300025961 Bacteria 195906
195 Ga0207712_10011054 3300025961 Bacteria 5746
196 Ga0207712_10144211 3300025961 Bacteria 1831
197 Ga0207640_10016872 3300025981 Bacteria 4258
198 Ga0207658_10174693 3300025986 Bacteria 1773
199 Ga0207677_10000142 3300026023 Bacteria 58625
200 Ga0207677_10014967 3300026023 Bacteria 4546
201 Ga0207703_10000550 3300026035 Bacteria 38556
202 Ga0207703_10387620 3300026035 Unclassified 1294
203 Ga0207639_10002159 3300026041 Bacteria 13247
204 Ga0207639_10065146 3300026041 Bacteria 2828
205 Ga0207678_10234707 3300026067 Bacteria 1570
206 Ga0207702_10000264 3300026078 Bacteria 60267
207 Ga0207702_10019410 3300026078 Bacteria 5625
208 Ga0207641_10000129 3300026088 Bacteria 110871
209 Ga0207641_10004274 3300026088 Bacteria 12416
210 Ga0207648_10000271 3300026089 Bacteria 56175
211 Ga0207648_10121228 3300026089 Bacteria 2299
212 Ga0207674_10266948 3300026116 Bacteria 1659
213 Ga0207675_100164365 3300026118 Bacteria 2119
214 Ga0207675_100310803 3300026118 Unclassified 1537
215 Ga0207675_100379021 3300026118 Bacteria 1391
216 Ga0207683_10056571 3300026121 Bacteria 3441
217 Ga0207683_10058421 3300026121 Bacteria 3387
218 Ga0207698_10000038 3300026142 Bacteria 101918
219 Ga0207698_10014508 3300026142 Bacteria 5241
220 Ga0268266_10000020 3300028379 Bacteria 527065
221 Ga0268264_10241449 3300028381 Bacteria 1673
222 Ga0268264_10354388 3300028381 Bacteria 1398
223 Ga0265337_1001606 3300028556 Bacteria 11032
224 Ga0265326_10000097 3300028558 Bacteria 44959
225 Ga0265326_10118071 3300028558 Bacteria 754
226 Ga0265319_1004983 3300028563 Bacteria 6466
227 Ga0265322_10000009 3300028654 Bacteria 170768
228 Ga0265336_10041617 3300028666 Bacteria 1404
229 Ga0265338_10002514 3300028800 Bacteria 27252
230 Ga0265324_10001939 3300029957 Bacteria 11097
231 Ga0265332_10028383 3300031238 Bacteria 2450
232 Ga0265328_10005790 3300031239 Bacteria 5276
233 Ga0265320_10000024 3300031240 Bacteria 170768
234 Ga0265325_10078588 3300031241 Bacteria 1643
235 Ga0265329_10003134 3300031242 Bacteria 7283
236 Ga0265339_10035053 3300031249 Bacteria 2818
237 Ga0265331_10002941 3300031250 Bacteria 11241
238 Ga0265327_10000649 3300031251 Bacteria 56238
239 Ga0265316_10085226 3300031344 Bacteria 2418
240 Ga0265314_10000898 3300031711 Bacteria 35392
241 Ga0307405_11210413 3300031731 Bacteria 654
242 Ga0307415_100029047 3300032126 Bacteria 3528
243 Ga0316583_10074831 3300032133 Bacteria 1184
244 Ga0373937_0004301 3300036401 Bacteria 12072
245 Ga0395899_0057152 3300037312 Bacteria 2881
246 Ga0395900_0081114 3300037418 Bacteria 3333
247 Ga0395900_0218359 3300037418 Bacteria 1923
248 Ga0395898_0004526 3300037466 Bacteria 15183
249 Ga0395898_0089277 3300037466 Bacteria 2966
250 Ga0395898_0682605 3300037466 Bacteria 969
251 Ga0395905_0007513 3300037471 Bacteria 10841
252 Ga0395901_0090900 3300038443 Bacteria 3195
253 Ga0395901_0112981 3300038443 Bacteria 2852
254 Ga0451807_2255517 3300041486 Bacteria 1966
255 Ga0451853_3058966 3300041512 Bacteria 868
256 Ga0451853_3071175 3300041512 Bacteria 922
257 Ga0451853_3770927 3300041512 Bacteria 2801
258 Ga0466961_0331934 3300044693 Bacteria 927
259 Ga0466963_0000547 3300044694 Bacteria 17653
260 Ga0466963_0004375 3300044694 Bacteria 8205
261 Ga0466957_0006793 3300044842 Bacteria 6466
262 Ga0466957_0136517 3300044842 Bacteria 1577
263 Ga0466957_0543199 3300044842 Bacteria 809
264 Ga0466958_0218540 3300045836 Bacteria 1215
265 Ga0466958_0236929 3300045836 Bacteria 1166
266 Ga0466967_0000005 3300045976 Bacteria 149543
267 Ga0495592_0000428 3300046454 Bacteria 31801
268 Ga0495592_0064708 3300046454 Bacteria 2679
269 Ga0495603_0000074 3300046455 Bacteria 43833
270 Ga0495603_0001089 3300046455 Bacteria 15778
271 Ga0495603_0003276 3300046455 Bacteria 9641
272 Ga0495629_0000055 3300046459 Bacteria 105268
273 Ga0495629_0051865 3300046459 Bacteria 2871
274 Ga0495629_0197914 3300046459 Bacteria 1390
275 Ga0495641_0000020 3300046461 Bacteria 115404
276 Ga0495641_0013632 3300046461 Bacteria 4452
277 Ga0495641_0024350 3300046461 Unclassified 2990
278 Ga0495651_0274997 3300046462 Bacteria 1140
279 Ga0495653_0090252 3300046463 Bacteria 2243
280 Ga0495582_0000013 3300046473 Bacteria 110372
281 Ga0495662_0011167 3300046476 Bacteria 4388
282 Ga0495594_0000007 3300046499 Bacteria 160047
283 Ga0495606_0000057 3300046507 Bacteria 197956
284 Ga0495608_0000854 3300046511 Bacteria 21319
285 Ga0495608_0000898 3300046511 Bacteria 20876
286 Ga0495610_0021361 3300046512 Bacteria 3562
287 Ga0495618_0000075 3300046514 Bacteria 70236
288 Ga0495620_0004503 3300046515 Bacteria 7843
289 Ga0495628_0009068 3300046516 Bacteria 8508
290 Ga0495628_0010801 3300046516 Bacteria 7735
291 Ga0495628_0131321 3300046516 Bacteria 1915
292 Ga0495630_0000011 3300046517 Bacteria 232063
293 Ga0495630_0003759 3300046517 Bacteria 10597
294 Ga0495630_0344715 3300046517 Bacteria 1140
295 Ga0495644_0001822 3300046523 Bacteria 8587
296 Ga0495652_0000003 3300046529 Bacteria 597094
297 Ga0495652_0012182 3300046529 Bacteria 7768
298 Ga0495640_0018466 3300046533 Bacteria 5169
299 Ga0495640_0273431 3300046533 Bacteria 1053
300 Ga0495586_0000862 3300046535 Bacteria 17412
301 Ga0495587_0012830 3300046536 Bacteria 5270
302 Ga0495587_0100392 3300046536 Bacteria 1668
303 Ga0495587_0248728 3300046536 Bacteria 1000
304 Ga0495598_0018786 3300046537 Bacteria 1801
305 Ga0495621_0194443 3300046539 Bacteria 814
306 Ga0495633_0072411 3300046558 Bacteria 1607
307 Ga0495667_0000022 3300046559 Bacteria 176919
308 Ga0495634_0067092 3300046642 Bacteria 2374
309 Ga0495634_0159457 3300046642 Bacteria 1423
310 Ga0495634_0463200 3300046642 Bacteria 746
