F451725
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 477 | 272 | 477 | 197 |
Family's Representative Sequence
| Representative Sequence | 3300026118|Ga0207675_100379021|Ga0207675_1003790212 |
| Length | 228 |
| Sequence | MFPASCGAMGRRRYYSPPMEAHERTEKLAASPPLFKSEFLNFFSRVHPAVPAVIFVPVVVAMEWLGVDRGYGVLSTILLTLAGIGIWTLTEYWLHRLVFHWEPDNALGRRMHFIIHGIHHDHPNDKLRLVMPPSVSIPLAAIFFFGFWAILGDAAFPVFAGFILGYLFYDYTHYYVHHFVPRTDFGKRLREHHMRXXXQDHRYGYGVSSPLWDHVFRTYPRKRSKYRQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 55 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 135 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 136 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 137 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 138 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 139 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 140 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 143 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 144 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 145 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 146 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 147 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 148 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 149 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 150 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 152 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 153 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 154 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 156 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 157 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 158 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 159 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 160 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 161 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 162 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 163 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 164 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 165 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 166 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 167 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 217 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 218 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 219 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 220 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 221 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 222 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 225 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 226 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 227 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 228 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 229 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 230 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 231 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 232 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 233 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 253 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 254 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 255 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 268 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 269 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 270 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.94 |
| Nodule | 0 |
| Rhizoplane | 9.64 |
| Rhizosphere | 85.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10004061 | 3300001979 | Bacteria | 6334 |
| 2 | JGI24744J21845_10043465 | 3300002077 | Bacteria | 837 |
| 3 | JGI25404J52841_10020320 | 3300003659 | Unclassified | 1438 |
| 4 | Ga0070683_100005990 | 3300005329 | Bacteria | 10184 |
| 5 | Ga0070683_100006807 | 3300005329 | Bacteria | 9604 |
| 6 | Ga0070683_100053256 | 3300005329 | Bacteria | 3750 |
| 7 | Ga0070690_100039142 | 3300005330 | Bacteria | 2995 |
| 8 | Ga0070677_10000013 | 3300005333 | Bacteria | 53677 |
| 9 | Ga0070666_10140581 | 3300005335 | Bacteria | 1681 |
| 10 | Ga0070680_100224500 | 3300005336 | Bacteria | 1586 |
| 11 | Ga0070682_100000077 | 3300005337 | Bacteria | 89055 |
| 12 | Ga0070682_100001703 | 3300005337 | Bacteria | 12223 |
| 13 | Ga0070682_100178220 | 3300005337 | Bacteria | 1482 |
| 14 | Ga0070682_100369028 | 3300005337 | Bacteria | 1076 |
| 15 | Ga0068868_100001566 | 3300005338 | Bacteria | 15608 |
| 16 | Ga0070691_10000014 | 3300005341 | Bacteria | 50487 |
| 17 | Ga0070661_100000005 | 3300005344 | Bacteria | 220455 |
| 18 | Ga0070668_100024702 | 3300005347 | Bacteria | 4554 |
| 19 | Ga0070669_100134435 | 3300005353 | Bacteria | 1901 |
| 20 | Ga0070675_100000008 | 3300005354 | Bacteria | 250004 |
| 21 | Ga0070674_100000001 | 3300005356 | Bacteria | 277173 |
| 22 | Ga0070674_100000063 | 3300005356 | Bacteria | 47714 |
| 23 | Ga0070673_100002647 | 3300005364 | Bacteria | 10955 |
| 24 | Ga0070673_100311210 | 3300005364 | Bacteria | 1389 |
| 25 | Ga0070688_100000022 | 3300005365 | Bacteria | 71190 |
| 26 | Ga0070688_100000209 | 3300005365 | Bacteria | 30882 |
| 27 | Ga0070688_100154740 | 3300005365 | Unclassified | 1570 |
| 28 | Ga0070688_100337361 | 3300005365 | Bacteria | 1100 |
| 29 | Ga0070667_100017503 | 3300005367 | Bacteria | 5940 |
| 30 | Ga0070667_100489797 | 3300005367 | Bacteria | 1126 |
| 31 | Ga0070703_10030567 | 3300005406 | Bacteria | 1623 |
| 32 | Ga0070713_100000022 | 3300005436 | Bacteria | 102527 |
| 33 | Ga0070713_100178874 | 3300005436 | Bacteria | 1905 |
| 34 | Ga0070701_10617311 | 3300005438 | Unclassified | 720 |
| 35 | Ga0070711_100142328 | 3300005439 | Bacteria | 1799 |
| 36 | Ga0070705_100343305 | 3300005440 | Bacteria | 1086 |
| 37 | Ga0070708_100608365 | 3300005445 | Bacteria | 1030 |
| 38 | Ga0070678_100016588 | 3300005456 | Bacteria | 4717 |
| 39 | Ga0070678_100040663 | 3300005456 | Bacteria | 3291 |
| 40 | Ga0070662_100000038 | 3300005457 | Bacteria | 75003 |
| 41 | Ga0068867_100000814 | 3300005459 | Bacteria | 21051 |
| 42 | Ga0070685_10000037 | 3300005466 | Bacteria | 80557 |
| 43 | Ga0070685_10000047 | 3300005466 | Bacteria | 72690 |
| 44 | Ga0070685_10161879 | 3300005466 | Bacteria | 1427 |
| 45 | Ga0070706_100248144 | 3300005467 | Unclassified | 1662 |
| 46 | Ga0070679_100000069 | 3300005530 | Bacteria | 76557 |
| 47 | Ga0070684_100025703 | 3300005535 | Bacteria | 4952 |
| 48 | Ga0070684_100234554 | 3300005535 | Bacteria | 1676 |
| 49 | Ga0070684_100314218 | 3300005535 | Bacteria | 1439 |
| 50 | Ga0070684_100466192 | 3300005535 | Bacteria | 1168 |
| 51 | Ga0068853_100003809 | 3300005539 | Bacteria | 11559 |
| 52 | Ga0070672_100000058 | 3300005543 | Bacteria | 49964 |
| 53 | Ga0070686_100020781 | 3300005544 | Bacteria | 3891 |
| 54 | Ga0070693_100004639 | 3300005547 | Bacteria | 6523 |
| 55 | Ga0070665_100000068 | 3300005548 | Bacteria | 204531 |
| 56 | Ga0070704_100086849 | 3300005549 | Bacteria | 2320 |
| 57 | Ga0070704_100217293 | 3300005549 | Bacteria | 1552 |
| 58 | Ga0070704_100489799 | 3300005549 | Bacteria | 1065 |
| 59 | Ga0070664_100198880 | 3300005564 | Bacteria | 1788 |
| 60 | Ga0068854_100065024 | 3300005578 | Bacteria | 2651 |
| 61 | Ga0068856_100000210 | 3300005614 | Bacteria | 63036 |
| 62 | Ga0068856_100074401 | 3300005614 | Bacteria | 3363 |
| 63 | Ga0068852_100000005 | 3300005616 | Bacteria | 173127 |
| 64 | Ga0068852_100197098 | 3300005616 | Bacteria | 1904 |
| 65 | Ga0068866_10000011 | 3300005718 | Bacteria | 97191 |
| 66 | Ga0068866_10000149 | 3300005718 | Bacteria | 31747 |
| 67 | Ga0068861_100226467 | 3300005719 | Bacteria | 1583 |
| 68 | Ga0068861_100258079 | 3300005719 | Unclassified | 1491 |
| 69 | Ga0068851_10003257 | 3300005834 | Bacteria | 7201 |
| 70 | Ga0068870_10155222 | 3300005840 | Bacteria | 1352 |
| 71 | Ga0068863_100000004 | 3300005841 | Bacteria | 272478 |
| 72 | Ga0068863_100008789 | 3300005841 | Bacteria | 9864 |
| 73 | Ga0068863_101264374 | 3300005841 | Unclassified | 744 |
| 74 | Ga0068858_100000012 | 3300005842 | Bacteria | 216931 |
| 75 | Ga0068860_100209489 | 3300005843 | Bacteria | 1890 |
| 76 | Ga0068862_100002681 | 3300005844 | Bacteria | 15654 |
| 77 | Ga0081455_10019034 | 3300005937 | Bacteria | 6512 |
| 78 | Ga0081455_10205275 | 3300005937 | Bacteria | 1472 |
| 79 | Ga0081540_1000358 | 3300005983 | Bacteria | 46046 |
| 80 | Ga0081540_1001283 | 3300005983 | Bacteria | 21922 |
| 81 | Ga0081539_10001387 | 3300005985 | Bacteria | 41711 |
| 82 | Ga0075365_10000493 | 3300006038 | Bacteria | 15046 |
| 83 | Ga0075365_10122436 | 3300006038 | Bacteria | 1795 |
| 84 | Ga0075363_100059520 | 3300006048 | Bacteria | 2054 |
| 85 | Ga0075364_10002586 | 3300006051 | Bacteria | 10144 |
| 86 | Ga0075364_10054383 | 3300006051 | Bacteria | 2618 |
| 87 | Ga0070716_100135535 | 3300006173 | Bacteria | 1563 |
| 88 | Ga0070712_100000820 | 3300006175 | Bacteria | 18444 |
| 89 | Ga0070712_100042651 | 3300006175 | Bacteria | 3120 |
| 90 | Ga0075367_10024128 | 3300006178 | Bacteria | 3429 |
| 91 | Ga0097621_100047803 | 3300006237 | Bacteria | 3468 |
| 92 | Ga0075428_100307103 | 3300006844 | Unclassified | 1705 |
| 93 | Ga0075430_100023632 | 3300006846 | Bacteria | 5234 |
| 94 | Ga0075431_100004630 | 3300006847 | Bacteria | 13508 |
| 95 | Ga0075433_10000647 | 3300006852 | Bacteria | 23411 |
| 96 | Ga0075433_10206692 | 3300006852 | Bacteria | 1745 |
| 97 | Ga0075434_100041572 | 3300006871 | Bacteria | 4554 |
| 98 | Ga0068865_100161823 | 3300006881 | Bacteria | 1708 |
| 99 | Ga0075435_100465117 | 3300007076 | Bacteria | 1091 |
| 100 | Ga0075435_100558977 | 3300007076 | Unclassified | 991 |
| 101 | Ga0105251_10196945 | 3300009011 | Bacteria | 908 |
| 102 | Ga0111539_10031246 | 3300009094 | Bacteria | 6470 |
| 103 | Ga0105245_10000012 | 3300009098 | Bacteria | 267151 |
| 104 | Ga0105245_10000147 | 3300009098 | Bacteria | 66496 |
| 105 | Ga0105245_10002356 | 3300009098 | Bacteria | 17078 |
| 106 | Ga0105245_10005525 | 3300009098 | Bacteria | 11105 |
| 107 | Ga0105245_10627298 | 3300009098 | Bacteria | 1103 |
| 108 | Ga0105247_10000516 | 3300009101 | Bacteria | 31677 |
| 109 | Ga0105247_10043232 | 3300009101 | Bacteria | 2760 |
| 110 | Ga0105247_10207528 | 3300009101 | Bacteria | 1320 |
| 111 | Ga0114129_10154171 | 3300009147 | Bacteria | 3143 |
| 112 | Ga0114129_10337592 | 3300009147 | Bacteria | 1999 |
| 113 | Ga0114129_10441170 | 3300009147 | Bacteria | 1709 |
| 114 | Ga0105243_10034255 | 3300009148 | Bacteria | 3929 |
| 115 | Ga0105243_10102617 | 3300009148 | Bacteria | 2377 |
| 116 | Ga0105243_10244111 | 3300009148 | Bacteria | 1600 |
| 117 | Ga0105242_10002409 | 3300009176 | Bacteria | 14698 |
| 118 | Ga0105242_10002566 | 3300009176 | Bacteria | 14216 |
| 119 | Ga0105242_10096155 | 3300009176 | Bacteria | 2501 |
| 120 | Ga0105242_10182191 | 3300009176 | Bacteria | 1854 |
| 121 | Ga0105242_10269972 | 3300009176 | Bacteria | 1540 |
| 122 | Ga0105248_10000134 | 3300009177 | Bacteria | 86132 |
| 123 | Ga0105248_10175674 | 3300009177 | Bacteria | 2414 |
| 124 | Ga0105237_10433925 | 3300009545 | Unclassified | 1319 |
| 125 | Ga0105249_10000235 | 3300009553 | Bacteria | 62630 |
| 126 | Ga0105249_10003553 | 3300009553 | Bacteria | 13485 |
| 127 | Ga0105249_10263968 | 3300009553 | Bacteria | 1712 |
| 128 | Ga0157371_10028965 | 3300013102 | Bacteria | 4009 |
| 129 | Ga0157370_10031894 | 3300013104 | Bacteria | 5150 |
| 130 | Ga0157370_10140095 | 3300013104 | Bacteria | 2253 |
| 131 | Ga0157369_10000130 | 3300013105 | Bacteria | 108193 |
| 132 | Ga0157374_10184028 | 3300013296 | Bacteria | 2042 |
| 133 | Ga0157374_10246573 | 3300013296 | Bacteria | 1757 |
| 134 | Ga0157378_10005134 | 3300013297 | Bacteria | 11498 |
| 135 | Ga0157378_10009732 | 3300013297 | Bacteria | 8375 |
| 136 | Ga0157375_10026644 | 3300013308 | Bacteria | 5392 |
| 137 | Ga0163163_10193126 | 3300014325 | Bacteria | 2084 |
| 138 | Ga0163163_10416520 | 3300014325 | Bacteria | 1402 |
| 139 | Ga0157380_10001764 | 3300014326 | Bacteria | 14277 |
| 140 | Ga0157380_10005377 | 3300014326 | Bacteria | 8949 |
| 141 | Ga0157379_10035211 | 3300014968 | Bacteria | 4464 |
| 142 | Ga0157379_10055580 | 3300014968 | Bacteria | 3536 |
| 143 | Ga0163161_10000018 | 3300017792 | Bacteria | 228801 |
| 144 | Ga0163161_10011427 | 3300017792 | Bacteria | 6158 |
| 145 | Ga0207656_10005080 | 3300025321 | Bacteria | 4627 |
| 146 | Ga0207653_10053313 | 3300025885 | Bacteria | 1351 |
| 147 | Ga0207682_10000038 | 3300025893 | Bacteria | 53885 |
| 148 | Ga0207642_10000010 | 3300025899 | Bacteria | 99207 |
| 149 | Ga0207642_10000044 | 3300025899 | Bacteria | 35749 |
| 150 | Ga0207642_10117913 | 3300025899 | Unclassified | 1364 |
| 151 | Ga0207710_10000276 | 3300025900 | Bacteria | 41913 |
| 152 | Ga0207680_10519132 | 3300025903 | Bacteria | 849 |
| 153 | Ga0207645_10279718 | 3300025907 | Bacteria | 1108 |
| 154 | Ga0207643_10157908 | 3300025908 | Bacteria | 1363 |
| 155 | Ga0207707_10067539 | 3300025912 | Bacteria | 3114 |
| 156 | Ga0207693_10004891 | 3300025915 | Bacteria | 11259 |
| 157 | Ga0207693_10060574 | 3300025915 | Bacteria | 2965 |
| 158 | Ga0207663_10040308 | 3300025916 | Bacteria | 2838 |
| 159 | Ga0207660_10193300 | 3300025917 | Bacteria | 1586 |
| 160 | Ga0207649_10000005 | 3300025920 | Bacteria | 356179 |
| 161 | Ga0207652_10000142 | 3300025921 | Bacteria | 76696 |
| 162 | Ga0207681_10047406 | 3300025923 | Bacteria | 2895 |
| 163 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 164 | Ga0207659_10000014 | 3300025926 | Bacteria | 168481 |
| 165 | Ga0207687_10000011 | 3300025927 | Bacteria | 388349 |
| 166 | Ga0207687_10000026 | 3300025927 | Bacteria | 173968 |
| 167 | Ga0207687_10000133 | 3300025927 | Bacteria | 49874 |
| 168 | Ga0207687_10074846 | 3300025927 | Bacteria | 2428 |
| 169 | Ga0207700_10000008 | 3300025928 | Bacteria | 341717 |
| 170 | Ga0207700_10080838 | 3300025928 | Bacteria | 2536 |
| 171 | Ga0207664_10367286 | 3300025929 | Bacteria | 1276 |
| 172 | Ga0207690_10007967 | 3300025932 | Bacteria | 6290 |
| 173 | Ga0207706_10000026 | 3300025933 | Bacteria | 149379 |
| 174 | Ga0207686_10000032 | 3300025934 | Bacteria | 150341 |
| 175 | Ga0207686_10002705 | 3300025934 | Bacteria | 9616 |
| 176 | Ga0207686_10189257 | 3300025934 | Bacteria | 1466 |
| 177 | Ga0207686_10310618 | 3300025934 | Bacteria | 1174 |
| 178 | Ga0207709_10002024 | 3300025935 | Bacteria | 13140 |
| 179 | Ga0207709_10494063 | 3300025935 | Bacteria | 954 |
| 180 | Ga0207669_10000002 | 3300025937 | Bacteria | 377651 |
| 181 | Ga0207669_10000025 | 3300025937 | Bacteria | 93633 |
| 182 | Ga0207669_10129696 | 3300025937 | Bacteria | 1730 |
| 183 | Ga0207704_10000045 | 3300025938 | Bacteria | 86589 |
| 184 | Ga0207711_10000024 | 3300025941 | Bacteria | 293596 |
| 185 | Ga0207711_10392840 | 3300025941 | Unclassified | 1288 |
| 186 | Ga0207661_10004059 | 3300025944 | Bacteria | 10225 |
| 187 | Ga0207661_10025349 | 3300025944 | Bacteria | 4505 |
| 188 | Ga0207661_10035113 | 3300025944 | Bacteria | 3904 |
| 189 | Ga0207661_10074488 | 3300025944 | Bacteria | 2782 |
| 190 | Ga0207679_10083871 | 3300025945 | Bacteria | 2444 |
| 191 | Ga0207679_10169117 | 3300025945 | Bacteria | 1798 |
| 192 | Ga0207651_10010018 | 3300025960 | Bacteria | 5226 |
| 193 | Ga0207651_10037162 | 3300025960 | Bacteria | 3188 |
| 194 | Ga0207712_10000037 | 3300025961 | Bacteria | 195906 |
| 195 | Ga0207712_10011054 | 3300025961 | Bacteria | 5746 |
| 196 | Ga0207712_10144211 | 3300025961 | Bacteria | 1831 |
| 197 | Ga0207640_10016872 | 3300025981 | Bacteria | 4258 |
| 198 | Ga0207658_10174693 | 3300025986 | Bacteria | 1773 |
| 199 | Ga0207677_10000142 | 3300026023 | Bacteria | 58625 |
| 200 | Ga0207677_10014967 | 3300026023 | Bacteria | 4546 |
| 201 | Ga0207703_10000550 | 3300026035 | Bacteria | 38556 |
| 202 | Ga0207703_10387620 | 3300026035 | Unclassified | 1294 |
| 203 | Ga0207639_10002159 | 3300026041 | Bacteria | 13247 |
| 204 | Ga0207639_10065146 | 3300026041 | Bacteria | 2828 |
| 205 | Ga0207678_10234707 | 3300026067 | Bacteria | 1570 |
| 206 | Ga0207702_10000264 | 3300026078 | Bacteria | 60267 |
| 207 | Ga0207702_10019410 | 3300026078 | Bacteria | 5625 |
| 208 | Ga0207641_10000129 | 3300026088 | Bacteria | 110871 |
| 209 | Ga0207641_10004274 | 3300026088 | Bacteria | 12416 |
| 210 | Ga0207648_10000271 | 3300026089 | Bacteria | 56175 |
| 211 | Ga0207648_10121228 | 3300026089 | Bacteria | 2299 |
| 212 | Ga0207674_10266948 | 3300026116 | Bacteria | 1659 |
| 213 | Ga0207675_100164365 | 3300026118 | Bacteria | 2119 |
| 214 | Ga0207675_100310803 | 3300026118 | Unclassified | 1537 |
| 215 | Ga0207675_100379021 | 3300026118 | Bacteria | 1391 |
| 216 | Ga0207683_10056571 | 3300026121 | Bacteria | 3441 |
| 217 | Ga0207683_10058421 | 3300026121 | Bacteria | 3387 |
| 218 | Ga0207698_10000038 | 3300026142 | Bacteria | 101918 |
| 219 | Ga0207698_10014508 | 3300026142 | Bacteria | 5241 |
| 220 | Ga0268266_10000020 | 3300028379 | Bacteria | 527065 |
| 221 | Ga0268264_10241449 | 3300028381 | Bacteria | 1673 |
| 222 | Ga0268264_10354388 | 3300028381 | Bacteria | 1398 |
| 223 | Ga0265337_1001606 | 3300028556 | Bacteria | 11032 |
| 224 | Ga0265326_10000097 | 3300028558 | Bacteria | 44959 |
| 225 | Ga0265326_10118071 | 3300028558 | Bacteria | 754 |
| 226 | Ga0265319_1004983 | 3300028563 | Bacteria | 6466 |
| 227 | Ga0265322_10000009 | 3300028654 | Bacteria | 170768 |