311 Ga0495657_0000070 3300046675 Bacteria 92382
312 Ga0495657_0009280 3300046675 Bacteria 7466
313 Ga0495599_0036517 3300046678 Bacteria 3086
314 Ga0495647_0000027 3300046681 Bacteria 58315
315 Ga0495647_0006284 3300046681 Bacteria 3926
316 Ga0495647_0019535 3300046681 Bacteria 2423
317 Ga0495658_0000009 3300046683 Bacteria 110421
318 Ga0495658_0069622 3300046683 Bacteria 2039
319 Ga0495658_0155097 3300046683 Bacteria 1409
320 Ga0495669_0000103 3300046684 Bacteria 53749
321 Ga0495613_0000068 3300046689 Bacteria 101803
322 Ga0495613_0000157 3300046689 Bacteria 66401
323 Ga0495613_0285008 3300046689 Unclassified 1146
324 Ga0495624_0000012 3300046690 Bacteria 124128
325 Ga0495624_0000548 3300046690 Bacteria 29416
326 Ga0495624_0014428 3300046690 Bacteria 5361
327 Ga0495670_0007137 3300046691 Bacteria 5499
328 Ga0495649_0000694 3300046694 Bacteria 27480
329 Ga0495600_0006485 3300046809 Bacteria 7122
330 Ga0495600_0188790 3300046809 Bacteria 1326
331 Ga0495600_0483663 3300046809 Bacteria 762
332 Ga0495604_0000289 3300047317 Bacteria 44881
333 Ga0495604_0000346 3300047317 Bacteria 41587
334 Ga0495604_0014408 3300047317 Bacteria 6306
335 Ga0495674_0000020 3300047319 Bacteria 178465
336 Ga0495676_0015881 3300047321 Bacteria 6691
337 Ga0495676_0034159 3300047321 Bacteria 4270
338 Ga0495676_0046016 3300047321 Bacteria 3547
339 Ga0495676_0264872 3300047321 Bacteria 1168
340 Ga0495680_0000952 3300047322 Bacteria 32176
341 Ga0495680_0002682 3300047322 Bacteria 17969
342 Ga0495680_0034352 3300047322 Bacteria 4095
343 Ga0495680_0118338 3300047322 Bacteria 1958
344 Ga0495675_0003693 3300047444 Bacteria 9252
345 Ga0495675_0172425 3300047444 Bacteria 1328
346 Ga0495677_0095128 3300047445 Bacteria 1125
347 Ga0495679_014650 3300047446 Bacteria 2896
348 Ga0495684_0470642 3300047471 Bacteria 869
349 Ga0495686_0051474 3300047472 Bacteria 2584
350 Ga0495593_0028970 3300047673 Bacteria 3040
351 Ga0495602_0000009 3300048088 Bacteria 258991
352 Ga0495602_0000547 3300048088 Bacteria 35115
353 Ga0495602_0266153 3300048088 Bacteria 1269
354 Ga0496100_0000007 3300048903 Bacteria 261266
355 Ga0496101_0000013 3300048904 Bacteria 261266
356 Ga0496102_0000045 3300048905 Bacteria 186726
357 Ga0496102_0012169 3300048905 Bacteria 7438
358 Ga0496102_0313578 3300048905 Bacteria 1478
359 Ga0496102_0334036 3300048905 Bacteria 1427
360 Ga0496103_0000050 3300048906 Bacteria 152034
361 Ga0496103_0003423 3300048906 Bacteria 9700
362 Ga0496103_0052093 3300048906 Bacteria 2535
363 Ga0496104_0000002 3300048907 Bacteria 686017
364 Ga0496104_0000013 3300048907 Bacteria 397163
365 Ga0496104_0000168 3300048907 Bacteria 58020
366 Ga0496104_0201412 3300048907 Bacteria 1903
367 Ga0496105_0000001 3300048908 Bacteria 1328178
368 Ga0496105_0000006 3300048908 Bacteria 393578
369 Ga0496105_0001486 3300048908 Bacteria 16548
370 Ga0496105_0039467 3300048908 Bacteria 3891
371 Ga0496106_0000006 3300048909 Bacteria 251855
372 Ga0496106_0000049 3300048909 Bacteria 97550
373 Ga0496106_0017707 3300048909 Bacteria 5269
374 Ga0496107_0000007 3300048910 Bacteria 257113
375 Ga0496107_0012980 3300048910 Bacteria 5821
376 Ga0496107_0013295 3300048910 Bacteria 5752
377 Ga0496108_0000001 3300048911 Bacteria 919044
378 Ga0496108_0000080 3300048911 Bacteria 102267
379 Ga0496108_0199872 3300048911 Bacteria 1734
380 Ga0496109_0000006 3300048912 Bacteria 325513
381 Ga0496109_0000024 3300048912 Bacteria 174723
382 Ga0496109_0000039 3300048912 Bacteria 145769
383 Ga0496109_0073866 3300048912 Bacteria 3134
384 Ga0496109_0295394 3300048912 Bacteria 1527
385 Ga0496110_0000121 3300048913 Bacteria 43576
386 Ga0496110_0003251 3300048913 Bacteria 12386
387 Ga0496110_0053791 3300048913 Bacteria 3540
388 Ga0496111_0000210 3300048914 Bacteria 27543
389 Ga0496111_0004560 3300048914 Bacteria 8770
390 Ga0496111_0132257 3300048914 Bacteria 1847
391 Ga0496112_0238311 3300048915 Bacteria 1772
392 Ga0496113_0043961 3300048916 Bacteria 3307
393 Ga0496113_0115916 3300048916 Bacteria 2090
394 Ga0496114_0000003 3300048917 Bacteria 630981
395 Ga0496114_0009454 3300048917 Bacteria 7738
396 Ga0496115_0003312 3300048918 Bacteria 11569
397 Ga0496115_0015135 3300048918 Bacteria 5846
398 Ga0496115_0212773 3300048918 Bacteria 1596
399 Ga0496118_0262066 3300048921 Unclassified 975
400 Ga0496119_0011863 3300048922 Bacteria 7154
401 Ga0496119_0214540 3300048922 Bacteria 988
402 Ga0496120_0037331 3300048923 Bacteria 2884
403 Ga0501036_0632914 3300049572 Bacteria 886
404 Ga0501038_0162904 3300049574 Bacteria 1811
405 Ga0501039_0162079 3300049575 Bacteria 1758
406 Ga0501040_0183643 3300049576 Bacteria 1483
407 Ga0501040_0277433 3300049576 Bacteria 1197
408 Ga0501040_0437739 3300049576 Bacteria 941
409 Ga0501041_0162277 3300049577 Bacteria 1397
410 Ga0501042_0087361 3300049578 Bacteria 2237
411 Ga0501042_0191292 3300049578 Bacteria 1476
412 Ga0501042_0608682 3300049578 Bacteria 794
413 Ga0501043_0729353 3300049579 Bacteria 722
414 Ga0501048_0592426 3300049582 Bacteria 796
415 Ga0501068_0472883 3300049584 Bacteria 812
416 Ga0501070_0137202 3300049586 Bacteria 2020
417 Ga0501071_0064909 3300049587 Bacteria 2650
418 Ga0501071_0214617 3300049587 Bacteria 1447
419 Ga0501071_0405791 3300049587 Bacteria 1041
420 Ga0501071_0669299 3300049587 Bacteria 799
421 Ga0501072_0031425 3300049588 Bacteria 4157
422 Ga0501072_0108933 3300049588 Bacteria 2204
423 Ga0501072_0202950 3300049588 Bacteria 1581
424 Ga0501072_0273259 3300049588 Bacteria 1344
425 Ga0501075_0333914 3300049591 Bacteria 1155
426 Ga0501076_0141463 3300049592 Bacteria 1955
427 Ga0501076_0209195 3300049592 Bacteria 1593
428 Ga0501077_0033600 3300049593 Bacteria 3265
429 Ga0501077_0097812 3300049593 Bacteria 1860
430 Ga0501079_0032903 3300049741 Bacteria 3988
431 Ga0501079_0112023 3300049741 Bacteria 2121
432 Ga0501079_0492412 3300049741 Bacteria 964
433 Ga0501080_0363465 3300049742 Bacteria 1306
434 Ga0501081_0022091 3300049743 Bacteria 4255
435 Ga0501081_0062946 3300049743 Bacteria 2574
436 Ga0501081_0287801 3300049743 Bacteria 1204
437 Ga0501045_0050631 3300049824 Bacteria 3031
438 Ga0501045_0062354 3300049824 Bacteria 2736
439 Ga0501045_0417893 3300049824 Bacteria 998
440 nmdc:mga03n38_13970_c1 3300050490 Bacteria 3065
441 nmdc:mga00v17_10616_c1 3300050491 Bacteria 5035
442 nmdc:mga0yw44_117758_c1 3300050492 Bacteria 1708
443 nmdc:mga0yw44_31398_c1 3300050492 Bacteria 3089
444 nmdc:mga0yw44_50259_c1 3300050492 Bacteria 2520
445 nmdc:mga05p37_138303_c1 3300050507 Bacteria 2985
446 nmdc:mga05p37_360950_c1 3300050507 Bacteria 1708
447 nmdc:mga06r32_68450_c1 3300050510 Bacteria 3430
448 nmdc:mga08y16_7100_c1 3300050511 Bacteria 11756
449 nmdc:mga0n895_12124_c1 3300050512 Bacteria 7714
450 nmdc:mga0n895_99923_c1 3300050512 Bacteria 2910
451 nmdc:mga0rr50_164833_c1 3300050513 Bacteria 1801
452 nmdc:mga08x19_166179_c1 3300050514 Unclassified 1500
453 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
454 Ga0495601_0000031 3300053077 Bacteria 105493
455 Ga0495601_0002152 3300053077 Bacteria 11084
456 Ga0495601_0146493 3300053077 Bacteria 1541
457 Ga0495612_0025926 3300053078 Bacteria 2355
458 Ga0495612_0065595 3300053078 Bacteria 1508
459 Ga0495612_0185937 3300053078 Bacteria 913
460 Ga0495655_0000004 3300053083 Bacteria 293683
461 Ga0495655_0000804 3300053083 Bacteria 4930
462 Ga0495595_0000004 3300053084 Bacteria 260821
463 Ga0495595_0003017 3300053084 Bacteria 6657
464 Ga0495595_0032542 3300053084 Bacteria 2349
465 Ga0495619_0000194 3300053085 Bacteria 44733
466 Ga0495619_0000327 3300053085 Bacteria 33238
467 Ga0495619_0002539 3300053085 Bacteria 11949
468 Ga0500572_146652 3300053111 Unclassified 770
469 Ga0500614_000672 3300053123 Bacteria 8744
470 Ga0500628_000004 3300053129 Bacteria 202098
471 Ga0501084_0021500 3300054114 Bacteria 5378
472 Ga0501084_0569829 3300054114 Bacteria 957
473 Ga0501084_0656491 3300054114 Bacteria 885
474 Ga0501082_0147549 3300060353 Bacteria 2042
475 Ga0501082_0374979 3300060353 Bacteria 1241
476 Ga0530510_0014154 3300061734 Bacteria 5624
477 Ga0530510_0092072 3300061734 Bacteria 2212

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049576 Ga0501040_0437739 Ga0501040_0437739_104_637 148
2 3300041512 Ga0451853_3071175 Ga0451853_3071175_246_830 155
3 3300054114 Ga0501084_0656491 Ga0501084_0656491_322_855 166
4 3300049572 Ga0501036_0632914 Ga0501036_0632914_74_697 167
5 3300041486 Ga0451807_2255517 Ga0451807_2255517_22_648 168
6 3300053085 Ga0495619_0000327 Ga0495619_0000327_6240_6866 168
7 3300049591 Ga0501075_0333914 Ga0501075_0333914_106_729 169
8 3300005436 Ga0070713_100178874 Ga0070713_1001788742 172
9 3300005439 Ga0070711_100142328 Ga0070711_1001423282 172
10 3300025916 Ga0207663_10040308 Ga0207663_100403082 172
11 3300025928 Ga0207700_10080838 Ga0207700_100808382 172
12 3300005365 Ga0070688_100000209 Ga0070688_1000002099 173
13 3300005466 Ga0070685_10000037 Ga0070685_1000003724 173
14 3300046536 Ga0495587_0248728 Ga0495587_0248728_304_930 174
15 3300005937 Ga0081455_10019034 Ga0081455_100190345 175
16 3300006038 Ga0075365_10000493 Ga0075365_100004937 175
17 3300006051 Ga0075364_10002586 Ga0075364_100025866 175
18 3300050491 nmdc:mga00v17_10616_c1 nmdc:mga00v17_10616_c1_1588_2211 175
19 3300050492 nmdc:mga0yw44_31398_c1 nmdc:mga0yw44_31398_c1_1265_1888 175
20 3300041512 Ga0451853_3058966 Ga0451853_3058966_198_731 176
21 3300045976 Ga0466967_0000005 Ga0466967_0000005_22088_22720 177
22 3300005347 Ga0070668_100024702 Ga0070668_1000247022 179
23 3300005367 Ga0070667_100017503 Ga0070667_1000175035 179
24 3300005841 Ga0068863_101264374 Ga0068863_1012643741 179
25 3300005843 Ga0068860_100209489 Ga0068860_1002094892 179
26 3300005844 Ga0068862_100002681 Ga0068862_10000268110 179
27 3300009553 Ga0105249_10003553 Ga0105249_100035536 179
28 3300014968 Ga0157379_10055580 Ga0157379_100555804 179
29 3300025961 Ga0207712_10011054 Ga0207712_100110541 179
30 3300028381 Ga0268264_10241449 Ga0268264_102414492 179
31 3300049582 Ga0501048_0592426 Ga0501048_0592426_16_642 179
32 3300054114 Ga0501084_0569829 Ga0501084_0569829_178_804 179
33 3300005329 Ga0070683_100006807 Ga0070683_1000068077 181
34 3300006038 Ga0075365_10122436 Ga0075365_101224363 181
35 3300006051 Ga0075364_10054383 Ga0075364_100543835 181
36 3300009176 Ga0105242_10096155 Ga0105242_100961554 181
37 3300025934 Ga0207686_10310618 Ga0207686_103106181 181
38 3300025944 Ga0207661_10025349 Ga0207661_100253494 181
39 3300046683 Ga0495658_0069622 Ga0495658_0069622_1347_1979 181
40 3300048905 Ga0496102_0313578 Ga0496102_0313578_431_1057 181
41 3300050492 nmdc:mga0yw44_50259_c1 nmdc:mga0yw44_50259_c1_1427_2053 181
42 3300050512 nmdc:mga0n895_12124_c1 nmdc:mga0n895_12124_c1_1557_2156 181
43 3300013102 Ga0157371_10028965 Ga0157371_100289654 182
44 3300025944 Ga0207661_10035113 Ga0207661_100351131 182
45 3300044842 Ga0466957_0136517 Ga0466957_0136517_161_784 182
46 3300044842 Ga0466957_0543199 Ga0466957_0543199_94_726 182
47 3300045836 Ga0466958_0236929 Ga0466958_0236929_95_718 182
48 3300005337 Ga0070682_100001703 Ga0070682_1000017035 183
49 3300005440 Ga0070705_100343305 Ga0070705_1003433052 183
50 3300006852 Ga0075433_10206692 Ga0075433_102066922 183
51 3300006871 Ga0075434_100041572 Ga0075434_1000415724 183
52 3300007076 Ga0075435_100465117 Ga0075435_1004651172 183
53 3300009098 Ga0105245_10627298 Ga0105245_106272981 183