| 228 | Ga0265336_10041617 | 3300028666 | Bacteria | 1404 |
| 229 | Ga0265338_10002514 | 3300028800 | Bacteria | 27252 |
| 230 | Ga0265324_10001939 | 3300029957 | Bacteria | 11097 |
| 231 | Ga0265332_10028383 | 3300031238 | Bacteria | 2450 |
| 232 | Ga0265328_10005790 | 3300031239 | Bacteria | 5276 |
| 233 | Ga0265320_10000024 | 3300031240 | Bacteria | 170768 |
| 234 | Ga0265325_10078588 | 3300031241 | Bacteria | 1643 |
| 235 | Ga0265329_10003134 | 3300031242 | Bacteria | 7283 |
| 236 | Ga0265339_10035053 | 3300031249 | Bacteria | 2818 |
| 237 | Ga0265331_10002941 | 3300031250 | Bacteria | 11241 |
| 238 | Ga0265327_10000649 | 3300031251 | Bacteria | 56238 |
| 239 | Ga0265316_10085226 | 3300031344 | Bacteria | 2418 |
| 240 | Ga0265314_10000898 | 3300031711 | Bacteria | 35392 |
| 241 | Ga0307405_11210413 | 3300031731 | Bacteria | 654 |
| 242 | Ga0307415_100029047 | 3300032126 | Bacteria | 3528 |
| 243 | Ga0316583_10074831 | 3300032133 | Bacteria | 1184 |
| 244 | Ga0373937_0004301 | 3300036401 | Bacteria | 12072 |
| 245 | Ga0395899_0057152 | 3300037312 | Bacteria | 2881 |
| 246 | Ga0395900_0081114 | 3300037418 | Bacteria | 3333 |
| 247 | Ga0395900_0218359 | 3300037418 | Bacteria | 1923 |
| 248 | Ga0395898_0004526 | 3300037466 | Bacteria | 15183 |
| 249 | Ga0395898_0089277 | 3300037466 | Bacteria | 2966 |
| 250 | Ga0395898_0682605 | 3300037466 | Bacteria | 969 |
| 251 | Ga0395905_0007513 | 3300037471 | Bacteria | 10841 |
| 252 | Ga0395901_0090900 | 3300038443 | Bacteria | 3195 |
| 253 | Ga0395901_0112981 | 3300038443 | Bacteria | 2852 |
| 254 | Ga0451807_2255517 | 3300041486 | Bacteria | 1966 |
| 255 | Ga0451853_3058966 | 3300041512 | Bacteria | 868 |
| 256 | Ga0451853_3071175 | 3300041512 | Bacteria | 922 |
| 257 | Ga0451853_3770927 | 3300041512 | Bacteria | 2801 |
| 258 | Ga0466961_0331934 | 3300044693 | Bacteria | 927 |
| 259 | Ga0466963_0000547 | 3300044694 | Bacteria | 17653 |
| 260 | Ga0466963_0004375 | 3300044694 | Bacteria | 8205 |
| 261 | Ga0466957_0006793 | 3300044842 | Bacteria | 6466 |
| 262 | Ga0466957_0136517 | 3300044842 | Bacteria | 1577 |
| 263 | Ga0466957_0543199 | 3300044842 | Bacteria | 809 |
| 264 | Ga0466958_0218540 | 3300045836 | Bacteria | 1215 |
| 265 | Ga0466958_0236929 | 3300045836 | Bacteria | 1166 |
| 266 | Ga0466967_0000005 | 3300045976 | Bacteria | 149543 |
| 267 | Ga0495592_0000428 | 3300046454 | Bacteria | 31801 |
| 268 | Ga0495592_0064708 | 3300046454 | Bacteria | 2679 |
| 269 | Ga0495603_0000074 | 3300046455 | Bacteria | 43833 |
| 270 | Ga0495603_0001089 | 3300046455 | Bacteria | 15778 |
| 271 | Ga0495603_0003276 | 3300046455 | Bacteria | 9641 |
| 272 | Ga0495629_0000055 | 3300046459 | Bacteria | 105268 |
| 273 | Ga0495629_0051865 | 3300046459 | Bacteria | 2871 |
| 274 | Ga0495629_0197914 | 3300046459 | Bacteria | 1390 |
| 275 | Ga0495641_0000020 | 3300046461 | Bacteria | 115404 |
| 276 | Ga0495641_0013632 | 3300046461 | Bacteria | 4452 |
| 277 | Ga0495641_0024350 | 3300046461 | Unclassified | 2990 |
| 278 | Ga0495651_0274997 | 3300046462 | Bacteria | 1140 |
| 279 | Ga0495653_0090252 | 3300046463 | Bacteria | 2243 |
| 280 | Ga0495582_0000013 | 3300046473 | Bacteria | 110372 |
| 281 | Ga0495662_0011167 | 3300046476 | Bacteria | 4388 |
| 282 | Ga0495594_0000007 | 3300046499 | Bacteria | 160047 |
| 283 | Ga0495606_0000057 | 3300046507 | Bacteria | 197956 |
| 284 | Ga0495608_0000854 | 3300046511 | Bacteria | 21319 |
| 285 | Ga0495608_0000898 | 3300046511 | Bacteria | 20876 |
| 286 | Ga0495610_0021361 | 3300046512 | Bacteria | 3562 |
| 287 | Ga0495618_0000075 | 3300046514 | Bacteria | 70236 |
| 288 | Ga0495620_0004503 | 3300046515 | Bacteria | 7843 |
| 289 | Ga0495628_0009068 | 3300046516 | Bacteria | 8508 |
| 290 | Ga0495628_0010801 | 3300046516 | Bacteria | 7735 |
| 291 | Ga0495628_0131321 | 3300046516 | Bacteria | 1915 |
| 292 | Ga0495630_0000011 | 3300046517 | Bacteria | 232063 |
| 293 | Ga0495630_0003759 | 3300046517 | Bacteria | 10597 |
| 294 | Ga0495630_0344715 | 3300046517 | Bacteria | 1140 |
| 295 | Ga0495644_0001822 | 3300046523 | Bacteria | 8587 |
| 296 | Ga0495652_0000003 | 3300046529 | Bacteria | 597094 |
| 297 | Ga0495652_0012182 | 3300046529 | Bacteria | 7768 |
| 298 | Ga0495640_0018466 | 3300046533 | Bacteria | 5169 |
| 299 | Ga0495640_0273431 | 3300046533 | Bacteria | 1053 |
| 300 | Ga0495586_0000862 | 3300046535 | Bacteria | 17412 |
| 301 | Ga0495587_0012830 | 3300046536 | Bacteria | 5270 |
| 302 | Ga0495587_0100392 | 3300046536 | Bacteria | 1668 |
| 303 | Ga0495587_0248728 | 3300046536 | Bacteria | 1000 |
| 304 | Ga0495598_0018786 | 3300046537 | Bacteria | 1801 |
| 305 | Ga0495621_0194443 | 3300046539 | Bacteria | 814 |
| 306 | Ga0495633_0072411 | 3300046558 | Bacteria | 1607 |
| 307 | Ga0495667_0000022 | 3300046559 | Bacteria | 176919 |
| 308 | Ga0495634_0067092 | 3300046642 | Bacteria | 2374 |
| 309 | Ga0495634_0159457 | 3300046642 | Bacteria | 1423 |
| 310 | Ga0495634_0463200 | 3300046642 | Bacteria | 746 |
| 311 | Ga0495657_0000070 | 3300046675 | Bacteria | 92382 |
| 312 | Ga0495657_0009280 | 3300046675 | Bacteria | 7466 |
| 313 | Ga0495599_0036517 | 3300046678 | Bacteria | 3086 |
| 314 | Ga0495647_0000027 | 3300046681 | Bacteria | 58315 |
| 315 | Ga0495647_0006284 | 3300046681 | Bacteria | 3926 |
| 316 | Ga0495647_0019535 | 3300046681 | Bacteria | 2423 |
| 317 | Ga0495658_0000009 | 3300046683 | Bacteria | 110421 |
| 318 | Ga0495658_0069622 | 3300046683 | Bacteria | 2039 |
| 319 | Ga0495658_0155097 | 3300046683 | Bacteria | 1409 |
| 320 | Ga0495669_0000103 | 3300046684 | Bacteria | 53749 |
| 321 | Ga0495613_0000068 | 3300046689 | Bacteria | 101803 |
| 322 | Ga0495613_0000157 | 3300046689 | Bacteria | 66401 |
| 323 | Ga0495613_0285008 | 3300046689 | Unclassified | 1146 |
| 324 | Ga0495624_0000012 | 3300046690 | Bacteria | 124128 |
| 325 | Ga0495624_0000548 | 3300046690 | Bacteria | 29416 |
| 326 | Ga0495624_0014428 | 3300046690 | Bacteria | 5361 |
| 327 | Ga0495670_0007137 | 3300046691 | Bacteria | 5499 |
| 328 | Ga0495649_0000694 | 3300046694 | Bacteria | 27480 |
| 329 | Ga0495600_0006485 | 3300046809 | Bacteria | 7122 |
| 330 | Ga0495600_0188790 | 3300046809 | Bacteria | 1326 |
| 331 | Ga0495600_0483663 | 3300046809 | Bacteria | 762 |
| 332 | Ga0495604_0000289 | 3300047317 | Bacteria | 44881 |
| 333 | Ga0495604_0000346 | 3300047317 | Bacteria | 41587 |
| 334 | Ga0495604_0014408 | 3300047317 | Bacteria | 6306 |
| 335 | Ga0495674_0000020 | 3300047319 | Bacteria | 178465 |
| 336 | Ga0495676_0015881 | 3300047321 | Bacteria | 6691 |
| 337 | Ga0495676_0034159 | 3300047321 | Bacteria | 4270 |
| 338 | Ga0495676_0046016 | 3300047321 | Bacteria | 3547 |
| 339 | Ga0495676_0264872 | 3300047321 | Bacteria | 1168 |
| 340 | Ga0495680_0000952 | 3300047322 | Bacteria | 32176 |
| 341 | Ga0495680_0002682 | 3300047322 | Bacteria | 17969 |
| 342 | Ga0495680_0034352 | 3300047322 | Bacteria | 4095 |
| 343 | Ga0495680_0118338 | 3300047322 | Bacteria | 1958 |
| 344 | Ga0495675_0003693 | 3300047444 | Bacteria | 9252 |
| 345 | Ga0495675_0172425 | 3300047444 | Bacteria | 1328 |
| 346 | Ga0495677_0095128 | 3300047445 | Bacteria | 1125 |
| 347 | Ga0495679_014650 | 3300047446 | Bacteria | 2896 |
| 348 | Ga0495684_0470642 | 3300047471 | Bacteria | 869 |
| 349 | Ga0495686_0051474 | 3300047472 | Bacteria | 2584 |
| 350 | Ga0495593_0028970 | 3300047673 | Bacteria | 3040 |
| 351 | Ga0495602_0000009 | 3300048088 | Bacteria | 258991 |
| 352 | Ga0495602_0000547 | 3300048088 | Bacteria | 35115 |
| 353 | Ga0495602_0266153 | 3300048088 | Bacteria | 1269 |
| 354 | Ga0496100_0000007 | 3300048903 | Bacteria | 261266 |
| 355 | Ga0496101_0000013 | 3300048904 | Bacteria | 261266 |
| 356 | Ga0496102_0000045 | 3300048905 | Bacteria | 186726 |
| 357 | Ga0496102_0012169 | 3300048905 | Bacteria | 7438 |
| 358 | Ga0496102_0313578 | 3300048905 | Bacteria | 1478 |
| 359 | Ga0496102_0334036 | 3300048905 | Bacteria | 1427 |
| 360 | Ga0496103_0000050 | 3300048906 | Bacteria | 152034 |
| 361 | Ga0496103_0003423 | 3300048906 | Bacteria | 9700 |
| 362 | Ga0496103_0052093 | 3300048906 | Bacteria | 2535 |
| 363 | Ga0496104_0000002 | 3300048907 | Bacteria | 686017 |
| 364 | Ga0496104_0000013 | 3300048907 | Bacteria | 397163 |
| 365 | Ga0496104_0000168 | 3300048907 | Bacteria | 58020 |
| 366 | Ga0496104_0201412 | 3300048907 | Bacteria | 1903 |
| 367 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 368 | Ga0496105_0000006 | 3300048908 | Bacteria | 393578 |
| 369 | Ga0496105_0001486 | 3300048908 | Bacteria | 16548 |
| 370 | Ga0496105_0039467 | 3300048908 | Bacteria | 3891 |
| 371 | Ga0496106_0000006 | 3300048909 | Bacteria | 251855 |
| 372 | Ga0496106_0000049 | 3300048909 | Bacteria | 97550 |