54 3300009147 Ga0114129_10154171 Ga0114129_101541713 183
55 3300031731 Ga0307405_11210413 Ga0307405_112104131 183
56 3300048907 Ga0496104_0201412 Ga0496104_0201412_365_994 183
57 3300049587 Ga0501071_0405791 Ga0501071_0405791_253_879 183
58 3300050512 nmdc:mga0n895_99923_c1 nmdc:mga0n895_99923_c1_1292_1918 183
59 3300050513 nmdc:mga0rr50_164833_c1 nmdc:mga0rr50_164833_c1_1050_1676 183
60 3300003659 JGI25404J52841_10020320 JGI25404J52841_100203202 184
61 3300005406 Ga0070703_10030567 Ga0070703_100305673 184
62 3300005614 Ga0068856_100000210 Ga0068856_10000021051 184
63 3300005719 Ga0068861_100258079 Ga0068861_1002580792 184
64 3300005983 Ga0081540_1000358 Ga0081540_100035825 184
65 3300017792 Ga0163161_10011427 Ga0163161_100114273 184
66 3300025885 Ga0207653_10053313 Ga0207653_100533132 184
67 3300026078 Ga0207702_10000264 Ga0207702_100002646 184
68 3300026118 Ga0207675_100310803 Ga0207675_1003108032 184
69 3300044693 Ga0466961_0331934 Ga0466961_0331934_56_676 184
70 3300046499 Ga0495594_0000007 Ga0495594_0000007_76962_77591 184
71 3300005329 Ga0070683_100053256 Ga0070683_1000532564 185
72 3300025944 Ga0207661_10074488 Ga0207661_100744882 185
73 3300005354 Ga0070675_100000008 Ga0070675_100000008245 186
74 3300013297 Ga0157378_10005134 Ga0157378_100051346 186
75 3300025926 Ga0207659_10000014 Ga0207659_1000001468 186
76 3300005353 Ga0070669_100134435 Ga0070669_1001344352 187
77 3300025923 Ga0207681_10047406 Ga0207681_100474062 187
78 3300046533 Ga0495640_0273431 Ga0495640_0273431_251_874 187
79 3300046535 Ga0495586_0000862 Ga0495586_0000862_15315_15950 187
80 3300046642 Ga0495634_0463200 Ga0495634_0463200_103_726 187
81 3300046689 Ga0495613_0285008 Ga0495613_0285008_311_967 187
82 3300047444 Ga0495675_0172425 Ga0495675_0172425_368_997 187
83 3300049742 Ga0501080_0363465 Ga0501080_0363465_592_1221 187
84 3300005329 Ga0070683_100005990 Ga0070683_1000059908 188
85 3300005364 Ga0070673_100002647 Ga0070673_1000026479 188
86 3300005459 Ga0068867_100000814 Ga0068867_10000081420 188
87 3300005535 Ga0070684_100025703 Ga0070684_1000257034 188
88 3300005841 Ga0068863_100000004 Ga0068863_1000000049 188
89 3300005983 Ga0081540_1001283 Ga0081540_100128313 188
90 3300009094 Ga0111539_10031246 Ga0111539_100312464 188
91 3300014325 Ga0163163_10193126 Ga0163163_101931263 188
92 3300014326 Ga0157380_10001764 Ga0157380_100017649 188
93 3300025944 Ga0207661_10004059 Ga0207661_100040594 188
94 3300025960 Ga0207651_10010018 Ga0207651_100100183 188
95 3300026088 Ga0207641_10000129 Ga0207641_100001299 188
96 3300026089 Ga0207648_10000271 Ga0207648_100002714 188
97 3300046455 Ga0495603_0003276 Ga0495603_0003276_1132_1758 188
98 3300046476 Ga0495662_0011167 Ga0495662_0011167_116_742 188
99 3300049576 Ga0501040_0183643 Ga0501040_0183643_785_1414 188
100 3300049578 Ga0501042_0191292 Ga0501042_0191292_18_647 188
101 3300049587 Ga0501071_0064909 Ga0501071_0064909_142_771 188
102 3300049588 Ga0501072_0108933 Ga0501072_0108933_1191_1820 188
103 3300049593 Ga0501077_0097812 Ga0501077_0097812_1191_1820 188
104 3300049741 Ga0501079_0112023 Ga0501079_0112023_637_1266 188
105 3300049743 Ga0501081_0287801 Ga0501081_0287801_179_808 188
106 3300049824 Ga0501045_0050631 Ga0501045_0050631_938_1567 188
107 3300050510 nmdc:mga06r32_68450_c1 nmdc:mga06r32_68450_c1_1467_2066 188
108 3300050511 nmdc:mga08y16_7100_c1 nmdc:mga08y16_7100_c1_9903_10502 188
109 3300054114 Ga0501084_0021500 Ga0501084_0021500_3082_3711 188
110 3300061734 Ga0530510_0014154 Ga0530510_0014154_613_1242 188
111 3300005841 Ga0068863_100008789 Ga0068863_1000087897 189
112 3300006175 Ga0070712_100000820 Ga0070712_10000082015 189
113 3300007076 Ga0075435_100558977 Ga0075435_1005589772 189
114 3300009176 Ga0105242_10002566 Ga0105242_1000256611 189
115 3300025915 Ga0207693_10004891 Ga0207693_100048915 189
116 3300025929 Ga0207664_10367286 Ga0207664_103672862 189
117 3300025934 Ga0207686_10000032 Ga0207686_10000032154 189
118 3300026035 Ga0207703_10387620 Ga0207703_103876201 189
119 3300026088 Ga0207641_10004274 Ga0207641_100042745 189
120 3300046533 Ga0495640_0018466 Ga0495640_0018466_3685_4314 189
121 3300047319 Ga0495674_0000020 Ga0495674_0000020_2833_3462 189
122 3300047321 Ga0495676_0264872 Ga0495676_0264872_62_685 189
123 3300047472 Ga0495686_0051474 Ga0495686_0051474_615_1244 189
124 3300048905 Ga0496102_0000045 Ga0496102_0000045_76219_76845 189
125 3300048905 Ga0496102_0334036 Ga0496102_0334036_109_738 189
126 3300048906 Ga0496103_0000050 Ga0496103_0000050_75188_75814 189
127 3300048906 Ga0496103_0052093 Ga0496103_0052093_1533_2162 189
128 3300048921 Ga0496118_0262066 Ga0496118_0262066_263_892 189
129 3300050514 nmdc:mga08x19_166179_c1 nmdc:mga08x19_166179_c1_82_705 189
130 3300053078 Ga0495612_0025926 Ga0495612_0025926_1094_1720 189
131 3300053083 Ga0495655_0000004 Ga0495655_0000004_151855_152481 189
132 3300053083 Ga0495655_0000804 Ga0495655_0000804_2271_2903 189
133 3300053085 Ga0495619_0002539 Ga0495619_0002539_2719_3342 189
134 3300053129 Ga0500628_000004 Ga0500628_000004_60270_60896 189
135 3300005338 Ga0068868_100001566 Ga0068868_10000156612 190
136 3300005356 Ga0070674_100000063 Ga0070674_10000006321 190
137 3300005365 Ga0070688_100154740 Ga0070688_1001547401 190
138 3300005365 Ga0070688_100337361 Ga0070688_1003373612 190
139 3300005718 Ga0068866_10000011 Ga0068866_1000001122 190
140 3300009011 Ga0105251_10196945 Ga0105251_101969451 190
141 3300025899 Ga0207642_10000010 Ga0207642_1000001073 190
142 3300025937 Ga0207669_10000025 Ga0207669_1000002511 190
143 3300026023 Ga0207677_10014967 Ga0207677_100149673 190
144 3300044842 Ga0466957_0006793 Ga0466957_0006793_291_923 190
145 3300046473 Ga0495582_0000013 Ga0495582_0000013_55104_55733 190
146 3300046511 Ga0495608_0000898 Ga0495608_0000898_11920_12552 190
147 3300046517 Ga0495630_0003759 Ga0495630_0003759_126_752 190
148 3300046539 Ga0495621_0194443 Ga0495621_0194443_106_765 190
149 3300046642 Ga0495634_0067092 Ga0495634_0067092_1440_2105 190
150 3300046675 Ga0495657_0000070 Ga0495657_0000070_83278_83910 190
151 3300046681 Ga0495647_0006284 Ga0495647_0006284_1890_2516 190
152 3300046683 Ga0495658_0000009 Ga0495658_0000009_54649_55278 190
153 3300047444 Ga0495675_0003693 Ga0495675_0003693_314_946 190
154 3300053084 Ga0495595_0000004 Ga0495595_0000004_251717_252349 190
155 3300053085 Ga0495619_0000194 Ga0495619_0000194_8318_8950 190
156 3300006237 Ga0097621_100047803 Ga0097621_1000478032 191
157 3300006846 Ga0075430_100023632 Ga0075430_1000236324 191
158 3300014326 Ga0157380_10005377 Ga0157380_100053774 191
159 3300017792 Ga0163161_10000018 Ga0163161_1000001870 191
160 3300025899 Ga0207642_10117913 Ga0207642_101179131 191
161 3300046511 Ga0495608_0000854 Ga0495608_0000854_2000_2626 191
162 3300046516 Ga0495628_0131321 Ga0495628_0131321_1114_1740 191
163 3300046689 Ga0495613_0000157 Ga0495613_0000157_18555_19181 191
164 3300047322 Ga0495680_0118338 Ga0495680_0118338_291_917 191
165 3300048912 Ga0496109_0000039 Ga0496109_0000039_134873_135505 191
166 3300048917 Ga0496114_0000003 Ga0496114_0000003_130878_131504 191
167 3300048918 Ga0496115_0003312 Ga0496115_0003312_10274_10900 191
168 3300053084 Ga0495595_0003017 Ga0495595_0003017_3604_4230 191
169 3300005543 Ga0070672_100000058 Ga0070672_10000005850 192
170 3300046529 Ga0495652_0000003 Ga0495652_0000003_207019_207648 192
171 3300048911 Ga0496108_0000080 Ga0496108_0000080_73903_74535 192
172 3300048912 Ga0496109_0000024 Ga0496109_0000024_73903_74535 192
173 3300048913 Ga0496110_0000121 Ga0496110_0000121_27910_28542 192
174 3300048914 Ga0496111_0000210 Ga0496111_0000210_21727_22359 192
175 3300002077 JGI24744J21845_10043465 JGI24744J21845_100434651 193
176 3300005330 Ga0070690_100039142 Ga0070690_1000391423 193
177 3300005335 Ga0070666_10140581 Ga0070666_101405812 193
178 3300005337 Ga0070682_100178220 Ga0070682_1001782202 193
179 3300005364 Ga0070673_100311210 Ga0070673_1003112102 193
180 3300005367 Ga0070667_100489797 Ga0070667_1004897972 193
181 3300005438 Ga0070701_10617311 Ga0070701_106173111 193
182 3300005445 Ga0070708_100608365 Ga0070708_1006083651 193
183 3300005456 Ga0070678_100016588 Ga0070678_1000165884 193
184 3300005466 Ga0070685_10161879 Ga0070685_101618793 193
185 3300005467 Ga0070706_100248144 Ga0070706_1002481442 193
186 3300005535 Ga0070684_100466192 Ga0070684_1004661922 193
187 3300005544 Ga0070686_100020781 Ga0070686_1000207814 193
188 3300005549 Ga0070704_100086849 Ga0070704_1000868493 193
189 3300005719 Ga0068861_100226467 Ga0068861_1002264671 193
190 3300006048 Ga0075363_100059520 Ga0075363_1000595203 193
191 3300006173 Ga0070716_100135535 Ga0070716_1001355353 193
192 3300006175 Ga0070712_100042651 Ga0070712_1000426514 193
193 3300006178 Ga0075367_10024128 Ga0075367_100241284 193
194 3300006881 Ga0068865_100161823 Ga0068865_1001618231 193
195 3300009098 Ga0105245_10002356 Ga0105245_100023569 193
196 3300009101 Ga0105247_10043232 Ga0105247_100432324 193
197 3300009148 Ga0105243_10244111 Ga0105243_102441113 193
198 3300009176 Ga0105242_10182191 Ga0105242_101821912 193
199 3300009177 Ga0105248_10175674 Ga0105248_101756742 193
200 3300009553 Ga0105249_10263968 Ga0105249_102639683 193
201 3300013296 Ga0157374_10246573 Ga0157374_102465733 193
202 3300013308 Ga0157375_10026644 Ga0157375_100266443 193
203 3300014325 Ga0163163_10416520 Ga0163163_104165203 193
204 3300025903 Ga0207680_10519132 Ga0207680_105191321 193
205 3300025915 Ga0207693_10060574 Ga0207693_100605744 193
206 3300025927 Ga0207687_10074846 Ga0207687_100748463 193
207 3300025935 Ga0207709_10494063 Ga0207709_104940631 193
208 3300025938 Ga0207704_10000045 Ga0207704_1000004572 193
209 3300025941 Ga0207711_10392840 Ga0207711_103928402 193
210 3300025960 Ga0207651_10037162 Ga0207651_100371622 193
211 3300025961 Ga0207712_10144211 Ga0207712_101442113 193
212 3300026089 Ga0207648_10121228 Ga0207648_101212282 193
213 3300026118 Ga0207675_100164365 Ga0207675_1001643653 193
214 3300026121 Ga0207683_10058421 Ga0207683_100584214 193
215 3300046461 Ga0495641_0013632 Ga0495641_0013632_641_1264 193
216 3300046512 Ga0495610_0021361 Ga0495610_0021361_220_852 193
217 3300047321 Ga0495676_0034159 Ga0495676_0034159_1042_1665 193
218 3300048905 Ga0496102_0012169 Ga0496102_0012169_1063_1686 193
219 3300048906 Ga0496103_0003423 Ga0496103_0003423_2199_2822 193
220 3300048908 Ga0496105_0039467 Ga0496105_0039467_940_1563 193
221 3300048909 Ga0496106_0017707 Ga0496106_0017707_799_1422 193
222 3300048910 Ga0496107_0013295 Ga0496107_0013295_1067_1690 193
223 3300048911 Ga0496108_0199872 Ga0496108_0199872_536_1159 193
224 3300048912 Ga0496109_0295394 Ga0496109_0295394_221_844 193
225 3300048913 Ga0496110_0003251 Ga0496110_0003251_4676_5299 193
226 3300048914 Ga0496111_0004560 Ga0496111_0004560_1084_1707 193
227 3300048915 Ga0496112_0238311 Ga0496112_0238311_413_1036 193
228 3300048916 Ga0496113_0043961 Ga0496113_0043961_311_934 193
229 3300048918 Ga0496115_0015135 Ga0496115_0015135_4261_4884 193
230 3300049578 Ga0501042_0608682 Ga0501042_0608682_42_674 193
231 3300050490 nmdc:mga03n38_13970_c1 nmdc:mga03n38_13970_c1_1575_2198 193
232 3300050492 nmdc:mga0yw44_117758_c1 nmdc:mga0yw44_117758_c1_91_714 193
233 3300005616 Ga0068852_100197098 Ga0068852_1001970982 194
234 3300009545 Ga0105237_10433925 Ga0105237_104339252 194