| 373 | Ga0496106_0017707 | 3300048909 | Bacteria | 5269 |
| 374 | Ga0496107_0000007 | 3300048910 | Bacteria | 257113 |
| 375 | Ga0496107_0012980 | 3300048910 | Bacteria | 5821 |
| 376 | Ga0496107_0013295 | 3300048910 | Bacteria | 5752 |
| 377 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 378 | Ga0496108_0000080 | 3300048911 | Bacteria | 102267 |
| 379 | Ga0496108_0199872 | 3300048911 | Bacteria | 1734 |
| 380 | Ga0496109_0000006 | 3300048912 | Bacteria | 325513 |
| 381 | Ga0496109_0000024 | 3300048912 | Bacteria | 174723 |
| 382 | Ga0496109_0000039 | 3300048912 | Bacteria | 145769 |
| 383 | Ga0496109_0073866 | 3300048912 | Bacteria | 3134 |
| 384 | Ga0496109_0295394 | 3300048912 | Bacteria | 1527 |
| 385 | Ga0496110_0000121 | 3300048913 | Bacteria | 43576 |
| 386 | Ga0496110_0003251 | 3300048913 | Bacteria | 12386 |
| 387 | Ga0496110_0053791 | 3300048913 | Bacteria | 3540 |
| 388 | Ga0496111_0000210 | 3300048914 | Bacteria | 27543 |
| 389 | Ga0496111_0004560 | 3300048914 | Bacteria | 8770 |
| 390 | Ga0496111_0132257 | 3300048914 | Bacteria | 1847 |
| 391 | Ga0496112_0238311 | 3300048915 | Bacteria | 1772 |
| 392 | Ga0496113_0043961 | 3300048916 | Bacteria | 3307 |
| 393 | Ga0496113_0115916 | 3300048916 | Bacteria | 2090 |
| 394 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 395 | Ga0496114_0009454 | 3300048917 | Bacteria | 7738 |
| 396 | Ga0496115_0003312 | 3300048918 | Bacteria | 11569 |
| 397 | Ga0496115_0015135 | 3300048918 | Bacteria | 5846 |
| 398 | Ga0496115_0212773 | 3300048918 | Bacteria | 1596 |
| 399 | Ga0496118_0262066 | 3300048921 | Unclassified | 975 |
| 400 | Ga0496119_0011863 | 3300048922 | Bacteria | 7154 |
| 401 | Ga0496119_0214540 | 3300048922 | Bacteria | 988 |
| 402 | Ga0496120_0037331 | 3300048923 | Bacteria | 2884 |
| 403 | Ga0501036_0632914 | 3300049572 | Bacteria | 886 |
| 404 | Ga0501038_0162904 | 3300049574 | Bacteria | 1811 |
| 405 | Ga0501039_0162079 | 3300049575 | Bacteria | 1758 |
| 406 | Ga0501040_0183643 | 3300049576 | Bacteria | 1483 |
| 407 | Ga0501040_0277433 | 3300049576 | Bacteria | 1197 |
| 408 | Ga0501040_0437739 | 3300049576 | Bacteria | 941 |
| 409 | Ga0501041_0162277 | 3300049577 | Bacteria | 1397 |
| 410 | Ga0501042_0087361 | 3300049578 | Bacteria | 2237 |
| 411 | Ga0501042_0191292 | 3300049578 | Bacteria | 1476 |
| 412 | Ga0501042_0608682 | 3300049578 | Bacteria | 794 |
| 413 | Ga0501043_0729353 | 3300049579 | Bacteria | 722 |
| 414 | Ga0501048_0592426 | 3300049582 | Bacteria | 796 |
| 415 | Ga0501068_0472883 | 3300049584 | Bacteria | 812 |
| 416 | Ga0501070_0137202 | 3300049586 | Bacteria | 2020 |
| 417 | Ga0501071_0064909 | 3300049587 | Bacteria | 2650 |
| 418 | Ga0501071_0214617 | 3300049587 | Bacteria | 1447 |
| 419 | Ga0501071_0405791 | 3300049587 | Bacteria | 1041 |
| 420 | Ga0501071_0669299 | 3300049587 | Bacteria | 799 |
| 421 | Ga0501072_0031425 | 3300049588 | Bacteria | 4157 |
| 422 | Ga0501072_0108933 | 3300049588 | Bacteria | 2204 |
| 423 | Ga0501072_0202950 | 3300049588 | Bacteria | 1581 |
| 424 | Ga0501072_0273259 | 3300049588 | Bacteria | 1344 |
| 425 | Ga0501075_0333914 | 3300049591 | Bacteria | 1155 |
| 426 | Ga0501076_0141463 | 3300049592 | Bacteria | 1955 |
| 427 | Ga0501076_0209195 | 3300049592 | Bacteria | 1593 |
| 428 | Ga0501077_0033600 | 3300049593 | Bacteria | 3265 |
| 429 | Ga0501077_0097812 | 3300049593 | Bacteria | 1860 |
| 430 | Ga0501079_0032903 | 3300049741 | Bacteria | 3988 |
| 431 | Ga0501079_0112023 | 3300049741 | Bacteria | 2121 |
| 432 | Ga0501079_0492412 | 3300049741 | Bacteria | 964 |
| 433 | Ga0501080_0363465 | 3300049742 | Bacteria | 1306 |
| 434 | Ga0501081_0022091 | 3300049743 | Bacteria | 4255 |
| 435 | Ga0501081_0062946 | 3300049743 | Bacteria | 2574 |
| 436 | Ga0501081_0287801 | 3300049743 | Bacteria | 1204 |
| 437 | Ga0501045_0050631 | 3300049824 | Bacteria | 3031 |
| 438 | Ga0501045_0062354 | 3300049824 | Bacteria | 2736 |
| 439 | Ga0501045_0417893 | 3300049824 | Bacteria | 998 |
| 440 | nmdc:mga03n38_13970_c1 | 3300050490 | Bacteria | 3065 |
| 441 | nmdc:mga00v17_10616_c1 | 3300050491 | Bacteria | 5035 |
| 442 | nmdc:mga0yw44_117758_c1 | 3300050492 | Bacteria | 1708 |
| 443 | nmdc:mga0yw44_31398_c1 | 3300050492 | Bacteria | 3089 |
| 444 | nmdc:mga0yw44_50259_c1 | 3300050492 | Bacteria | 2520 |
| 445 | nmdc:mga05p37_138303_c1 | 3300050507 | Bacteria | 2985 |
| 446 | nmdc:mga05p37_360950_c1 | 3300050507 | Bacteria | 1708 |
| 447 | nmdc:mga06r32_68450_c1 | 3300050510 | Bacteria | 3430 |
| 448 | nmdc:mga08y16_7100_c1 | 3300050511 | Bacteria | 11756 |
| 449 | nmdc:mga0n895_12124_c1 | 3300050512 | Bacteria | 7714 |
| 450 | nmdc:mga0n895_99923_c1 | 3300050512 | Bacteria | 2910 |
| 451 | nmdc:mga0rr50_164833_c1 | 3300050513 | Bacteria | 1801 |
| 452 | nmdc:mga08x19_166179_c1 | 3300050514 | Unclassified | 1500 |
| 453 | nmdc:mga0a205_1_c2 | 3300050515 | Bacteria | 266330 |
| 454 | Ga0495601_0000031 | 3300053077 | Bacteria | 105493 |
| 455 | Ga0495601_0002152 | 3300053077 | Bacteria | 11084 |
| 456 | Ga0495601_0146493 | 3300053077 | Bacteria | 1541 |
| 457 | Ga0495612_0025926 | 3300053078 | Bacteria | 2355 |
| 458 | Ga0495612_0065595 | 3300053078 | Bacteria | 1508 |
| 459 | Ga0495612_0185937 | 3300053078 | Bacteria | 913 |
| 460 | Ga0495655_0000004 | 3300053083 | Bacteria | 293683 |
| 461 | Ga0495655_0000804 | 3300053083 | Bacteria | 4930 |
| 462 | Ga0495595_0000004 | 3300053084 | Bacteria | 260821 |
| 463 | Ga0495595_0003017 | 3300053084 | Bacteria | 6657 |
| 464 | Ga0495595_0032542 | 3300053084 | Bacteria | 2349 |
| 465 | Ga0495619_0000194 | 3300053085 | Bacteria | 44733 |
| 466 | Ga0495619_0000327 | 3300053085 | Bacteria | 33238 |
| 467 | Ga0495619_0002539 | 3300053085 | Bacteria | 11949 |
| 468 | Ga0500572_146652 | 3300053111 | Unclassified | 770 |
| 469 | Ga0500614_000672 | 3300053123 | Bacteria | 8744 |
| 470 | Ga0500628_000004 | 3300053129 | Bacteria | 202098 |
| 471 | Ga0501084_0021500 | 3300054114 | Bacteria | 5378 |
| 472 | Ga0501084_0569829 | 3300054114 | Bacteria | 957 |
| 473 | Ga0501084_0656491 | 3300054114 | Bacteria | 885 |
| 474 | Ga0501082_0147549 | 3300060353 | Bacteria | 2042 |
| 475 | Ga0501082_0374979 | 3300060353 | Bacteria | 1241 |
| 476 | Ga0530510_0014154 | 3300061734 | Bacteria | 5624 |
| 477 | Ga0530510_0092072 | 3300061734 | Bacteria | 2212 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049576 | Ga0501040_0437739 | Ga0501040_0437739_104_637 | 148 |
| 2 | 3300041512 | Ga0451853_3071175 | Ga0451853_3071175_246_830 | 155 |
| 3 | 3300054114 | Ga0501084_0656491 | Ga0501084_0656491_322_855 | 166 |
| 4 | 3300049572 | Ga0501036_0632914 | Ga0501036_0632914_74_697 | 167 |
| 5 | 3300041486 | Ga0451807_2255517 | Ga0451807_2255517_22_648 | 168 |
| 6 | 3300053085 | Ga0495619_0000327 | Ga0495619_0000327_6240_6866 | 168 |
| 7 | 3300049591 | Ga0501075_0333914 | Ga0501075_0333914_106_729 | 169 |
| 8 | 3300005436 | Ga0070713_100178874 | Ga0070713_1001788742 | 172 |
| 9 | 3300005439 | Ga0070711_100142328 | Ga0070711_1001423282 | 172 |
| 10 | 3300025916 | Ga0207663_10040308 | Ga0207663_100403082 | 172 |
| 11 | 3300025928 | Ga0207700_10080838 | Ga0207700_100808382 | 172 |
| 12 | 3300005365 | Ga0070688_100000209 | Ga0070688_1000002099 | 173 |
| 13 | 3300005466 | Ga0070685_10000037 | Ga0070685_1000003724 | 173 |
| 14 | 3300046536 | Ga0495587_0248728 | Ga0495587_0248728_304_930 | 174 |
| 15 | 3300005937 | Ga0081455_10019034 | Ga0081455_100190345 | 175 |
| 16 | 3300006038 | Ga0075365_10000493 | Ga0075365_100004937 | 175 |
| 17 | 3300006051 | Ga0075364_10002586 | Ga0075364_100025866 | 175 |
| 18 | 3300050491 | nmdc:mga00v17_10616_c1 | nmdc:mga00v17_10616_c1_1588_2211 | 175 |
| 19 | 3300050492 | nmdc:mga0yw44_31398_c1 | nmdc:mga0yw44_31398_c1_1265_1888 | 175 |
| 20 | 3300041512 | Ga0451853_3058966 | Ga0451853_3058966_198_731 | 176 |
| 21 | 3300045976 | Ga0466967_0000005 | Ga0466967_0000005_22088_22720 | 177 |
| 22 | 3300005347 | Ga0070668_100024702 | Ga0070668_1000247022 | 179 |
| 23 | 3300005367 | Ga0070667_100017503 | Ga0070667_1000175035 | 179 |
| 24 | 3300005841 | Ga0068863_101264374 | Ga0068863_1012643741 | 179 |
| 25 | 3300005843 | Ga0068860_100209489 | Ga0068860_1002094892 | 179 |
| 26 | 3300005844 | Ga0068862_100002681 | Ga0068862_10000268110 | 179 |
| 27 | 3300009553 | Ga0105249_10003553 | Ga0105249_100035536 | 179 |
| 28 | 3300014968 | Ga0157379_10055580 | Ga0157379_100555804 | 179 |
| 29 | 3300025961 | Ga0207712_10011054 | Ga0207712_100110541 | 179 |
| 30 | 3300028381 | Ga0268264_10241449 | Ga0268264_102414492 | 179 |
| 31 | 3300049582 | Ga0501048_0592426 | Ga0501048_0592426_16_642 | 179 |
| 32 | 3300054114 | Ga0501084_0569829 | Ga0501084_0569829_178_804 | 179 |