235 3300025907 Ga0207645_10279718 Ga0207645_102797181 194
236 3300026142 Ga0207698_10014508 Ga0207698_100145082 194
237 3300032126 Ga0307415_100029047 Ga0307415_1000290474 194
238 3300046537 Ga0495598_0018786 Ga0495598_0018786_474_1109 194
239 3300005457 Ga0070662_100000038 Ga0070662_10000003871 195
240 3300025933 Ga0207706_10000026 Ga0207706_1000002684 195
241 3300028558 Ga0265326_10118071 Ga0265326_101180711 195
242 3300028563 Ga0265319_1004983 Ga0265319_10049836 195
243 3300028800 Ga0265338_10002514 Ga0265338_1000251421 195
244 3300031241 Ga0265325_10078588 Ga0265325_100785882 195
245 3300005456 Ga0070678_100040663 Ga0070678_1000406633 196
246 3300005834 Ga0068851_10003257 Ga0068851_100032574 196
247 3300005937 Ga0081455_10205275 Ga0081455_102052751 196
248 3300005985 Ga0081539_10001387 Ga0081539_1000138730 196
249 3300006844 Ga0075428_100307103 Ga0075428_1003071031 196
250 3300006847 Ga0075431_100004630 Ga0075431_1000046306 196
251 3300025321 Ga0207656_10005080 Ga0207656_100050803 196
252 3300026067 Ga0207678_10234707 Ga0207678_102347071 196
253 3300026121 Ga0207683_10056571 Ga0207683_100565712 196
254 3300037312 Ga0395899_0057152 Ga0395899_0057152_266_889 196
255 3300037418 Ga0395900_0081114 Ga0395900_0081114_945_1568 196
256 3300037466 Ga0395898_0004526 Ga0395898_0004526_1049_1711 196
257 3300037466 Ga0395898_0682605 Ga0395898_0682605_61_690 196
258 3300037471 Ga0395905_0007513 Ga0395905_0007513_9540_10163 196
259 3300038443 Ga0395901_0112981 Ga0395901_0112981_2060_2683 196
260 3300046461 Ga0495641_0024350 Ga0495641_0024350_1318_1950 196
261 3300046507 Ga0495606_0000057 Ga0495606_0000057_122276_122908 196
262 3300046517 Ga0495630_0000011 Ga0495630_0000011_116802_117434 196
263 3300046681 Ga0495647_0019535 Ga0495647_0019535_1448_2080 196
264 3300047321 Ga0495676_0046016 Ga0495676_0046016_430_1062 196
265 3300048912 Ga0496109_0073866 Ga0496109_0073866_2456_3082 196
266 3300048916 Ga0496113_0115916 Ga0496113_0115916_57_683 196
267 3300049574 Ga0501038_0162904 Ga0501038_0162904_694_1317 196
268 3300049576 Ga0501040_0277433 Ga0501040_0277433_389_1012 196
269 3300049577 Ga0501041_0162277 Ga0501041_0162277_54_677 196
270 3300049578 Ga0501042_0087361 Ga0501042_0087361_589_1212 196
271 3300049579 Ga0501043_0729353 Ga0501043_0729353_43_666 196
272 3300049584 Ga0501068_0472883 Ga0501068_0472883_71_694 196
273 3300049587 Ga0501071_0214617 Ga0501071_0214617_313_936 196
274 3300049588 Ga0501072_0273259 Ga0501072_0273259_177_800 196
275 3300049592 Ga0501076_0209195 Ga0501076_0209195_618_1241 196
276 3300049593 Ga0501077_0033600 Ga0501077_0033600_372_995 196
277 3300049741 Ga0501079_0032903 Ga0501079_0032903_267_890 196
278 3300049743 Ga0501081_0022091 Ga0501081_0022091_2178_2801 196
279 3300049824 Ga0501045_0062354 Ga0501045_0062354_522_1145 196
280 3300053077 Ga0495601_0146493 Ga0495601_0146493_834_1466 196
281 3300053078 Ga0495612_0185937 Ga0495612_0185937_171_803 196
282 3300060353 Ga0501082_0147549 Ga0501082_0147549_191_814 196
283 3300061734 Ga0530510_0092072 Ga0530510_0092072_535_1158 196
284 3300026116 Ga0207674_10266948 Ga0207674_102669482 197
285 3300046459 Ga0495629_0197914 Ga0495629_0197914_415_1038 197
286 3300046462 Ga0495651_0274997 Ga0495651_0274997_100_726 197
287 3300046558 Ga0495633_0072411 Ga0495633_0072411_208_831 197
288 3300046691 Ga0495670_0007137 Ga0495670_0007137_1906_2529 197
289 3300049575 Ga0501039_0162079 Ga0501039_0162079_151_777 197
290 3300049587 Ga0501071_0669299 Ga0501071_0669299_154_780 197
291 3300049588 Ga0501072_0031425 Ga0501072_0031425_1653_2279 197
292 3300049592 Ga0501076_0141463 Ga0501076_0141463_863_1489 197
293 3300049743 Ga0501081_0062946 Ga0501081_0062946_688_1314 197
294 3300060353 Ga0501082_0374979 Ga0501082_0374979_183_809 197
295 3300005549 Ga0070704_100217293 Ga0070704_1002172932 198
296 3300005549 Ga0070704_100489799 Ga0070704_1004897992 198
297 3300009147 Ga0114129_10441170 Ga0114129_104411702 198
298 3300028381 Ga0268264_10354388 Ga0268264_103543882 198
299 3300046523 Ga0495644_0001822 Ga0495644_0001822_2458_3093 198
300 3300046690 Ga0495624_0000548 Ga0495624_0000548_16967_17599 198
301 3300050507 nmdc:mga05p37_360950_c1 nmdc:mga05p37_360950_c1_445_1068 198
302 3300053111 Ga0500572_146652 Ga0500572_146652_29_625 198
303 3300005356 Ga0070674_100000001 Ga0070674_100000001205 199
304 3300005718 Ga0068866_10000149 Ga0068866_1000014915 199
305 3300009148 Ga0105243_10102617 Ga0105243_101026172 199
306 3300025899 Ga0207642_10000044 Ga0207642_1000004415 199
307 3300025937 Ga0207669_10000002 Ga0207669_10000002144 199
308 3300046454 Ga0495592_0064708 Ga0495592_0064708_1740_2363 199
309 3300046455 Ga0495603_0001089 Ga0495603_0001089_1254_1877 199
310 3300046536 Ga0495587_0012830 Ga0495587_0012830_699_1325 199
311 3300049824 Ga0501045_0417893 Ga0501045_0417893_358_984 199
312 3300005564 Ga0070664_100198880 Ga0070664_1001988804 200
313 3300005616 Ga0068852_100000005 Ga0068852_100000005135 200
314 3300006852 Ga0075433_10000647 Ga0075433_1000064710 200
315 3300009147 Ga0114129_10337592 Ga0114129_103375923 200
316 3300009148 Ga0105243_10034255 Ga0105243_100342554 200
317 3300013296 Ga0157374_10184028 Ga0157374_101840282 200
318 3300025935 Ga0207709_10002024 Ga0207709_1000202410 200
319 3300025945 Ga0207679_10169117 Ga0207679_101691174 200
320 3300026142 Ga0207698_10000038 Ga0207698_1000003856 200
321 3300037418 Ga0395900_0218359 Ga0395900_0218359_319_942 200
322 3300037466 Ga0395898_0089277 Ga0395898_0089277_1974_2597 200
323 3300038443 Ga0395901_0090900 Ga0395901_0090900_1170_1793 200
324 3300045836 Ga0466958_0218540 Ga0466958_0218540_404_1036 200