| 33 | 3300005329 | Ga0070683_100006807 | Ga0070683_1000068077 | 181 |
| 34 | 3300006038 | Ga0075365_10122436 | Ga0075365_101224363 | 181 |
| 35 | 3300006051 | Ga0075364_10054383 | Ga0075364_100543835 | 181 |
| 36 | 3300009176 | Ga0105242_10096155 | Ga0105242_100961554 | 181 |
| 37 | 3300025934 | Ga0207686_10310618 | Ga0207686_103106181 | 181 |
| 38 | 3300025944 | Ga0207661_10025349 | Ga0207661_100253494 | 181 |
| 39 | 3300046683 | Ga0495658_0069622 | Ga0495658_0069622_1347_1979 | 181 |
| 40 | 3300048905 | Ga0496102_0313578 | Ga0496102_0313578_431_1057 | 181 |
| 41 | 3300050492 | nmdc:mga0yw44_50259_c1 | nmdc:mga0yw44_50259_c1_1427_2053 | 181 |
| 42 | 3300050512 | nmdc:mga0n895_12124_c1 | nmdc:mga0n895_12124_c1_1557_2156 | 181 |
| 43 | 3300013102 | Ga0157371_10028965 | Ga0157371_100289654 | 182 |
| 44 | 3300025944 | Ga0207661_10035113 | Ga0207661_100351131 | 182 |
| 45 | 3300044842 | Ga0466957_0136517 | Ga0466957_0136517_161_784 | 182 |
| 46 | 3300044842 | Ga0466957_0543199 | Ga0466957_0543199_94_726 | 182 |
| 47 | 3300045836 | Ga0466958_0236929 | Ga0466958_0236929_95_718 | 182 |
| 48 | 3300005337 | Ga0070682_100001703 | Ga0070682_1000017035 | 183 |
| 49 | 3300005440 | Ga0070705_100343305 | Ga0070705_1003433052 | 183 |
| 50 | 3300006852 | Ga0075433_10206692 | Ga0075433_102066922 | 183 |
| 51 | 3300006871 | Ga0075434_100041572 | Ga0075434_1000415724 | 183 |
| 52 | 3300007076 | Ga0075435_100465117 | Ga0075435_1004651172 | 183 |
| 53 | 3300009098 | Ga0105245_10627298 | Ga0105245_106272981 | 183 |
| 54 | 3300009147 | Ga0114129_10154171 | Ga0114129_101541713 | 183 |
| 55 | 3300031731 | Ga0307405_11210413 | Ga0307405_112104131 | 183 |
| 56 | 3300048907 | Ga0496104_0201412 | Ga0496104_0201412_365_994 | 183 |
| 57 | 3300049587 | Ga0501071_0405791 | Ga0501071_0405791_253_879 | 183 |
| 58 | 3300050512 | nmdc:mga0n895_99923_c1 | nmdc:mga0n895_99923_c1_1292_1918 | 183 |
| 59 | 3300050513 | nmdc:mga0rr50_164833_c1 | nmdc:mga0rr50_164833_c1_1050_1676 | 183 |
| 60 | 3300003659 | JGI25404J52841_10020320 | JGI25404J52841_100203202 | 184 |
| 61 | 3300005406 | Ga0070703_10030567 | Ga0070703_100305673 | 184 |
| 62 | 3300005614 | Ga0068856_100000210 | Ga0068856_10000021051 | 184 |
| 63 | 3300005719 | Ga0068861_100258079 | Ga0068861_1002580792 | 184 |
| 64 | 3300005983 | Ga0081540_1000358 | Ga0081540_100035825 | 184 |
| 65 | 3300017792 | Ga0163161_10011427 | Ga0163161_100114273 | 184 |
| 66 | 3300025885 | Ga0207653_10053313 | Ga0207653_100533132 | 184 |
| 67 | 3300026078 | Ga0207702_10000264 | Ga0207702_100002646 | 184 |
| 68 | 3300026118 | Ga0207675_100310803 | Ga0207675_1003108032 | 184 |
| 69 | 3300044693 | Ga0466961_0331934 | Ga0466961_0331934_56_676 | 184 |
| 70 | 3300046499 | Ga0495594_0000007 | Ga0495594_0000007_76962_77591 | 184 |
| 71 | 3300005329 | Ga0070683_100053256 | Ga0070683_1000532564 | 185 |
| 72 | 3300025944 | Ga0207661_10074488 | Ga0207661_100744882 | 185 |
| 73 | 3300005354 | Ga0070675_100000008 | Ga0070675_100000008245 | 186 |
| 74 | 3300013297 | Ga0157378_10005134 | Ga0157378_100051346 | 186 |
| 75 | 3300025926 | Ga0207659_10000014 | Ga0207659_1000001468 | 186 |
| 76 | 3300005353 | Ga0070669_100134435 | Ga0070669_1001344352 | 187 |
| 77 | 3300025923 | Ga0207681_10047406 | Ga0207681_100474062 | 187 |
| 78 | 3300046533 | Ga0495640_0273431 | Ga0495640_0273431_251_874 | 187 |
| 79 | 3300046535 | Ga0495586_0000862 | Ga0495586_0000862_15315_15950 | 187 |
| 80 | 3300046642 | Ga0495634_0463200 | Ga0495634_0463200_103_726 | 187 |
| 81 | 3300046689 | Ga0495613_0285008 | Ga0495613_0285008_311_967 | 187 |
| 82 | 3300047444 | Ga0495675_0172425 | Ga0495675_0172425_368_997 | 187 |
| 83 | 3300049742 | Ga0501080_0363465 | Ga0501080_0363465_592_1221 | 187 |
| 84 | 3300005329 | Ga0070683_100005990 | Ga0070683_1000059908 | 188 |
| 85 | 3300005364 | Ga0070673_100002647 | Ga0070673_1000026479 | 188 |
| 86 | 3300005459 | Ga0068867_100000814 | Ga0068867_10000081420 | 188 |
| 87 | 3300005535 | Ga0070684_100025703 | Ga0070684_1000257034 | 188 |
| 88 | 3300005841 | Ga0068863_100000004 | Ga0068863_1000000049 | 188 |
| 89 | 3300005983 | Ga0081540_1001283 | Ga0081540_100128313 | 188 |
| 90 | 3300009094 | Ga0111539_10031246 | Ga0111539_100312464 | 188 |
| 91 | 3300014325 | Ga0163163_10193126 | Ga0163163_101931263 | 188 |
| 92 | 3300014326 | Ga0157380_10001764 | Ga0157380_100017649 | 188 |
| 93 | 3300025944 | Ga0207661_10004059 | Ga0207661_100040594 | 188 |
| 94 | 3300025960 | Ga0207651_10010018 | Ga0207651_100100183 | 188 |
| 95 | 3300026088 | Ga0207641_10000129 | Ga0207641_100001299 | 188 |
| 96 | 3300026089 | Ga0207648_10000271 | Ga0207648_100002714 | 188 |
| 97 | 3300046455 | Ga0495603_0003276 | Ga0495603_0003276_1132_1758 | 188 |
| 98 | 3300046476 | Ga0495662_0011167 | Ga0495662_0011167_116_742 | 188 |
| 99 | 3300049576 | Ga0501040_0183643 | Ga0501040_0183643_785_1414 | 188 |
| 100 | 3300049578 | Ga0501042_0191292 | Ga0501042_0191292_18_647 | 188 |
| 101 | 3300049587 | Ga0501071_0064909 | Ga0501071_0064909_142_771 | 188 |
| 102 | 3300049588 | Ga0501072_0108933 | Ga0501072_0108933_1191_1820 | 188 |
| 103 | 3300049593 | Ga0501077_0097812 | Ga0501077_0097812_1191_1820 | 188 |
| 104 | 3300049741 | Ga0501079_0112023 | Ga0501079_0112023_637_1266 | 188 |
| 105 | 3300049743 | Ga0501081_0287801 | Ga0501081_0287801_179_808 | 188 |
| 106 | 3300049824 | Ga0501045_0050631 | Ga0501045_0050631_938_1567 | 188 |
| 107 | 3300050510 | nmdc:mga06r32_68450_c1 | nmdc:mga06r32_68450_c1_1467_2066 | 188 |
| 108 | 3300050511 | nmdc:mga08y16_7100_c1 | nmdc:mga08y16_7100_c1_9903_10502 | 188 |
| 109 | 3300054114 | Ga0501084_0021500 | Ga0501084_0021500_3082_3711 | 188 |
| 110 | 3300061734 | Ga0530510_0014154 | Ga0530510_0014154_613_1242 | 188 |
| 111 | 3300005841 | Ga0068863_100008789 | Ga0068863_1000087897 | 189 |
| 112 | 3300006175 | Ga0070712_100000820 | Ga0070712_10000082015 | 189 |
| 113 | 3300007076 | Ga0075435_100558977 | Ga0075435_1005589772 | 189 |
| 114 | 3300009176 | Ga0105242_10002566 | Ga0105242_1000256611 | 189 |
| 115 | 3300025915 | Ga0207693_10004891 | Ga0207693_100048915 | 189 |
| 116 | 3300025929 | Ga0207664_10367286 | Ga0207664_103672862 | 189 |
| 117 | 3300025934 | Ga0207686_10000032 | Ga0207686_10000032154 | 189 |
| 118 | 3300026035 | Ga0207703_10387620 | Ga0207703_103876201 | 189 |
| 119 | 3300026088 | Ga0207641_10004274 | Ga0207641_100042745 | 189 |
| 120 | 3300046533 | Ga0495640_0018466 | Ga0495640_0018466_3685_4314 | 189 |
| 121 | 3300047319 | Ga0495674_0000020 | Ga0495674_0000020_2833_3462 | 189 |
| 122 | 3300047321 | Ga0495676_0264872 | Ga0495676_0264872_62_685 | 189 |
| 123 | 3300047472 | Ga0495686_0051474 | Ga0495686_0051474_615_1244 | 189 |
| 124 | 3300048905 | Ga0496102_0000045 | Ga0496102_0000045_76219_76845 | 189 |
| 125 | 3300048905 | Ga0496102_0334036 | Ga0496102_0334036_109_738 | 189 |
| 126 | 3300048906 | Ga0496103_0000050 | Ga0496103_0000050_75188_75814 | 189 |
| 127 | 3300048906 | Ga0496103_0052093 | Ga0496103_0052093_1533_2162 | 189 |
| 128 | 3300048921 | Ga0496118_0262066 | Ga0496118_0262066_263_892 | 189 |
| 129 | 3300050514 | nmdc:mga08x19_166179_c1 | nmdc:mga08x19_166179_c1_82_705 | 189 |
| 130 | 3300053078 | Ga0495612_0025926 | Ga0495612_0025926_1094_1720 | 189 |
| 131 | 3300053083 | Ga0495655_0000004 | Ga0495655_0000004_151855_152481 | 189 |
| 132 | 3300053083 | Ga0495655_0000804 | Ga0495655_0000804_2271_2903 | 189 |
| 133 | 3300053085 | Ga0495619_0002539 | Ga0495619_0002539_2719_3342 | 189 |
| 134 | 3300053129 | Ga0500628_000004 | Ga0500628_000004_60270_60896 | 189 |
| 135 | 3300005338 | Ga0068868_100001566 | Ga0068868_10000156612 | 190 |
| 136 | 3300005356 | Ga0070674_100000063 | Ga0070674_10000006321 | 190 |
| 137 | 3300005365 | Ga0070688_100154740 | Ga0070688_1001547401 | 190 |
| 138 | 3300005365 | Ga0070688_100337361 | Ga0070688_1003373612 | 190 |
| 139 | 3300005718 | Ga0068866_10000011 | Ga0068866_1000001122 | 190 |
| 140 | 3300009011 | Ga0105251_10196945 | Ga0105251_101969451 | 190 |
| 141 | 3300025899 | Ga0207642_10000010 | Ga0207642_1000001073 | 190 |
| 142 | 3300025937 | Ga0207669_10000025 | Ga0207669_1000002511 | 190 |
| 143 | 3300026023 | Ga0207677_10014967 | Ga0207677_100149673 | 190 |
| 144 | 3300044842 | Ga0466957_0006793 | Ga0466957_0006793_291_923 | 190 |
| 145 | 3300046473 | Ga0495582_0000013 | Ga0495582_0000013_55104_55733 | 190 |
| 146 | 3300046511 | Ga0495608_0000898 | Ga0495608_0000898_11920_12552 | 190 |
| 147 | 3300046517 | Ga0495630_0003759 | Ga0495630_0003759_126_752 | 190 |
| 148 | 3300046539 | Ga0495621_0194443 | Ga0495621_0194443_106_765 | 190 |
| 149 | 3300046642 | Ga0495634_0067092 | Ga0495634_0067092_1440_2105 | 190 |
| 150 | 3300046675 | Ga0495657_0000070 | Ga0495657_0000070_83278_83910 | 190 |