325 3300046516 Ga0495628_0010801 Ga0495628_0010801_5873_6499 200
326 3300046517 Ga0495630_0344715 Ga0495630_0344715_128_754 200
327 3300046678 Ga0495599_0036517 Ga0495599_0036517_2304_2930 200
328 3300046690 Ga0495624_0014428 Ga0495624_0014428_2062_2685 200
329 3300046809 Ga0495600_0006485 Ga0495600_0006485_6393_7016 200
330 3300050507 nmdc:mga05p37_138303_c1 nmdc:mga05p37_138303_c1_347_970 200
331 3300050515 nmdc:mga0a205_1_c2 nmdc:mga0a205_1_c2_170918_171541 200
332 3300009177 Ga0105248_10000134 Ga0105248_100001348 201
333 3300013104 Ga0157370_10031894 Ga0157370_100318944 201
334 3300025941 Ga0207711_10000024 Ga0207711_10000024212 201
335 3300025986 Ga0207658_10174693 Ga0207658_101746932 201
336 3300026041 Ga0207639_10065146 Ga0207639_100651462 201
337 3300044694 Ga0466963_0004375 Ga0466963_0004375_633_1265 201
338 3300046459 Ga0495629_0000055 Ga0495629_0000055_70143_70775 201
339 3300046463 Ga0495653_0090252 Ga0495653_0090252_128_754 201
340 3300046514 Ga0495618_0000075 Ga0495618_0000075_69153_69779 201
341 3300046675 Ga0495657_0009280 Ga0495657_0009280_4886_5512 201
342 3300046809 Ga0495600_0188790 Ga0495600_0188790_208_831 201
343 3300048909 Ga0496106_0000049 Ga0496106_0000049_92617_93243 201
344 3300048910 Ga0496107_0012980 Ga0496107_0012980_4760_5386 201
345 3300049741 Ga0501079_0492412 Ga0501079_0492412_52_675 201
346 3300005344 Ga0070661_100000005 Ga0070661_1000000059 202
347 3300005535 Ga0070684_100234554 Ga0070684_1002345541 202
348 3300005840 Ga0068870_10155222 Ga0068870_101552222 202
349 3300013104 Ga0157370_10140095 Ga0157370_101400953 202
350 3300025908 Ga0207643_10157908 Ga0207643_101579082 202
351 3300025920 Ga0207649_10000005 Ga0207649_10000005154 202
352 3300025932 Ga0207690_10007967 Ga0207690_100079672 202
353 3300044694 Ga0466963_0000547 Ga0466963_0000547_8464_9129 202
354 3300046642 Ga0495634_0159457 Ga0495634_0159457_351_977 202
355 3300046684 Ga0495669_0000103 Ga0495669_0000103_25602_26228 202
356 3300047317 Ga0495604_0000289 Ga0495604_0000289_27843_28472 202
357 3300047322 Ga0495680_0000952 Ga0495680_0000952_19621_20247 202
358 3300048903 Ga0496100_0000007 Ga0496100_0000007_186873_187499 202
359 3300048904 Ga0496101_0000013 Ga0496101_0000013_186873_187499 202
360 3300048907 Ga0496104_0000013 Ga0496104_0000013_113805_114431 202
361 3300048908 Ga0496105_0000006 Ga0496105_0000006_282733_283359 202
362 3300048909 Ga0496106_0000006 Ga0496106_0000006_181012_181638 202
363 3300048910 Ga0496107_0000007 Ga0496107_0000007_181014_181640 202
364 3300048922 Ga0496119_0214540 Ga0496119_0214540_281_907 202
365 3300049586 Ga0501070_0137202 Ga0501070_0137202_646_1272 202
366 3300049588 Ga0501072_0202950 Ga0501072_0202950_530_1156 202
367 3300046681 Ga0495647_0000027 Ga0495647_0000027_47852_48475 206
368 3300047317 Ga0495604_0000346 Ga0495604_0000346_16317_16940 206
369 3300048088 Ga0495602_0000547 Ga0495602_0000547_31261_31884 206
370 3300001979 JGI24740J21852_10004061 JGI24740J21852_100040616 207
371 3300005333 Ga0070677_10000013 Ga0070677_1000001310 207
372 3300005336 Ga0070680_100224500 Ga0070680_1002245003 207
373 3300005337 Ga0070682_100000077 Ga0070682_10000007773 207
374 3300005337 Ga0070682_100369028 Ga0070682_1003690282 207
375 3300005341 Ga0070691_10000014 Ga0070691_1000001440 207
376 3300005365 Ga0070688_100000022 Ga0070688_10000002226 207
377 3300005436 Ga0070713_100000022 Ga0070713_10000002281 207
378 3300005466 Ga0070685_10000047 Ga0070685_1000004748 207
379 3300005530 Ga0070679_100000069 Ga0070679_10000006932 207
380 3300005535 Ga0070684_100314218 Ga0070684_1003142182 207
381 3300005539 Ga0068853_100003809 Ga0068853_1000038094 207
382 3300005547 Ga0070693_100004639 Ga0070693_1000046397 207
383 3300005548 Ga0070665_100000068 Ga0070665_10000006837 207
384 3300005578 Ga0068854_100065024 Ga0068854_1000650243 207
385 3300005614 Ga0068856_100074401 Ga0068856_1000744013 207
386 3300005842 Ga0068858_100000012 Ga0068858_100000012210 207
387 3300009098 Ga0105245_10000012 Ga0105245_1000001220 207
388 3300009098 Ga0105245_10000147 Ga0105245_100001478 207
389 3300009098 Ga0105245_10005525 Ga0105245_100055251 207
390 3300009101 Ga0105247_10000516 Ga0105247_1000051622 207
391 3300009101 Ga0105247_10207528 Ga0105247_102075281 207
392 3300009176 Ga0105242_10002409 Ga0105242_100024097 207
393 3300009176 Ga0105242_10269972 Ga0105242_102699721 207
394 3300009553 Ga0105249_10000235 Ga0105249_1000023525 207
395 3300013105 Ga0157369_10000130 Ga0157369_1000013015 207
396 3300013297 Ga0157378_10009732 Ga0157378_100097327 207
397 3300014968 Ga0157379_10035211 Ga0157379_100352114 207
398 3300025893 Ga0207682_10000038 Ga0207682_1000003810 207
399 3300025900 Ga0207710_10000276 Ga0207710_1000027616 207
400 3300025912 Ga0207707_10067539 Ga0207707_100675393 207
401 3300025917 Ga0207660_10193300 Ga0207660_101933002 207
402 3300025921 Ga0207652_10000142 Ga0207652_1000014250 207
403 3300025924 Ga0207694_10000004 Ga0207694_10000004885 207
404 3300025927 Ga0207687_10000011 Ga0207687_1000001173 207
405 3300025927 Ga0207687_10000026 Ga0207687_10000026176 207
406 3300025927 Ga0207687_10000133 Ga0207687_100001331 207
407 3300025928 Ga0207700_10000008 Ga0207700_1000000870 207
408 3300025934 Ga0207686_10002705 Ga0207686_100027057 207
409 3300025934 Ga0207686_10189257 Ga0207686_101892572 207
410 3300025937 Ga0207669_10129696 Ga0207669_101296962 207
411 3300025945 Ga0207679_10083871 Ga0207679_100838713 207
412 3300025961 Ga0207712_10000037 Ga0207712_10000037110 207
413 3300025981 Ga0207640_10016872 Ga0207640_100168724 207
414 3300026023 Ga0207677_10000142 Ga0207677_1000014256 207
415 3300026035 Ga0207703_10000550 Ga0207703_100005509 207