| 151 | 3300046681 | Ga0495647_0006284 | Ga0495647_0006284_1890_2516 | 190 |
| 152 | 3300046683 | Ga0495658_0000009 | Ga0495658_0000009_54649_55278 | 190 |
| 153 | 3300047444 | Ga0495675_0003693 | Ga0495675_0003693_314_946 | 190 |
| 154 | 3300053084 | Ga0495595_0000004 | Ga0495595_0000004_251717_252349 | 190 |
| 155 | 3300053085 | Ga0495619_0000194 | Ga0495619_0000194_8318_8950 | 190 |
| 156 | 3300006237 | Ga0097621_100047803 | Ga0097621_1000478032 | 191 |
| 157 | 3300006846 | Ga0075430_100023632 | Ga0075430_1000236324 | 191 |
| 158 | 3300014326 | Ga0157380_10005377 | Ga0157380_100053774 | 191 |
| 159 | 3300017792 | Ga0163161_10000018 | Ga0163161_1000001870 | 191 |
| 160 | 3300025899 | Ga0207642_10117913 | Ga0207642_101179131 | 191 |
| 161 | 3300046511 | Ga0495608_0000854 | Ga0495608_0000854_2000_2626 | 191 |
| 162 | 3300046516 | Ga0495628_0131321 | Ga0495628_0131321_1114_1740 | 191 |
| 163 | 3300046689 | Ga0495613_0000157 | Ga0495613_0000157_18555_19181 | 191 |
| 164 | 3300047322 | Ga0495680_0118338 | Ga0495680_0118338_291_917 | 191 |
| 165 | 3300048912 | Ga0496109_0000039 | Ga0496109_0000039_134873_135505 | 191 |
| 166 | 3300048917 | Ga0496114_0000003 | Ga0496114_0000003_130878_131504 | 191 |
| 167 | 3300048918 | Ga0496115_0003312 | Ga0496115_0003312_10274_10900 | 191 |
| 168 | 3300053084 | Ga0495595_0003017 | Ga0495595_0003017_3604_4230 | 191 |
| 169 | 3300005543 | Ga0070672_100000058 | Ga0070672_10000005850 | 192 |
| 170 | 3300046529 | Ga0495652_0000003 | Ga0495652_0000003_207019_207648 | 192 |
| 171 | 3300048911 | Ga0496108_0000080 | Ga0496108_0000080_73903_74535 | 192 |
| 172 | 3300048912 | Ga0496109_0000024 | Ga0496109_0000024_73903_74535 | 192 |
| 173 | 3300048913 | Ga0496110_0000121 | Ga0496110_0000121_27910_28542 | 192 |
| 174 | 3300048914 | Ga0496111_0000210 | Ga0496111_0000210_21727_22359 | 192 |
| 175 | 3300002077 | JGI24744J21845_10043465 | JGI24744J21845_100434651 | 193 |
| 176 | 3300005330 | Ga0070690_100039142 | Ga0070690_1000391423 | 193 |
| 177 | 3300005335 | Ga0070666_10140581 | Ga0070666_101405812 | 193 |
| 178 | 3300005337 | Ga0070682_100178220 | Ga0070682_1001782202 | 193 |
| 179 | 3300005364 | Ga0070673_100311210 | Ga0070673_1003112102 | 193 |
| 180 | 3300005367 | Ga0070667_100489797 | Ga0070667_1004897972 | 193 |
| 181 | 3300005438 | Ga0070701_10617311 | Ga0070701_106173111 | 193 |
| 182 | 3300005445 | Ga0070708_100608365 | Ga0070708_1006083651 | 193 |
| 183 | 3300005456 | Ga0070678_100016588 | Ga0070678_1000165884 | 193 |
| 184 | 3300005466 | Ga0070685_10161879 | Ga0070685_101618793 | 193 |
| 185 | 3300005467 | Ga0070706_100248144 | Ga0070706_1002481442 | 193 |
| 186 | 3300005535 | Ga0070684_100466192 | Ga0070684_1004661922 | 193 |
| 187 | 3300005544 | Ga0070686_100020781 | Ga0070686_1000207814 | 193 |
| 188 | 3300005549 | Ga0070704_100086849 | Ga0070704_1000868493 | 193 |
| 189 | 3300005719 | Ga0068861_100226467 | Ga0068861_1002264671 | 193 |
| 190 | 3300006048 | Ga0075363_100059520 | Ga0075363_1000595203 | 193 |
| 191 | 3300006173 | Ga0070716_100135535 | Ga0070716_1001355353 | 193 |
| 192 | 3300006175 | Ga0070712_100042651 | Ga0070712_1000426514 | 193 |
| 193 | 3300006178 | Ga0075367_10024128 | Ga0075367_100241284 | 193 |
| 194 | 3300006881 | Ga0068865_100161823 | Ga0068865_1001618231 | 193 |
| 195 | 3300009098 | Ga0105245_10002356 | Ga0105245_100023569 | 193 |
| 196 | 3300009101 | Ga0105247_10043232 | Ga0105247_100432324 | 193 |
| 197 | 3300009148 | Ga0105243_10244111 | Ga0105243_102441113 | 193 |
| 198 | 3300009176 | Ga0105242_10182191 | Ga0105242_101821912 | 193 |
| 199 | 3300009177 | Ga0105248_10175674 | Ga0105248_101756742 | 193 |
| 200 | 3300009553 | Ga0105249_10263968 | Ga0105249_102639683 | 193 |
| 201 | 3300013296 | Ga0157374_10246573 | Ga0157374_102465733 | 193 |
| 202 | 3300013308 | Ga0157375_10026644 | Ga0157375_100266443 | 193 |
| 203 | 3300014325 | Ga0163163_10416520 | Ga0163163_104165203 | 193 |
| 204 | 3300025903 | Ga0207680_10519132 | Ga0207680_105191321 | 193 |
| 205 | 3300025915 | Ga0207693_10060574 | Ga0207693_100605744 | 193 |
| 206 | 3300025927 | Ga0207687_10074846 | Ga0207687_100748463 | 193 |
| 207 | 3300025935 | Ga0207709_10494063 | Ga0207709_104940631 | 193 |
| 208 | 3300025938 | Ga0207704_10000045 | Ga0207704_1000004572 | 193 |
| 209 | 3300025941 | Ga0207711_10392840 | Ga0207711_103928402 | 193 |
| 210 | 3300025960 | Ga0207651_10037162 | Ga0207651_100371622 | 193 |
| 211 | 3300025961 | Ga0207712_10144211 | Ga0207712_101442113 | 193 |
| 212 | 3300026089 | Ga0207648_10121228 | Ga0207648_101212282 | 193 |
| 213 | 3300026118 | Ga0207675_100164365 | Ga0207675_1001643653 | 193 |
| 214 | 3300026121 | Ga0207683_10058421 | Ga0207683_100584214 | 193 |
| 215 | 3300046461 | Ga0495641_0013632 | Ga0495641_0013632_641_1264 | 193 |
| 216 | 3300046512 | Ga0495610_0021361 | Ga0495610_0021361_220_852 | 193 |
| 217 | 3300047321 | Ga0495676_0034159 | Ga0495676_0034159_1042_1665 | 193 |
| 218 | 3300048905 | Ga0496102_0012169 | Ga0496102_0012169_1063_1686 | 193 |
| 219 | 3300048906 | Ga0496103_0003423 | Ga0496103_0003423_2199_2822 | 193 |
| 220 | 3300048908 | Ga0496105_0039467 | Ga0496105_0039467_940_1563 | 193 |
| 221 | 3300048909 | Ga0496106_0017707 | Ga0496106_0017707_799_1422 | 193 |
| 222 | 3300048910 | Ga0496107_0013295 | Ga0496107_0013295_1067_1690 | 193 |
| 223 | 3300048911 | Ga0496108_0199872 | Ga0496108_0199872_536_1159 | 193 |
| 224 | 3300048912 | Ga0496109_0295394 | Ga0496109_0295394_221_844 | 193 |
| 225 | 3300048913 | Ga0496110_0003251 | Ga0496110_0003251_4676_5299 | 193 |
| 226 | 3300048914 | Ga0496111_0004560 | Ga0496111_0004560_1084_1707 | 193 |
| 227 | 3300048915 | Ga0496112_0238311 | Ga0496112_0238311_413_1036 | 193 |
| 228 | 3300048916 | Ga0496113_0043961 | Ga0496113_0043961_311_934 | 193 |
| 229 | 3300048918 | Ga0496115_0015135 | Ga0496115_0015135_4261_4884 | 193 |
| 230 | 3300049578 | Ga0501042_0608682 | Ga0501042_0608682_42_674 | 193 |
| 231 | 3300050490 | nmdc:mga03n38_13970_c1 | nmdc:mga03n38_13970_c1_1575_2198 | 193 |
| 232 | 3300050492 | nmdc:mga0yw44_117758_c1 | nmdc:mga0yw44_117758_c1_91_714 | 193 |
| 233 | 3300005616 | Ga0068852_100197098 | Ga0068852_1001970982 | 194 |
| 234 | 3300009545 | Ga0105237_10433925 | Ga0105237_104339252 | 194 |
| 235 | 3300025907 | Ga0207645_10279718 | Ga0207645_102797181 | 194 |
| 236 | 3300026142 | Ga0207698_10014508 | Ga0207698_100145082 | 194 |
| 237 | 3300032126 | Ga0307415_100029047 | Ga0307415_1000290474 | 194 |
| 238 | 3300046537 | Ga0495598_0018786 | Ga0495598_0018786_474_1109 | 194 |
| 239 | 3300005457 | Ga0070662_100000038 | Ga0070662_10000003871 | 195 |
| 240 | 3300025933 | Ga0207706_10000026 | Ga0207706_1000002684 | 195 |
| 241 | 3300028558 | Ga0265326_10118071 | Ga0265326_101180711 | 195 |
| 242 | 3300028563 | Ga0265319_1004983 | Ga0265319_10049836 | 195 |
| 243 | 3300028800 | Ga0265338_10002514 | Ga0265338_1000251421 | 195 |
| 244 | 3300031241 | Ga0265325_10078588 | Ga0265325_100785882 | 195 |
| 245 | 3300005456 | Ga0070678_100040663 | Ga0070678_1000406633 | 196 |
| 246 | 3300005834 | Ga0068851_10003257 | Ga0068851_100032574 | 196 |
| 247 | 3300005937 | Ga0081455_10205275 | Ga0081455_102052751 | 196 |
| 248 | 3300005985 | Ga0081539_10001387 | Ga0081539_1000138730 | 196 |
| 249 | 3300006844 | Ga0075428_100307103 | Ga0075428_1003071031 | 196 |
| 250 | 3300006847 | Ga0075431_100004630 | Ga0075431_1000046306 | 196 |
| 251 | 3300025321 | Ga0207656_10005080 | Ga0207656_100050803 | 196 |
| 252 | 3300026067 | Ga0207678_10234707 | Ga0207678_102347071 | 196 |
| 253 | 3300026121 | Ga0207683_10056571 | Ga0207683_100565712 | 196 |
| 254 | 3300037312 | Ga0395899_0057152 | Ga0395899_0057152_266_889 | 196 |
| 255 | 3300037418 | Ga0395900_0081114 | Ga0395900_0081114_945_1568 | 196 |
| 256 | 3300037466 | Ga0395898_0004526 | Ga0395898_0004526_1049_1711 | 196 |
| 257 | 3300037466 | Ga0395898_0682605 | Ga0395898_0682605_61_690 | 196 |
| 258 | 3300037471 | Ga0395905_0007513 | Ga0395905_0007513_9540_10163 | 196 |
| 259 | 3300038443 | Ga0395901_0112981 | Ga0395901_0112981_2060_2683 | 196 |
| 260 | 3300046461 | Ga0495641_0024350 | Ga0495641_0024350_1318_1950 | 196 |
| 261 | 3300046507 | Ga0495606_0000057 | Ga0495606_0000057_122276_122908 | 196 |
| 262 | 3300046517 | Ga0495630_0000011 | Ga0495630_0000011_116802_117434 | 196 |
| 263 | 3300046681 | Ga0495647_0019535 | Ga0495647_0019535_1448_2080 | 196 |
| 264 | 3300047321 | Ga0495676_0046016 | Ga0495676_0046016_430_1062 | 196 |
| 265 | 3300048912 | Ga0496109_0073866 | Ga0496109_0073866_2456_3082 | 196 |
| 266 | 3300048916 | Ga0496113_0115916 | Ga0496113_0115916_57_683 | 196 |
| 267 | 3300049574 | Ga0501038_0162904 | Ga0501038_0162904_694_1317 | 196 |
| 268 | 3300049576 | Ga0501040_0277433 | Ga0501040_0277433_389_1012 | 196 |
| 269 | 3300049577 | Ga0501041_0162277 | Ga0501041_0162277_54_677 | 196 |
| 270 | 3300049578 | Ga0501042_0087361 | Ga0501042_0087361_589_1212 | 196 |
| 271 | 3300049579 | Ga0501043_0729353 | Ga0501043_0729353_43_666 | 196 |
| 272 | 3300049584 | Ga0501068_0472883 | Ga0501068_0472883_71_694 | 196 |
| 273 | 3300049587 | Ga0501071_0214617 | Ga0501071_0214617_313_936 | 196 |
| 274 | 3300049588 | Ga0501072_0273259 | Ga0501072_0273259_177_800 | 196 |
| 275 | 3300049592 | Ga0501076_0209195 | Ga0501076_0209195_618_1241 | 196 |
| 276 | 3300049593 | Ga0501077_0033600 | Ga0501077_0033600_372_995 | 196 |
| 277 | 3300049741 | Ga0501079_0032903 | Ga0501079_0032903_267_890 | 196 |
| 278 | 3300049743 | Ga0501081_0022091 | Ga0501081_0022091_2178_2801 | 196 |
| 279 | 3300049824 | Ga0501045_0062354 | Ga0501045_0062354_522_1145 | 196 |
| 280 | 3300053077 | Ga0495601_0146493 | Ga0495601_0146493_834_1466 | 196 |
| 281 | 3300053078 | Ga0495612_0185937 | Ga0495612_0185937_171_803 | 196 |
| 282 | 3300060353 | Ga0501082_0147549 | Ga0501082_0147549_191_814 | 196 |
| 283 | 3300061734 | Ga0530510_0092072 | Ga0530510_0092072_535_1158 | 196 |
| 284 | 3300026116 | Ga0207674_10266948 | Ga0207674_102669482 | 197 |
| 285 | 3300046459 | Ga0495629_0197914 | Ga0495629_0197914_415_1038 | 197 |
| 286 | 3300046462 | Ga0495651_0274997 | Ga0495651_0274997_100_726 | 197 |
| 287 | 3300046558 | Ga0495633_0072411 | Ga0495633_0072411_208_831 | 197 |
| 288 | 3300046691 | Ga0495670_0007137 | Ga0495670_0007137_1906_2529 | 197 |
| 289 | 3300049575 | Ga0501039_0162079 | Ga0501039_0162079_151_777 | 197 |
| 290 | 3300049587 | Ga0501071_0669299 | Ga0501071_0669299_154_780 | 197 |
| 291 | 3300049588 | Ga0501072_0031425 | Ga0501072_0031425_1653_2279 | 197 |
| 292 | 3300049592 | Ga0501076_0141463 | Ga0501076_0141463_863_1489 | 197 |
| 293 | 3300049743 | Ga0501081_0062946 | Ga0501081_0062946_688_1314 | 197 |
| 294 | 3300060353 | Ga0501082_0374979 | Ga0501082_0374979_183_809 | 197 |
| 295 | 3300005549 | Ga0070704_100217293 | Ga0070704_1002172932 | 198 |
| 296 | 3300005549 | Ga0070704_100489799 | Ga0070704_1004897992 | 198 |
| 297 | 3300009147 | Ga0114129_10441170 | Ga0114129_104411702 | 198 |
| 298 | 3300028381 | Ga0268264_10354388 | Ga0268264_103543882 | 198 |
| 299 | 3300046523 | Ga0495644_0001822 | Ga0495644_0001822_2458_3093 | 198 |
| 300 | 3300046690 | Ga0495624_0000548 | Ga0495624_0000548_16967_17599 | 198 |
| 301 | 3300050507 | nmdc:mga05p37_360950_c1 | nmdc:mga05p37_360950_c1_445_1068 | 198 |
| 302 | 3300053111 | Ga0500572_146652 | Ga0500572_146652_29_625 | 198 |
| 303 | 3300005356 | Ga0070674_100000001 | Ga0070674_100000001205 | 199 |
| 304 | 3300005718 | Ga0068866_10000149 | Ga0068866_1000014915 | 199 |
| 305 | 3300009148 | Ga0105243_10102617 | Ga0105243_101026172 | 199 |
| 306 | 3300025899 | Ga0207642_10000044 | Ga0207642_1000004415 | 199 |
| 307 | 3300025937 | Ga0207669_10000002 | Ga0207669_10000002144 | 199 |
| 308 | 3300046454 | Ga0495592_0064708 | Ga0495592_0064708_1740_2363 | 199 |
| 309 | 3300046455 | Ga0495603_0001089 | Ga0495603_0001089_1254_1877 | 199 |
| 310 | 3300046536 | Ga0495587_0012830 | Ga0495587_0012830_699_1325 | 199 |
| 311 | 3300049824 | Ga0501045_0417893 | Ga0501045_0417893_358_984 | 199 |
| 312 | 3300005564 | Ga0070664_100198880 | Ga0070664_1001988804 | 200 |
| 313 | 3300005616 | Ga0068852_100000005 | Ga0068852_100000005135 | 200 |
| 314 | 3300006852 | Ga0075433_10000647 | Ga0075433_1000064710 | 200 |
| 315 | 3300009147 | Ga0114129_10337592 | Ga0114129_103375923 | 200 |
| 316 | 3300009148 | Ga0105243_10034255 | Ga0105243_100342554 | 200 |
| 317 | 3300013296 | Ga0157374_10184028 | Ga0157374_101840282 | 200 |
| 318 | 3300025935 | Ga0207709_10002024 | Ga0207709_1000202410 | 200 |
| 319 | 3300025945 | Ga0207679_10169117 | Ga0207679_101691174 | 200 |
| 320 | 3300026142 | Ga0207698_10000038 | Ga0207698_1000003856 | 200 |
| 321 | 3300037418 | Ga0395900_0218359 | Ga0395900_0218359_319_942 | 200 |
| 322 | 3300037466 | Ga0395898_0089277 | Ga0395898_0089277_1974_2597 | 200 |
| 323 | 3300038443 | Ga0395901_0090900 | Ga0395901_0090900_1170_1793 | 200 |
| 324 | 3300045836 | Ga0466958_0218540 | Ga0466958_0218540_404_1036 | 200 |
| 325 | 3300046516 | Ga0495628_0010801 | Ga0495628_0010801_5873_6499 | 200 |
| 326 | 3300046517 | Ga0495630_0344715 | Ga0495630_0344715_128_754 | 200 |
| 327 | 3300046678 | Ga0495599_0036517 | Ga0495599_0036517_2304_2930 | 200 |
| 328 | 3300046690 | Ga0495624_0014428 | Ga0495624_0014428_2062_2685 | 200 |
| 329 | 3300046809 | Ga0495600_0006485 | Ga0495600_0006485_6393_7016 | 200 |
| 330 | 3300050507 | nmdc:mga05p37_138303_c1 | nmdc:mga05p37_138303_c1_347_970 | 200 |
| 331 | 3300050515 | nmdc:mga0a205_1_c2 | nmdc:mga0a205_1_c2_170918_171541 | 200 |
| 332 | 3300009177 | Ga0105248_10000134 | Ga0105248_100001348 | 201 |
| 333 | 3300013104 | Ga0157370_10031894 | Ga0157370_100318944 | 201 |
| 334 | 3300025941 | Ga0207711_10000024 | Ga0207711_10000024212 | 201 |
| 335 | 3300025986 | Ga0207658_10174693 | Ga0207658_101746932 | 201 |
| 336 | 3300026041 | Ga0207639_10065146 | Ga0207639_100651462 | 201 |
| 337 | 3300044694 | Ga0466963_0004375 | Ga0466963_0004375_633_1265 | 201 |
| 338 | 3300046459 | Ga0495629_0000055 | Ga0495629_0000055_70143_70775 | 201 |
| 339 | 3300046463 | Ga0495653_0090252 | Ga0495653_0090252_128_754 | 201 |
| 340 | 3300046514 | Ga0495618_0000075 | Ga0495618_0000075_69153_69779 | 201 |
| 341 | 3300046675 | Ga0495657_0009280 | Ga0495657_0009280_4886_5512 | 201 |
| 342 | 3300046809 | Ga0495600_0188790 | Ga0495600_0188790_208_831 | 201 |
| 343 | 3300048909 | Ga0496106_0000049 | Ga0496106_0000049_92617_93243 | 201 |
| 344 | 3300048910 | Ga0496107_0012980 | Ga0496107_0012980_4760_5386 | 201 |
| 345 | 3300049741 | Ga0501079_0492412 | Ga0501079_0492412_52_675 | 201 |
| 346 | 3300005344 | Ga0070661_100000005 | Ga0070661_1000000059 | 202 |
| 347 | 3300005535 | Ga0070684_100234554 | Ga0070684_1002345541 | 202 |
| 348 | 3300005840 | Ga0068870_10155222 | Ga0068870_101552222 | 202 |
| 349 | 3300013104 | Ga0157370_10140095 | Ga0157370_101400953 | 202 |
| 350 | 3300025908 | Ga0207643_10157908 | Ga0207643_101579082 | 202 |
| 351 | 3300025920 | Ga0207649_10000005 | Ga0207649_10000005154 | 202 |
| 352 | 3300025932 | Ga0207690_10007967 | Ga0207690_100079672 | 202 |
| 353 | 3300044694 | Ga0466963_0000547 | Ga0466963_0000547_8464_9129 | 202 |
| 354 | 3300046642 | Ga0495634_0159457 | Ga0495634_0159457_351_977 | 202 |
| 355 | 3300046684 | Ga0495669_0000103 | Ga0495669_0000103_25602_26228 | 202 |
| 356 | 3300047317 | Ga0495604_0000289 | Ga0495604_0000289_27843_28472 | 202 |
| 357 | 3300047322 | Ga0495680_0000952 | Ga0495680_0000952_19621_20247 | 202 |
| 358 | 3300048903 | Ga0496100_0000007 | Ga0496100_0000007_186873_187499 | 202 |
| 359 | 3300048904 | Ga0496101_0000013 | Ga0496101_0000013_186873_187499 | 202 |
| 360 | 3300048907 | Ga0496104_0000013 | Ga0496104_0000013_113805_114431 | 202 |
| 361 | 3300048908 | Ga0496105_0000006 | Ga0496105_0000006_282733_283359 | 202 |
| 362 | 3300048909 | Ga0496106_0000006 | Ga0496106_0000006_181012_181638 | 202 |
| 363 | 3300048910 | Ga0496107_0000007 | Ga0496107_0000007_181014_181640 | 202 |
| 364 | 3300048922 | Ga0496119_0214540 | Ga0496119_0214540_281_907 | 202 |
| 365 | 3300049586 | Ga0501070_0137202 | Ga0501070_0137202_646_1272 | 202 |
| 366 | 3300049588 | Ga0501072_0202950 | Ga0501072_0202950_530_1156 | 202 |
| 367 | 3300046681 | Ga0495647_0000027 | Ga0495647_0000027_47852_48475 | 206 |
| 368 | 3300047317 | Ga0495604_0000346 | Ga0495604_0000346_16317_16940 | 206 |
| 369 | 3300048088 | Ga0495602_0000547 | Ga0495602_0000547_31261_31884 | 206 |
| 370 | 3300001979 | JGI24740J21852_10004061 | JGI24740J21852_100040616 | 207 |
| 371 | 3300005333 | Ga0070677_10000013 | Ga0070677_1000001310 | 207 |
| 372 | 3300005336 | Ga0070680_100224500 | Ga0070680_1002245003 | 207 |
| 373 | 3300005337 | Ga0070682_100000077 | Ga0070682_10000007773 | 207 |
| 374 | 3300005337 | Ga0070682_100369028 | Ga0070682_1003690282 | 207 |
| 375 | 3300005341 | Ga0070691_10000014 | Ga0070691_1000001440 | 207 |
| 376 | 3300005365 | Ga0070688_100000022 | Ga0070688_10000002226 | 207 |
| 377 | 3300005436 | Ga0070713_100000022 | Ga0070713_10000002281 | 207 |
| 378 | 3300005466 | Ga0070685_10000047 | Ga0070685_1000004748 | 207 |
| 379 | 3300005530 | Ga0070679_100000069 | Ga0070679_10000006932 | 207 |
| 380 | 3300005535 | Ga0070684_100314218 | Ga0070684_1003142182 | 207 |
| 381 | 3300005539 | Ga0068853_100003809 | Ga0068853_1000038094 | 207 |
| 382 | 3300005547 | Ga0070693_100004639 | Ga0070693_1000046397 | 207 |
| 383 | 3300005548 | Ga0070665_100000068 | Ga0070665_10000006837 | 207 |