416 3300026041 Ga0207639_10002159 Ga0207639_100021596 207
417 3300026078 Ga0207702_10019410 Ga0207702_100194104 207
418 3300026118 Ga0207675_100379021 Ga0207675_1003790212 207
419 3300028379 Ga0268266_10000020 Ga0268266_10000020364 207
420 3300028556 Ga0265337_1001606 Ga0265337_10016069 207
421 3300028558 Ga0265326_10000097 Ga0265326_1000009725 207
422 3300028654 Ga0265322_10000009 Ga0265322_1000000925 207
423 3300028666 Ga0265336_10041617 Ga0265336_100416171 207
424 3300029957 Ga0265324_10001939 Ga0265324_100019399 207
425 3300031238 Ga0265332_10028383 Ga0265332_100283833 207
426 3300031239 Ga0265328_10005790 Ga0265328_100057905 207
427 3300031240 Ga0265320_10000024 Ga0265320_10000024150 207
428 3300031242 Ga0265329_10003134 Ga0265329_100031344 207
429 3300031249 Ga0265339_10035053 Ga0265339_100350532 207
430 3300031250 Ga0265331_10002941 Ga0265331_100029414 207
431 3300031251 Ga0265327_10000649 Ga0265327_1000064925 207
432 3300031344 Ga0265316_10085226 Ga0265316_100852263 207
433 3300031711 Ga0265314_10000898 Ga0265314_1000089825 207
434 3300032133 Ga0316583_10074831 Ga0316583_100748312 207
435 3300036401 Ga0373937_0004301 Ga0373937_0004301_1520_2149 207
436 3300041512 Ga0451853_3770927 Ga0451853_3770927_2163_2789 207
437 3300046454 Ga0495592_0000428 Ga0495592_0000428_20329_20955 207
438 3300046455 Ga0495603_0000074 Ga0495603_0000074_10200_10826 207
439 3300046459 Ga0495629_0051865 Ga0495629_0051865_1409_2038 207
440 3300046461 Ga0495641_0000020 Ga0495641_0000020_48711_49355 207
441 3300046515 Ga0495620_0004503 Ga0495620_0004503_1940_2569 207
442 3300046516 Ga0495628_0009068 Ga0495628_0009068_3355_3981 207
443 3300046529 Ga0495652_0012182 Ga0495652_0012182_2556_3182 207
444 3300046536 Ga0495587_0100392 Ga0495587_0100392_117_746 207
445 3300046559 Ga0495667_0000022 Ga0495667_0000022_59452_60078 207
446 3300046683 Ga0495658_0155097 Ga0495658_0155097_224_850 207
447 3300046689 Ga0495613_0000068 Ga0495613_0000068_31220_31849 207
448 3300046690 Ga0495624_0000012 Ga0495624_0000012_50631_51263 207
449 3300046694 Ga0495649_0000694 Ga0495649_0000694_10834_11460 207
450 3300046809 Ga0495600_0483663 Ga0495600_0483663_68_694 207
451 3300047317 Ga0495604_0014408 Ga0495604_0014408_5595_6224 207
452 3300047321 Ga0495676_0015881 Ga0495676_0015881_5385_6011 207
453 3300047322 Ga0495680_0002682 Ga0495680_0002682_12585_13211 207
454 3300047322 Ga0495680_0034352 Ga0495680_0034352_1408_2034 207
455 3300047445 Ga0495677_0095128 Ga0495677_0095128_272_940 207
456 3300047446 Ga0495679_014650 Ga0495679_014650_1642_2268 207
457 3300047471 Ga0495684_0470642 Ga0495684_0470642_213_839 207
458 3300047673 Ga0495593_0028970 Ga0495593_0028970_1137_1763 207
459 3300048088 Ga0495602_0000009 Ga0495602_0000009_68076_68705 207
460 3300048088 Ga0495602_0266153 Ga0495602_0266153_224_850 207
461 3300048907 Ga0496104_0000002 Ga0496104_0000002_468303_468926 207
462 3300048907 Ga0496104_0000168 Ga0496104_0000168_49201_49827 207
463 3300048908 Ga0496105_0000001 Ga0496105_0000001_859253_859876 207
464 3300048908 Ga0496105_0001486 Ga0496105_0001486_5759_6385 207
465 3300048911 Ga0496108_0000001 Ga0496108_0000001_167356_167982 207
466 3300048912 Ga0496109_0000006 Ga0496109_0000006_167356_167982 207
467 3300048913 Ga0496110_0053791 Ga0496110_0053791_748_1374 207
468 3300048914 Ga0496111_0132257 Ga0496111_0132257_570_1196 207
469 3300048917 Ga0496114_0009454 Ga0496114_0009454_4813_5439 207
470 3300048918 Ga0496115_0212773 Ga0496115_0212773_336_962 207
471 3300048922 Ga0496119_0011863 Ga0496119_0011863_4471_5094 207
472 3300048923 Ga0496120_0037331 Ga0496120_0037331_1963_2586 207
473 3300053077 Ga0495601_0000031 Ga0495601_0000031_96225_96854 207
474 3300053077 Ga0495601_0002152 Ga0495601_0002152_3649_4275 207
475 3300053078 Ga0495612_0065595 Ga0495612_0065595_389_1015 207
476 3300053084 Ga0495595_0032542 Ga0495595_0032542_1624_2253 207
477 3300053123 Ga0500614_000672 Ga0500614_000672_5726_6370 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04116

FA_hydroxylase

Fatty acid hydroxylase

80

218

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zr0-assembly1.cif.gz_A full length scs7p (only hydroxylase domain visible) 0.779 15 203
4zr0-assembly1.cif.gz_A full length scs7p (only hydroxylase domain visible) 0.717 15 203
4xci-assembly1.cif.gz_A crystal structure of a hexadecameric tf55 complex from s. solfataricus, crystal form ii 0.3519 34 187
4xci-assembly1.cif.gz_A crystal structure of a hexadecameric tf55 complex from s. solfataricus, crystal form ii 0.2813 34 187
8glv-assembly1.cif.gz_Fm 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella 0.2497 30 199
ID Description Score Start End Superfamily
af_Q2FZR6_145_349_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.4437 41 201 1.10.3720.10
af_Q2G1R0_3_202_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.429 30 197 1.20.1250.20
af_P75799_92_298_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.3884 41 200 1.10.3720.10
af_Q2FZR7_83_297_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.3871 57 197 1.10.3720.10
af_A0A1D6K3V9_101_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3822 37 156 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2B7ZRW0-F1-model_v4 Fatty acid hydroxylase 0.8382 12 165 GO:0005506
GO:0006633
GO:0016020
GO:0080132
AF-A0A4V3DZ63-F1-model_v4 deleted 0.8356 12 203
AF-A0A4R2WH45-F1-model_v4 deleted 0.835 12 207
AF-A0A3D1DB57-F1-model_v4 deleted 0.8331 12 165
AF-A0A7K3WSZ7-F1-model_v4 Fatty acid hydroxylase 0.8323 12 207 GO:0005506
GO:0006633
GO:0016020
GO:0080132

Feature Viewer

pLDDT pTM Quality
76.09 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map