| 384 | 3300005578 | Ga0068854_100065024 | Ga0068854_1000650243 | 207 |
| 385 | 3300005614 | Ga0068856_100074401 | Ga0068856_1000744013 | 207 |
| 386 | 3300005842 | Ga0068858_100000012 | Ga0068858_100000012210 | 207 |
| 387 | 3300009098 | Ga0105245_10000012 | Ga0105245_1000001220 | 207 |
| 388 | 3300009098 | Ga0105245_10000147 | Ga0105245_100001478 | 207 |
| 389 | 3300009098 | Ga0105245_10005525 | Ga0105245_100055251 | 207 |
| 390 | 3300009101 | Ga0105247_10000516 | Ga0105247_1000051622 | 207 |
| 391 | 3300009101 | Ga0105247_10207528 | Ga0105247_102075281 | 207 |
| 392 | 3300009176 | Ga0105242_10002409 | Ga0105242_100024097 | 207 |
| 393 | 3300009176 | Ga0105242_10269972 | Ga0105242_102699721 | 207 |
| 394 | 3300009553 | Ga0105249_10000235 | Ga0105249_1000023525 | 207 |
| 395 | 3300013105 | Ga0157369_10000130 | Ga0157369_1000013015 | 207 |
| 396 | 3300013297 | Ga0157378_10009732 | Ga0157378_100097327 | 207 |
| 397 | 3300014968 | Ga0157379_10035211 | Ga0157379_100352114 | 207 |
| 398 | 3300025893 | Ga0207682_10000038 | Ga0207682_1000003810 | 207 |
| 399 | 3300025900 | Ga0207710_10000276 | Ga0207710_1000027616 | 207 |
| 400 | 3300025912 | Ga0207707_10067539 | Ga0207707_100675393 | 207 |
| 401 | 3300025917 | Ga0207660_10193300 | Ga0207660_101933002 | 207 |
| 402 | 3300025921 | Ga0207652_10000142 | Ga0207652_1000014250 | 207 |
| 403 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004885 | 207 |
| 404 | 3300025927 | Ga0207687_10000011 | Ga0207687_1000001173 | 207 |
| 405 | 3300025927 | Ga0207687_10000026 | Ga0207687_10000026176 | 207 |
| 406 | 3300025927 | Ga0207687_10000133 | Ga0207687_100001331 | 207 |
| 407 | 3300025928 | Ga0207700_10000008 | Ga0207700_1000000870 | 207 |
| 408 | 3300025934 | Ga0207686_10002705 | Ga0207686_100027057 | 207 |
| 409 | 3300025934 | Ga0207686_10189257 | Ga0207686_101892572 | 207 |
| 410 | 3300025937 | Ga0207669_10129696 | Ga0207669_101296962 | 207 |
| 411 | 3300025945 | Ga0207679_10083871 | Ga0207679_100838713 | 207 |
| 412 | 3300025961 | Ga0207712_10000037 | Ga0207712_10000037110 | 207 |
| 413 | 3300025981 | Ga0207640_10016872 | Ga0207640_100168724 | 207 |
| 414 | 3300026023 | Ga0207677_10000142 | Ga0207677_1000014256 | 207 |
| 415 | 3300026035 | Ga0207703_10000550 | Ga0207703_100005509 | 207 |
| 416 | 3300026041 | Ga0207639_10002159 | Ga0207639_100021596 | 207 |
| 417 | 3300026078 | Ga0207702_10019410 | Ga0207702_100194104 | 207 |
| 418 | 3300026118 | Ga0207675_100379021 | Ga0207675_1003790212 | 207 |
| 419 | 3300028379 | Ga0268266_10000020 | Ga0268266_10000020364 | 207 |
| 420 | 3300028556 | Ga0265337_1001606 | Ga0265337_10016069 | 207 |
| 421 | 3300028558 | Ga0265326_10000097 | Ga0265326_1000009725 | 207 |
| 422 | 3300028654 | Ga0265322_10000009 | Ga0265322_1000000925 | 207 |
| 423 | 3300028666 | Ga0265336_10041617 | Ga0265336_100416171 | 207 |
| 424 | 3300029957 | Ga0265324_10001939 | Ga0265324_100019399 | 207 |
| 425 | 3300031238 | Ga0265332_10028383 | Ga0265332_100283833 | 207 |
| 426 | 3300031239 | Ga0265328_10005790 | Ga0265328_100057905 | 207 |
| 427 | 3300031240 | Ga0265320_10000024 | Ga0265320_10000024150 | 207 |
| 428 | 3300031242 | Ga0265329_10003134 | Ga0265329_100031344 | 207 |
| 429 | 3300031249 | Ga0265339_10035053 | Ga0265339_100350532 | 207 |
| 430 | 3300031250 | Ga0265331_10002941 | Ga0265331_100029414 | 207 |
| 431 | 3300031251 | Ga0265327_10000649 | Ga0265327_1000064925 | 207 |
| 432 | 3300031344 | Ga0265316_10085226 | Ga0265316_100852263 | 207 |
| 433 | 3300031711 | Ga0265314_10000898 | Ga0265314_1000089825 | 207 |
| 434 | 3300032133 | Ga0316583_10074831 | Ga0316583_100748312 | 207 |
| 435 | 3300036401 | Ga0373937_0004301 | Ga0373937_0004301_1520_2149 | 207 |
| 436 | 3300041512 | Ga0451853_3770927 | Ga0451853_3770927_2163_2789 | 207 |
| 437 | 3300046454 | Ga0495592_0000428 | Ga0495592_0000428_20329_20955 | 207 |
| 438 | 3300046455 | Ga0495603_0000074 | Ga0495603_0000074_10200_10826 | 207 |
| 439 | 3300046459 | Ga0495629_0051865 | Ga0495629_0051865_1409_2038 | 207 |
| 440 | 3300046461 | Ga0495641_0000020 | Ga0495641_0000020_48711_49355 | 207 |
| 441 | 3300046515 | Ga0495620_0004503 | Ga0495620_0004503_1940_2569 | 207 |
| 442 | 3300046516 | Ga0495628_0009068 | Ga0495628_0009068_3355_3981 | 207 |
| 443 | 3300046529 | Ga0495652_0012182 | Ga0495652_0012182_2556_3182 | 207 |
| 444 | 3300046536 | Ga0495587_0100392 | Ga0495587_0100392_117_746 | 207 |
| 445 | 3300046559 | Ga0495667_0000022 | Ga0495667_0000022_59452_60078 | 207 |
| 446 | 3300046683 | Ga0495658_0155097 | Ga0495658_0155097_224_850 | 207 |
| 447 | 3300046689 | Ga0495613_0000068 | Ga0495613_0000068_31220_31849 | 207 |
| 448 | 3300046690 | Ga0495624_0000012 | Ga0495624_0000012_50631_51263 | 207 |
| 449 | 3300046694 | Ga0495649_0000694 | Ga0495649_0000694_10834_11460 | 207 |
| 450 | 3300046809 | Ga0495600_0483663 | Ga0495600_0483663_68_694 | 207 |
| 451 | 3300047317 | Ga0495604_0014408 | Ga0495604_0014408_5595_6224 | 207 |
| 452 | 3300047321 | Ga0495676_0015881 | Ga0495676_0015881_5385_6011 | 207 |
| 453 | 3300047322 | Ga0495680_0002682 | Ga0495680_0002682_12585_13211 | 207 |
| 454 | 3300047322 | Ga0495680_0034352 | Ga0495680_0034352_1408_2034 | 207 |
| 455 | 3300047445 | Ga0495677_0095128 | Ga0495677_0095128_272_940 | 207 |
| 456 | 3300047446 | Ga0495679_014650 | Ga0495679_014650_1642_2268 | 207 |
| 457 | 3300047471 | Ga0495684_0470642 | Ga0495684_0470642_213_839 | 207 |
| 458 | 3300047673 | Ga0495593_0028970 | Ga0495593_0028970_1137_1763 | 207 |
| 459 | 3300048088 | Ga0495602_0000009 | Ga0495602_0000009_68076_68705 | 207 |
| 460 | 3300048088 | Ga0495602_0266153 | Ga0495602_0266153_224_850 | 207 |
| 461 | 3300048907 | Ga0496104_0000002 | Ga0496104_0000002_468303_468926 | 207 |
| 462 | 3300048907 | Ga0496104_0000168 | Ga0496104_0000168_49201_49827 | 207 |
| 463 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_859253_859876 | 207 |
| 464 | 3300048908 | Ga0496105_0001486 | Ga0496105_0001486_5759_6385 | 207 |
| 465 | 3300048911 | Ga0496108_0000001 | Ga0496108_0000001_167356_167982 | 207 |
| 466 | 3300048912 | Ga0496109_0000006 | Ga0496109_0000006_167356_167982 | 207 |
| 467 | 3300048913 | Ga0496110_0053791 | Ga0496110_0053791_748_1374 | 207 |
| 468 | 3300048914 | Ga0496111_0132257 | Ga0496111_0132257_570_1196 | 207 |
| 469 | 3300048917 | Ga0496114_0009454 | Ga0496114_0009454_4813_5439 | 207 |
| 470 | 3300048918 | Ga0496115_0212773 | Ga0496115_0212773_336_962 | 207 |
| 471 | 3300048922 | Ga0496119_0011863 | Ga0496119_0011863_4471_5094 | 207 |
| 472 | 3300048923 | Ga0496120_0037331 | Ga0496120_0037331_1963_2586 | 207 |
| 473 | 3300053077 | Ga0495601_0000031 | Ga0495601_0000031_96225_96854 | 207 |
| 474 | 3300053077 | Ga0495601_0002152 | Ga0495601_0002152_3649_4275 | 207 |
| 475 | 3300053078 | Ga0495612_0065595 | Ga0495612_0065595_389_1015 | 207 |
| 476 | 3300053084 | Ga0495595_0032542 | Ga0495595_0032542_1624_2253 | 207 |
| 477 | 3300053123 | Ga0500614_000672 | Ga0500614_000672_5726_6370 | 207 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zr0-assembly1.cif.gz_A | full length scs7p (only hydroxylase domain visible) | 0.779 | 15 | 203 |
| 4zr0-assembly1.cif.gz_A | full length scs7p (only hydroxylase domain visible) | 0.717 | 15 | 203 |
| 4xci-assembly1.cif.gz_A | crystal structure of a hexadecameric tf55 complex from s. solfataricus, crystal form ii | 0.3519 | 34 | 187 |
| 4xci-assembly1.cif.gz_A | crystal structure of a hexadecameric tf55 complex from s. solfataricus, crystal form ii | 0.2813 | 34 | 187 |
| 8glv-assembly1.cif.gz_Fm | 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella | 0.2497 | 30 | 199 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZR6_145_349_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.4437 | 41 | 201 | 1.10.3720.10 |
| af_Q2G1R0_3_202_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.429 | 30 | 197 | 1.20.1250.20 |
| af_P75799_92_298_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.3884 | 41 | 200 | 1.10.3720.10 |
| af_Q2FZR7_83_297_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.3871 | 57 | 197 | 1.10.3720.10 |
| af_A0A1D6K3V9_101_228_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3822 | 37 | 156 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2B7ZRW0-F1-model_v4 | Fatty acid hydroxylase | 0.8382 | 12 | 165 |
GO:0005506
GO:0006633 GO:0016020 GO:0080132 |
| AF-A0A4V3DZ63-F1-model_v4 | deleted | 0.8356 | 12 | 203 |
|
| AF-A0A4R2WH45-F1-model_v4 | deleted | 0.835 | 12 | 207 |
|
| AF-A0A3D1DB57-F1-model_v4 | deleted | 0.8331 | 12 | 165 |
|
| AF-A0A7K3WSZ7-F1-model_v4 | Fatty acid hydroxylase | 0.8323 | 12 | 207 |
GO:0005506
GO:0006633 GO:0016020 GO:0080132 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar