F451665

General Info

Members Datasets Scaffolds Average Seq Length
477 250 954 287

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1011664|Ga0081540_10116644
Length 330
Sequence VARFASALIAPDAVTVQAGWKTWSLSCRISFVGFAKTNLDGWETIMPERDGYIPGVPCWVDTNQPDPELALSFYGGLFGWEFADAMPPGSPEKYFIGRIRGGDVAAVGSIPAGAPPTATWNIYIWVESADETVVRARAVGGGVAMAPFDVADTGRMALLTDPEGAAFCVWQANKHKGAKVVNEHGSLNFNTLATQDPQAAEAFYGAVFGWQTLTIPAGVMWILPGYGDHLEEKTPGLRQQIAQMGAPEGFIDVVAALAPIADGANTPAHWSVTFAVDDATATAAKARKLGGEIVTGPIDVPWARLAVINDPQGATFIASQFVPENKKLTA

Samples

Sample ID Description Type Environment
1 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
157 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
158 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
159 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
160 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
175 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
197 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
234 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
245 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.89
Nodule 0
Rhizoplane 10.69
Rhizosphere 86.16
Stem 0
Stem Tuber 0
Unclassified 8.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081540_1011664 3300005983 Bacteria 5858
2 JGI24737J22298_10065681 3300001990 Bacteria 1087
3 JGI25407J50210_10000220 3300003373 Bacteria 9844
4 JGI25407J50210_10001637 3300003373 Bacteria 5125
5 JGI25407J50210_10006939 3300003373 Bacteria 2832
6 JGI25407J50210_10030487 3300003373 Bacteria 1398
7 Ga0070683_100030847 3300005329 Bacteria 4870
8 Ga0068869_100044217 3300005334 Bacteria 3202
9 Ga0070682_100018738 3300005337 Bacteria 4051
10 Ga0068868_100030695 3300005338 Bacteria 4121
11 Ga0070660_100044573 3300005339 Bacteria 3393
12 Ga0070689_100002821 3300005340 Bacteria 11424
13 Ga0070689_100025534 3300005340 Bacteria 4440
14 Ga0070691_10047955 3300005341 Bacteria 2032
15 Ga0070691_10110143 3300005341 Unclassified 1376
16 Ga0070691_10127858 3300005341 Unclassified 1285
17 Ga0070687_100039887 3300005343 Bacteria 2362
18 Ga0070687_100119616 3300005343 Bacteria 1504
19 Ga0070661_100183063 3300005344 Bacteria 1595
20 Ga0070692_10012456 3300005345 Bacteria 3938
21 Ga0070668_100059752 3300005347 Bacteria 2951
22 Ga0070668_100149593 3300005347 Bacteria 1887
23 Ga0070669_100236320 3300005353 Bacteria 1450
24 Ga0070675_100231733 3300005354 Bacteria 1611
25 Ga0070674_100040204 3300005356 Bacteria 3162
26 Ga0070688_100000327 3300005365 Bacteria 24351
27 Ga0070688_100006438 3300005365 Bacteria 6277
28 Ga0070688_100255448 3300005365 Bacteria 1249
29 Ga0070659_100010395 3300005366 Bacteria 6844
30 Ga0070659_100031729 3300005366 Bacteria 4093
31 Ga0070667_100152393 3300005367 Bacteria 2031
32 Ga0070709_10136315 3300005434 Bacteria 1681
33 Ga0070714_100169796 3300005435 Bacteria 1979
34 Ga0070713_100029720 3300005436 Bacteria 4330
35 Ga0070705_100435741 3300005440 Unclassified 980
36 Ga0070700_100007244 3300005441 Bacteria 5979
37 Ga0070700_100087734 3300005441 Bacteria 2023
38 Ga0070694_100334999 3300005444 Bacteria 1168
39 Ga0070708_100229598 3300005445 Bacteria 1741
40 Ga0070663_100000923 3300005455 Bacteria 15942
41 Ga0070663_100306904 3300005455 Bacteria 1272
42 Ga0070678_100041702 3300005456 Bacteria 3256
43 Ga0070678_100085556 3300005456 Bacteria 2403
44 Ga0070678_100136014 3300005456 Unclassified 1960
45 Ga0070678_100148803 3300005456 Bacteria 1884
46 Ga0070662_100062019 3300005457 Bacteria 2731
47 Ga0070681_10053754 3300005458 Bacteria 4013
48 Ga0068867_100049900 3300005459 Bacteria 3082
49 Ga0068867_100093002 3300005459 Bacteria 2291
50 Ga0070685_10034270 3300005466 Unclassified 2859
51 Ga0070685_10042434 3300005466 Bacteria 2596
52 Ga0070685_10162662 3300005466 Bacteria 1424
53 Ga0070706_100015361 3300005467 Bacteria 7070
54 Ga0070707_100190132 3300005468 Bacteria 2001
55 Ga0070698_100264890 3300005471 Bacteria 1650
56 Ga0070679_100270045 3300005530 Unclassified 1655
57 Ga0070684_100196644 3300005535 Bacteria 1836
58 Ga0068853_100317278 3300005539 Bacteria 1444
59 Ga0070672_100072016 3300005543 Bacteria 2751
60 Ga0070686_100032899 3300005544 Bacteria 3182
61 Ga0070686_100083847 3300005544 Bacteria 2116
62 Ga0070686_100246112 3300005544 Unclassified 1304
63 Ga0070665_100119824 3300005548 Bacteria 2633
64 Ga0070704_100038724 3300005549 Bacteria 3268
65 Ga0070704_100079619 3300005549 Bacteria 2407
66 Ga0070704_100299871 3300005549 Bacteria 1338
67 Ga0070664_100036670 3300005564 Bacteria 4119
68 Ga0068857_100133694 3300005577 Bacteria 2239
69 Ga0068854_100096277 3300005578 Bacteria 2211
70 Ga0068854_100113223 3300005578 Bacteria 2049
71 Ga0068854_100131239 3300005578 Bacteria 1913
72 Ga0068856_100011534 3300005614 Bacteria 8572
73 Ga0068856_100081253 3300005614 Bacteria 3215
74 Ga0070702_100017834 3300005615 Bacteria 3670
75 Ga0070702_100030222 3300005615 Bacteria 2952
76 Ga0068852_100174521 3300005616 Bacteria 2017
77 Ga0068852_100648898 3300005616 Bacteria 1063
78 Ga0068864_100012483 3300005618 Bacteria 7024
79 Ga0068863_100046887 3300005841 Unclassified 4102
80 Ga0068858_100365617 3300005842 Bacteria 1383
81 Ga0068860_100087951 3300005843 Bacteria 2957
82 Ga0068860_100119414 3300005843 Bacteria 2524
83 Ga0068862_100050950 3300005844 Bacteria 3540
84 Ga0068862_100084765 3300005844 Bacteria 2753
85 Ga0068862_100412594 3300005844 Bacteria 1265
86 Ga0081455_10009289 3300005937 Bacteria 10125
87 Ga0081455_10018335 3300005937 Bacteria 6671
88 Ga0081455_10037373 3300005937 Bacteria 4314
89 Ga0081455_10041039 3300005937 Bacteria 4075
90 Ga0081538_10000201 3300005981 Bacteria 66216
91 Ga0081538_10000274 3300005981 Bacteria 58781
92 Ga0081538_10001033 3300005981 Bacteria 29696
93 Ga0081538_10001230 3300005981 Bacteria 26863
94 Ga0081538_10001585 3300005981 Bacteria 23330
95 Ga0081538_10002970 3300005981 Bacteria 16188
96 Ga0081538_10003343 3300005981 Bacteria 15188
97 Ga0081538_10004222 3300005981 Bacteria 13338
98 Ga0081538_10007717 3300005981 Bacteria 9270
99 Ga0081538_10013475 3300005981 Bacteria 6466
100 Ga0081538_10039569 3300005981 Bacteria 3023
101 Ga0081538_10068184 3300005981 Bacteria 1980
102 Ga0081538_10092519 3300005981 Bacteria 1557
103 Ga0081540_1060902 3300005983 Bacteria 1802
104 Ga0070717_10017941 3300006028 Bacteria 5519
105 Ga0070717_10035503 3300006028 Bacteria 4036
106 Ga0075365_10017211 3300006038 Bacteria 4417
107 Ga0075365_10023823 3300006038 Bacteria 3854
108 Ga0075363_100024273 3300006048 Bacteria 3080
109 Ga0075364_10019849 3300006051 Bacteria 4224
110 Ga0070712_100042047 3300006175 Bacteria 3141
111 Ga0070712_100137979 3300006175 Bacteria 1857
112 Ga0075367_10176179 3300006178 Bacteria 1333
113 Ga0097621_100111231 3300006237 Bacteria 2315
114 Ga0068871_100290309 3300006358 Bacteria 1433
115 Ga0068871_100396951 3300006358 Unclassified 1228
116 Ga0075428_100006074 3300006844 Bacteria 13426
117 Ga0075428_100014826 3300006844 Bacteria 8662
118 Ga0075428_100019912 3300006844 Bacteria 7430
119 Ga0075428_100044653 3300006844 Bacteria 4868
120 Ga0075428_100056313 3300006844 Bacteria 4307
121 Ga0075428_100351198 3300006844 Unclassified 1583
122 Ga0075430_100002932 3300006846 Bacteria 14265
123 Ga0075430_100069869 3300006846 Bacteria 2945
124 Ga0075430_100086577 3300006846 Bacteria 2622
125 Ga0075430_100148948 3300006846 Bacteria 1949
126 Ga0075430_100212433 3300006846 Bacteria 1605
127 Ga0075431_100009773 3300006847 Bacteria 9633
128 Ga0075431_100062403 3300006847 Bacteria 3845
129 Ga0075431_100435030 3300006847 Bacteria 1309
130 Ga0075433_10106382 3300006852 Bacteria 2486
131 Ga0075434_100442552 3300006871 Bacteria 1321
132 Ga0075434_100648557 3300006871 Bacteria 1074
133 Ga0075429_100007361 3300006880 Bacteria 9556
134 Ga0075429_100126307 3300006880 Bacteria 2237
135 Ga0068865_100012395 3300006881 Bacteria 5366
136 Ga0068865_100094627 3300006881 Bacteria 2175
137 Ga0075435_100067911 3300007076 Unclassified 2903
138 Ga0111539_10005282 3300009094 Bacteria 16724
139 Ga0111539_10110817 3300009094 Bacteria 3221
140 Ga0111539_10228441 3300009094 Bacteria 2167
141 Ga0105245_10011109 3300009098 Bacteria 7839
142 Ga0105245_10162125 3300009098 Bacteria 2123
143 Ga0105245_10313484 3300009098 Bacteria 1543
144 Ga0114129_10008620 3300009147 Bacteria 14538
145 Ga0114129_10014683 3300009147 Bacteria 11160
146 Ga0114129_10077729 3300009147 Bacteria 4616
147 Ga0114129_10723498 3300009147 Unclassified 1277
148 Ga0105243_10029987 3300009148 Bacteria 4186
149 Ga0105243_10209281 3300009148 Bacteria 1716
150 Ga0105243_10288282 3300009148 Bacteria 1482
151 Ga0105243_10816399 3300009148 Unclassified 921
152 Ga0105241_10216511 3300009174 Unclassified 1607
153 Ga0105242_10005228 3300009176 Bacteria 10023
154 Ga0105242_10646868 3300009176 Bacteria 1028
155 Ga0105248_10129134 3300009177 Bacteria 2851
156 Ga0105249_10089128 3300009553 Bacteria 2882
157 Ga0105249_10117475 3300009553 Bacteria 2523
158 Ga0105249_10154707 3300009553 Bacteria 2210
159 Ga0105249_10236501 3300009553 Bacteria 1804
160 Ga0105239_10237790 3300010375 Bacteria 2044
161 Ga0105246_10093936 3300011119 Bacteria 2168
162 Ga0157374_10011816 3300013296 Bacteria 7573
163 Ga0157374_10239330 3300013296 Unclassified 1785
164 Ga0157374_10372069 3300013296 Bacteria 1422
165 Ga0157378_10013121 3300013297 Bacteria 7250
166 Ga0157372_10016067 3300013307 Bacteria 8031
167 Ga0157372_10485476 3300013307 Bacteria 1440
168 Ga0157375_10027953 3300013308 Bacteria 5279
169 Ga0157375_10054272 3300013308 Bacteria 3947
170 Ga0157375_10225517 3300013308 Bacteria 2033
171 Ga0157375_11077250 3300013308 Bacteria 940
172 Ga0163163_10079061 3300014325 Unclassified 3287
173 Ga0163163_10152174 3300014325 Bacteria 2357
174 Ga0157380_10057098 3300014326 Bacteria 3107
175 Ga0157380_10130061 3300014326 Bacteria 2146
176 Ga0157377_10031006 3300014745 Bacteria 2902
177 Ga0157377_10062313 3300014745 Bacteria 2134
178 Ga0157379_10070950 3300014968 Bacteria 3117
179 Ga0157379_10208677 3300014968 Bacteria 1768
180 Ga0157376_10371647 3300014969 Bacteria 1374
181 Ga0157376_10636361 3300014969 Bacteria 1065
182 Ga0213874_10006280 3300021377 Bacteria 2810
183 Ga0213876_10010842 3300021384 Bacteria 4882
184 Ga0213875_10045983 3300021388 Bacteria 2048
185 Ga0207697_10082869 3300025315 Bacteria 1353
186 Ga0207688_10002908 3300025901 Bacteria 9310
187 Ga0207688_10025603 3300025901 Bacteria 3241
188 Ga0207688_10080694 3300025901 Bacteria 1857
189 Ga0207685_10057464 3300025905 Bacteria 1526
190 Ga0207645_10275489 3300025907 Bacteria 1116
191 Ga0207707_10264028 3300025912 Bacteria 1493
192 Ga0207693_10069350 3300025915 Bacteria 2759
193 Ga0207693_10074266 3300025915 Bacteria 2663
194 Ga0207693_10170950 3300025915 Bacteria 1711
195 Ga0207663_10080567 3300025916 Bacteria 2129
196 Ga0207662_10001629 3300025918 Bacteria 10981
197 Ga0207662_10028928 3300025918 Bacteria 3208
198 Ga0207657_10034071 3300025919 Bacteria 4583
199 Ga0207646_10281293 3300025922 Bacteria 1503
200 Ga0207659_10009580 3300025926 Bacteria 6058
201 Ga0207687_10090763 3300025927 Bacteria 2227
202 Ga0207687_10295968 3300025927 Bacteria 1302
203 Ga0207664_10082337 3300025929 Bacteria 2621
204 Ga0207690_10202279 3300025932 Bacteria 1509
205 Ga0207690_10267278 3300025932 Unclassified 1327
206 Ga0207706_10082770 3300025933 Bacteria 2821
207 Ga0207686_10046379 3300025934 Bacteria 2680
208 Ga0207670_10000134 3300025936 Bacteria 48888
209 Ga0207670_10179553 3300025936 Bacteria 1593
210 Ga0207670_10202691 3300025936 Unclassified 1508
211 Ga0207670_10495652 3300025936 Bacteria 991
212 Ga0207704_10023470 3300025938 Bacteria 3325
213 Ga0207704_10084694 3300025938 Bacteria 2061
214 Ga0207691_10049431 3300025940 Bacteria 3853
215 Ga0207689_10027646 3300025942 Bacteria 4747
216 Ga0207679_10019425 3300025945 Bacteria 4564
217 Ga0207712_10308787 3300025961 Bacteria 1301
218 Ga0207668_10100403 3300025972 Bacteria 2149
219 Ga0207668_10219742 3300025972 Unclassified 1525
220 Ga0207640_10134194 3300025981 Bacteria 1794
221 Ga0207677_10145565 3300026023 Bacteria 1820
222 Ga0207677_10346802 3300026023 Bacteria 1243
223 Ga0207703_10421057 3300026035 Bacteria 1243
224 Ga0207708_10000282 3300026075 Bacteria 39901
225 Ga0207708_10031589 3300026075 Bacteria 4020
226 Ga0207708_10057103 3300026075 Bacteria 2978
227 Ga0207702_10039521 3300026078 Bacteria 3953
228 Ga0207702_10119166 3300026078 Bacteria 2359
229 Ga0207641_10375631 3300026088 Unclassified 1360
230 Ga0207648_10064705 3300026089 Bacteria 3187
231 Ga0207648_10083024 3300026089 Bacteria 2794
232 Ga0207676_10333590 3300026095 Unclassified 1397
233 Ga0207674_10090998 3300026116 Bacteria 3042
234 Ga0207675_100117071 3300026118 Bacteria 2519
235 Ga0207675_100117806 3300026118 Bacteria 2511
236 Ga0207675_100163702 3300026118 Bacteria 2123
237 Ga0207683_10112041 3300026121 Bacteria 2444
238 Ga0207683_10131503 3300026121 Bacteria 2251
239 Ga0207683_10432663 3300026121 Unclassified 1212
240 Ga0207698_10038461 3300026142 Bacteria 3535
241 Ga0207698_10187965 3300026142 Bacteria 1836
242 Ga0207698_10358228 3300026142 Bacteria 1381
243 Ga0207698_10468901 3300026142 Bacteria 1219
244 Ga0207428_10025229 3300027907 Bacteria 4976
245 Ga0268266_10082313 3300028379 Bacteria 2808
246 Ga0268265_10582942 3300028380 Bacteria 1066
247 Ga0268264_10088871 3300028381 Bacteria 2660
248 Ga0268264_10329035 3300028381 Bacteria 1447
249 Ga0307408_100198788 3300031548 Bacteria 1621
250 Ga0307413_10088023 3300031824 Bacteria 2014
251 Ga0307410_10292613 3300031852 Bacteria 1282
252 Ga0307406_10225898 3300031901 Bacteria 1395
253 Ga0307409_100053467 3300031995 Bacteria 3103
254 Ga0307416_100008053 3300032002 Bacteria 6756
255 Ga0307416_100047375 3300032002 Bacteria 3402
256 Ga0307416_100129527 3300032002 Bacteria 2268
257 Ga0307415_100036466 3300032126 Bacteria 3222
258 Ga0373936_0115470 3300035113 Bacteria 1143
259 Ga0373943_0005245 3300035170 Bacteria 5831
260 Ga0373946_0002307 3300035171 Bacteria 6749
261 Ga0373931_0296107 3300035691 Bacteria 998
262 Ga0373931_0634610 3300035691 Unclassified 701
263 Ga0373935_0101995 3300035692 Bacteria 1893
264 Ga0373947_0007185 3300035725 Bacteria 6453
265 Ga0373947_0081523 3300035725 Bacteria 2004
266 Ga0373937_0057775 3300036401 Bacteria 3564
267 Ga0373937_0150855 3300036401 Bacteria 2177
268 Ga0373925_0016761 3300037068 Bacteria 5306
269 Ga0395899_0157406 3300037312 Bacteria 1607
270 Ga0395900_0256764 3300037418 Bacteria 1747
271 Ga0395905_0572966 3300037471 Unclassified 1030
272 Ga0436364_0668940 3300037853 Bacteria 41832
273 Ga0395901_0014722 3300038443 Bacteria 7950
274 Ga0395901_0071187 3300038443 Bacteria 3624
275 Ga0395901_0217219 3300038443 Bacteria 1999
276 Ga0436365_0457869 3300039437 Bacteria 20822
277 Ga0436363_1261424 3300039450 Bacteria 6710
278 Ga0436362_0996789 3300039453 Bacteria 1756
279 Ga0439450_001453 3300042008 Bacteria 3475
280 Ga0439463_001298 3300042016 Bacteria 6641
281 Ga0439440_0000948 3300042993 Bacteria 5093
282 Ga0466965_0110585 3300044683 Bacteria 1411
283 Ga0466966_0029960 3300044684 Bacteria 3538
284 Ga0466961_0004584 3300044693 Bacteria 8678
285 Ga0466963_0012062 3300044694 Bacteria 5280
286 Ga0466963_0014117 3300044694 Bacteria 4920
287 Ga0466963_0056009 3300044694 Bacteria 2623
288 Ga0466968_0078196 3300044735 Bacteria 1449
289 Ga0466968_0083703 3300044735 Unclassified 1406
290 Ga0466970_0047805 3300044765 Bacteria 2281
291 Ga0466957_0025026 3300044842 Bacteria 3536
292 Ga0466958_0029714 3300045836 Bacteria 3243
293 Ga0466958_0055082 3300045836 Bacteria 2413
294 Ga0466958_0246489 3300045836 Bacteria 1142
295 Ga0495603_0109227 3300046455 Bacteria 1614
296 Ga0495629_0001040 3300046459 Bacteria 22219
297 Ga0495641_0015242 3300046461 Bacteria 4116
298 Ga0495651_0015601 3300046462 Bacteria 5879
299 Ga0495651_0088724 3300046462 Unclassified 2323
300 Ga0495653_0040787 3300046463 Bacteria 3626
301 Ga0495582_0000203 3300046473 Bacteria 32995
302 Ga0495582_0030070 3300046473 Bacteria 2981
303 Ga0495639_0005277 3300046475 Bacteria 5559
304 Ga0495662_0001946 3300046476 Bacteria 10370
305 Ga0495608_0024978 3300046511 Bacteria 4081
306 Ga0495608_0041770 3300046511 Bacteria 3068
307 Ga0495608_0126285 3300046511 Unclassified 1638
308 Ga0495618_0215958 3300046514 Bacteria 1211
309 Ga0495618_0251748 3300046514 Bacteria 1108
310 Ga0495630_0111868 3300046517 Bacteria 2068
311 Ga0495666_0010877 3300046526 Bacteria 4537
312 Ga0495652_0091696 3300046529 Bacteria 2483
313 Ga0495652_0113096 3300046529 Bacteria 2180
314 Ga0495665_0000530 3300046531 Bacteria 19297
315 Ga0495665_0068469 3300046531 Unclassified 1872
316 Ga0495640_0307251 3300046533 Unclassified 984
317 Ga0495586_0180781 3300046535 Bacteria 1193
318 Ga0495667_0022497 3300046559 Unclassified 4246
319 Ga0495667_0042301 3300046559 Unclassified 3021
320 Ga0495656_0032341 3300046615 Bacteria 2128
321 Ga0495634_0016678 3300046642 Bacteria 5248
322 Ga0495635_0015081 3300046663 Bacteria 5405
323 Ga0495635_0028044 3300046663 Bacteria 3914
324 Ga0495657_0126949 3300046675 Bacteria 1601
325 Ga0495657_0177948 3300046675 Bacteria 1307
326 Ga0495623_0031419 3300046679 Bacteria 3413
327 Ga0495658_0004068 3300046683 Bacteria 7203
328 Ga0495658_0048497 3300046683 Bacteria 2395
329 Ga0495613_0006189 3300046689 Bacteria 8954
330 Ga0495600_0025981 3300046809 Unclassified 3777
331 Ga0495600_0186761 3300046809 Bacteria 1334
332 Ga0495581_0011490 3300047315 Bacteria 5124
333 Ga0495604_0006632 3300047317 Bacteria 9177
334 Ga0495674_0011137 3300047319 Bacteria 8492
335 Ga0495674_0035989 3300047319 Bacteria 4461
336 Ga0495676_0019173 3300047321 Bacteria 6019
337 Ga0495680_0002021 3300047322 Bacteria 21279
338 Ga0495680_0009515 3300047322 Bacteria 8734
339 Ga0495680_0042643 3300047322 Unclassified 3599
340 Ga0495680_0071256 3300047322 Bacteria 2647
341 Ga0495680_0252046 3300047322 Bacteria 1251
342 Ga0495684_0002378 3300047471 Bacteria 15041
343 Ga0495684_0005701 3300047471 Bacteria 9684
344 Ga0495593_0037974 3300047673 Bacteria 2602
345 Ga0495614_0052032 3300048089 Bacteria 1755
346 Ga0496100_0016481 3300048903 Bacteria 4341
347 Ga0496100_0054683 3300048903 Bacteria 2605
348 Ga0496101_0006608 3300048904 Bacteria 7470
349 Ga0496101_0012407 3300048904 Bacteria 5686
350 Ga0496102_0023207 3300048905 Bacteria 5507
351 Ga0496102_0103292 3300048905 Bacteria 2650
352 Ga0496102_0120675 3300048905 Bacteria 2448
353 Ga0496102_0395663 3300048905 Bacteria 1299
354 Ga0496103_0039179 3300048906 Bacteria 2912
355 Ga0496103_0144262 3300048906 Bacteria 1524
356 Ga0496104_0012688 3300048907 Bacteria 7588
357 Ga0496104_0020003 3300048907 Bacteria 6130
358 Ga0496104_0101325 3300048907 Bacteria 2757
359 Ga0496104_0101564 3300048907 Bacteria 2754
360 Ga0496105_0006413 3300048908 Bacteria 9044
361 Ga0496105_0042559 3300048908 Bacteria 3744
362 Ga0496105_0154179 3300048908 Bacteria 1887
363 Ga0496106_0029161 3300048909 Bacteria 4111
364 Ga0496106_0048183 3300048909 Bacteria 3209
365 Ga0496106_0229351 3300048909 Bacteria 1482
366 Ga0496107_0019501 3300048910 Bacteria 4785
367 Ga0496107_0057070 3300048910 Bacteria 2822
368 Ga0496107_0068301 3300048910 Bacteria 2579
369 Ga0496107_0114929 3300048910 Bacteria 1980
370 Ga0496108_0022167 3300048911 Bacteria 5221
371 Ga0496108_0137633 3300048911 Bacteria 2102
372 Ga0496108_0157000 3300048911 Unclassified 1965
373 Ga0496108_0242391 3300048911 Bacteria 1568
374 Ga0496109_0018369 3300048912 Bacteria 6144
375 Ga0496109_0031813 3300048912 Bacteria 4738
376 Ga0496109_0047642 3300048912 Bacteria 3897
377 Ga0496109_0074756 3300048912 Bacteria 3115
378 Ga0496109_0280355 3300048912 Bacteria 1571
379 Ga0496110_0023942 3300048913 Bacteria 5199
380 Ga0496110_0024364 3300048913 Bacteria 5157
381 Ga0496110_0267617 3300048913 Bacteria 1556
382 Ga0496110_0685808 3300048913 Unclassified 925
383 Ga0496111_0024156 3300048914 Bacteria 4277
384 Ga0496111_0033065 3300048914 Bacteria 3689
385 Ga0496111_0084229 3300048914 Bacteria 2324
386 Ga0496111_0255153 3300048914 Unclassified 1301
387 Ga0496112_0349254 3300048915 Bacteria 1422
388 Ga0496114_0035863 3300048917 Bacteria 4097
389 Ga0496114_0041032 3300048917 Bacteria 3835
390 Ga0496114_0258286 3300048917 Bacteria 1533
391 Ga0496114_0303397 3300048917 Bacteria 1410
392 Ga0496114_0403898 3300048917 Bacteria 1210
393 Ga0496114_0522907 3300048917 Bacteria 1049
394 Ga0496115_0008791 3300048918 Bacteria 7483
395 Ga0496115_0015547 3300048918 Bacteria 5775
396 Ga0496115_0069646 3300048918 Bacteria 2850
397 Ga0501031_0029730 3300049568 Bacteria 3565
398 Ga0501031_0172062 3300049568 Bacteria 1415
399 Ga0501038_0046013 3300049574 Bacteria 3785
400 Ga0501038_0238168 3300049574 Bacteria 1446
401 Ga0501039_0113004 3300049575 Bacteria 2124
402 Ga0501039_0247549 3300049575 Bacteria 1402
403 Ga0501040_0015357 3300049576 Bacteria 5064
404 Ga0501040_0100541 3300049576 Bacteria 2016
405 Ga0501040_0333667 3300049576 Bacteria 1085
406 Ga0501042_0012520 3300049578 Bacteria 5749
407 Ga0501042_0059572 3300049578 Bacteria 2726
408 Ga0501042_0086588 3300049578 Bacteria 2247
409 Ga0501048_0094479 3300049582 Archaea 2109
410 Ga0501048_0109983 3300049582 Bacteria 1946
411 Ga0501067_0097530 3300049583 Bacteria 1632
412 Ga0501071_0008639 3300049587 Bacteria 6734
413 Ga0501071_0144452 3300049587 Bacteria 1773
414 Ga0501071_0336877 3300049587 Bacteria 1147
415 Ga0501072_0018900 3300049588 Bacteria 5317
416 Ga0501072_0540571 3300049588 Bacteria 921
417 Ga0501074_0171939 3300049590 Bacteria 1546
418 Ga0501074_0350551 3300049590 Bacteria 1048
419 Ga0501075_0029526 3300049591 Bacteria 4056
420 Ga0501075_0067569 3300049591 Bacteria 2699
421 Ga0501075_0180607 3300049591 Bacteria 1610
422 Ga0501076_0010553 3300049592 Bacteria 6858
423 Ga0501077_0013116 3300049593 Bacteria 5193
424 Ga0501077_0237434 3300049593 Bacteria 1159
425 Ga0501079_0037806 3300049741 Bacteria 3721
426 Ga0501079_0075796 3300049741 Bacteria 2601
427 Ga0501079_0246160 3300049741 Bacteria 1397
428 Ga0501081_0022388 3300049743 Bacteria 4228
429 Ga0501081_0144926 3300049743 Bacteria 1704
430 Ga0501081_0248103 3300049743 Bacteria 1299
431 Ga0501035_0185491 3300049822 Bacteria 1791
432 Ga0501045_0157852 3300049824 Bacteria 1688
433 Ga0501045_0372174 3300049824 Bacteria 1063
434 nmdc:mga03n38_12420_c1 3300050490 Bacteria 3204
435 nmdc:mga0yw44_21314_c1 3300050492 Bacteria 3613
436 nmdc:mga0yw44_76596_c1 3300050492 Bacteria 2088
437 nmdc:mga06z11_75131_c1 3300050494 Bacteria 1798
438 nmdc:mga05p37_4572_c1 3300050507 Bacteria 16178
439 nmdc:mga05p37_89478_c1 3300050507 Bacteria 3794
440 nmdc:mga09592_132593_c1 3300050508 Bacteria 2145
441 nmdc:mga09592_327366_c1 3300050508 Bacteria 1327
442 nmdc:mga09592_42413_c1 3300050508 Bacteria 3826
443 nmdc:mga09592_50154_c1 3300050508 Bacteria 3521
444 nmdc:mga09592_8557_c1 3300050508 Bacteria 8322
445 nmdc:mga0qj67_109230_c1 3300050509 Unclassified 2232
446 nmdc:mga0qj67_143788_c1 3300050509 Bacteria 1934
447 nmdc:mga0qj67_25730_c1 3300050509 Bacteria 4551
448 nmdc:mga0qj67_322753_c1 3300050509 Bacteria 1250
449 nmdc:mga0qj67_4858_c1 3300050509 Bacteria 9774
450 nmdc:mga06r32_111843_c1 3300050510 Bacteria 2688
451 nmdc:mga06r32_26276_c1 3300050510 Bacteria 5427
452 nmdc:mga06r32_67692_c1 3300050510 Bacteria 3448
453 nmdc:mga06r32_84374_c1 3300050510 Bacteria 3096
454 nmdc:mga08y16_120478_c1 3300050511 Bacteria 2730
455 nmdc:mga08y16_1814_c1 3300050511 Bacteria 21652
456 nmdc:mga08y16_36369_c1 3300050511 Bacteria 5171
457 nmdc:mga0n895_212932_c1 3300050512 Bacteria 1962
458 nmdc:mga0n895_479499_c1 3300050512 Bacteria 1254
459 nmdc:mga0rr50_145033_c1 3300050513 Bacteria 1913
460 nmdc:mga0rr50_62206_c1 3300050513 Unclassified 1375
461 nmdc:mga0a205_134599_c1 3300050515 Bacteria 2372
462 Ga0495655_0044743 3300053083 Bacteria 1147
463 Ga0495595_0001357 3300053084 Bacteria 9508
464 Ga0495595_0030731 3300053084 Bacteria 2410
465 Ga0495595_0062672 3300053084 Unclassified 1744
466 Ga0495619_0000841 3300053085 Bacteria 20167
467 Ga0495619_0004432 3300053085 Bacteria 8954
468 Ga0495619_0029856 3300053085 Bacteria 3525
469 Ga0495619_0087074 3300053085 Bacteria 2111
470 Ga0501084_0035258 3300054114 Bacteria 4183
471 Ga0501084_0185798 3300054114 Bacteria 1754
472 Ga0501082_0136907 3300060353 Bacteria 2125
473 Ga0466962_0009176 3300061719 Bacteria 4737
474 Ga0530510_0007173 3300061734 Bacteria 7757
475 Ga0530510_0021466 3300061734 Bacteria 4594
476 Ga0530510_0191554 3300061734 Bacteria 1518
477 Ga0530510_0480296 3300061734 Bacteria 941
478 Ga0081540_1011664
479 JGI24737J22298_10065681
480 JGI25407J50210_10000220
481 JGI25407J50210_10001637
482 JGI25407J50210_10006939
483 JGI25407J50210_10030487
484 Ga0070683_100030847
485 Ga0068869_100044217
486 Ga0070682_100018738
487 Ga0068868_100030695
488 Ga0070660_100044573
489 Ga0070689_100002821
490 Ga0070689_100025534
491 Ga0070691_10047955
492 Ga0070691_10110143
493 Ga0070691_10127858
494 Ga0070687_100039887
495 Ga0070687_100119616
496 Ga0070661_100183063
497 Ga0070692_10012456
498 Ga0070668_100059752
499 Ga0070668_100149593
500 Ga0070669_100236320
501 Ga0070675_100231733
502 Ga0070674_100040204
503 Ga0070688_100000327
504 Ga0070688_100006438
505 Ga0070688_100255448
506 Ga0070659_100010395
507 Ga0070659_100031729
508 Ga0070667_100152393
509 Ga0070709_10136315
510 Ga0070714_100169796
511 Ga0070713_100029720
512 Ga0070705_100435741
513 Ga0070700_100007244
514 Ga0070700_100087734
515 Ga0070694_100334999
516 Ga0070708_100229598
517 Ga0070663_100000923
518 Ga0070663_100306904
519 Ga0070678_100041702
520 Ga0070678_100085556
521 Ga0070678_100136014
522 Ga0070678_100148803
523 Ga0070662_100062019
524 Ga0070681_10053754
525 Ga0068867_100049900
526 Ga0068867_100093002
527 Ga0070685_10034270
528 Ga0070685_10042434
529 Ga0070685_10162662
530 Ga0070706_100015361
531 Ga0070707_100190132
532 Ga0070698_100264890
533 Ga0070679_100270045
534 Ga0070684_100196644
535 Ga0068853_100317278
536 Ga0070672_100072016
537 Ga0070686_100032899
538 Ga0070686_100083847
539 Ga0070686_100246112
540 Ga0070665_100119824
541 Ga0070704_100038724
542 Ga0070704_100079619
543 Ga0070704_100299871
544 Ga0070664_100036670
545 Ga0068857_100133694
546 Ga0068854_100096277
547 Ga0068854_100113223
548 Ga0068854_100131239
549 Ga0068856_100011534
550 Ga0068856_100081253
551 Ga0070702_100017834
552 Ga0070702_100030222
553 Ga0068852_100174521
554 Ga0068852_100648898
555 Ga0068864_100012483
556 Ga0068863_100046887
557 Ga0068858_100365617
558 Ga0068860_100087951
559 Ga0068860_100119414
560 Ga0068862_100050950
561 Ga0068862_100084765
562 Ga0068862_100412594
563 Ga0081455_10009289
564 Ga0081455_10018335
565 Ga0081455_10037373
566 Ga0081455_10041039
567 Ga0081538_10000201
568 Ga0081538_10000274
569 Ga0081538_10001033
570 Ga0081538_10001230
571 Ga0081538_10001585
572 Ga0081538_10002970
573 Ga0081538_10003343
574 Ga0081538_10004222
575 Ga0081538_10007717
576 Ga0081538_10013475
577 Ga0081538_10039569
578 Ga0081538_10068184
579 Ga0081538_10092519
580 Ga0081540_1060902
581 Ga0070717_10017941
582 Ga0070717_10035503
583 Ga0075365_10017211
584 Ga0075365_10023823
585 Ga0075363_100024273
586 Ga0075364_10019849
587 Ga0070712_100042047
588 Ga0070712_100137979
589 Ga0075367_10176179
590 Ga0097621_100111231
591 Ga0068871_100290309
592 Ga0068871_100396951
593 Ga0075428_100006074
594 Ga0075428_100014826
595 Ga0075428_100019912
596 Ga0075428_100044653
597 Ga0075428_100056313
598 Ga0075428_100351198
599 Ga0075430_100002932
600 Ga0075430_100069869
601 Ga0075430_100086577
602 Ga0075430_100148948
603 Ga0075430_100212433
604 Ga0075431_100009773
605 Ga0075431_100062403
606 Ga0075431_100435030
607 Ga0075433_10106382
608 Ga0075434_100442552
609 Ga0075434_100648557
610 Ga0075429_100007361
611 Ga0075429_100126307
612 Ga0068865_100012395
613 Ga0068865_100094627
614 Ga0075435_100067911
615 Ga0111539_10005282
616 Ga0111539_10110817
617 Ga0111539_10228441
618 Ga0105245_10011109
619 Ga0105245_10162125
620 Ga0105245_10313484
621 Ga0114129_10008620
622 Ga0114129_10014683
623 Ga0114129_10077729
624 Ga0114129_10723498
625 Ga0105243_10029987
626 Ga0105243_10209281
627 Ga0105243_10288282
628 Ga0105243_10816399
629 Ga0105241_10216511
630 Ga0105242_10005228
631 Ga0105242_10646868
632 Ga0105248_10129134
633 Ga0105249_10089128
634 Ga0105249_10117475
635 Ga0105249_10154707
636 Ga0105249_10236501
637 Ga0105239_10237790
638 Ga0105246_10093936
639 Ga0157374_10011816
640 Ga0157374_10239330
641 Ga0157374_10372069
642 Ga0157378_10013121
643 Ga0157372_10016067
644 Ga0157372_10485476
645 Ga0157375_10027953
646 Ga0157375_10054272
647 Ga0157375_10225517
648 Ga0157375_11077250
649 Ga0163163_10079061
650 Ga0163163_10152174
651 Ga0157380_10057098
652 Ga0157380_10130061
653 Ga0157377_10031006
654 Ga0157377_10062313
655 Ga0157379_10070950
656 Ga0157379_10208677
657 Ga0157376_10371647
658 Ga0157376_10636361
659 Ga0213874_10006280
660 Ga0213876_10010842
661 Ga0213875_10045983
662 Ga0207697_10082869
663 Ga0207688_10002908
664 Ga0207688_10025603
665 Ga0207688_10080694
666 Ga0207685_10057464
667 Ga0207645_10275489
668 Ga0207707_10264028
669 Ga0207693_10069350
670 Ga0207693_10074266
671 Ga0207693_10170950
672 Ga0207663_10080567
673 Ga0207662_10001629
674 Ga0207662_10028928
675 Ga0207657_10034071
676 Ga0207646_10281293
677 Ga0207659_10009580
678 Ga0207687_10090763
679 Ga0207687_10295968
680 Ga0207664_10082337
681 Ga0207690_10202279
682 Ga0207690_10267278
683 Ga0207706_10082770
684 Ga0207686_10046379
685 Ga0207670_10000134
686 Ga0207670_10179553
687 Ga0207670_10202691
688 Ga0207670_10495652
689 Ga0207704_10023470
690 Ga0207704_10084694
691 Ga0207691_10049431
692 Ga0207689_10027646
693 Ga0207679_10019425
694 Ga0207712_10308787
695 Ga0207668_10100403
696 Ga0207668_10219742
697 Ga0207640_10134194
698 Ga0207677_10145565
699 Ga0207677_10346802
700 Ga0207703_10421057
701 Ga0207708_10000282
702 Ga0207708_10031589
703 Ga0207708_10057103
704 Ga0207702_10039521
705 Ga0207702_10119166
706 Ga0207641_10375631
707 Ga0207648_10064705
708 Ga0207648_10083024
709 Ga0207676_10333590
710 Ga0207674_10090998
711 Ga0207675_100117071
712 Ga0207675_100117806
713 Ga0207675_100163702
714 Ga0207683_10112041
715 Ga0207683_10131503
716 Ga0207683_10432663
717 Ga0207698_10038461
718 Ga0207698_10187965
719 Ga0207698_10358228
720 Ga0207698_10468901
721 Ga0207428_10025229
722 Ga0268266_10082313
723 Ga0268265_10582942
724 Ga0268264_10088871
725 Ga0268264_10329035
726 Ga0307408_100198788
727 Ga0307413_10088023
728 Ga0307410_10292613
729 Ga0307406_10225898
730 Ga0307409_100053467
731 Ga0307416_100008053
732 Ga0307416_100047375
733 Ga0307416_100129527
734 Ga0307415_100036466
735 Ga0373936_0115470
736 Ga0373943_0005245
737 Ga0373946_0002307
738 Ga0373931_0296107
739 Ga0373931_0634610
740 Ga0373935_0101995
741 Ga0373947_0007185
742 Ga0373947_0081523
743 Ga0373937_0057775
744 Ga0373937_0150855
745 Ga0373925_0016761
746 Ga0395899_0157406
747 Ga0395900_0256764
748 Ga0395905_0572966
749 Ga0436364_0668940
750 Ga0395901_0014722
751 Ga0395901_0071187
752 Ga0395901_0217219
753 Ga0436365_0457869
754 Ga0436363_1261424
755 Ga0436362_0996789
756 Ga0439450_001453
757 Ga0439463_001298
758 Ga0439440_0000948
759 Ga0466965_0110585
760 Ga0466966_0029960
761 Ga0466961_0004584
762 Ga0466963_0012062
763 Ga0466963_0014117
764 Ga0466963_0056009
765 Ga0466968_0078196
766 Ga0466968_0083703
767 Ga0466970_0047805
768 Ga0466957_0025026
769 Ga0466958_0029714
770 Ga0466958_0055082
771 Ga0466958_0246489
772 Ga0495603_0109227
773 Ga0495629_0001040
774 Ga0495641_0015242
775 Ga0495651_0015601
776 Ga0495651_0088724
777 Ga0495653_0040787
778 Ga0495582_0000203
779 Ga0495582_0030070
780 Ga0495639_0005277
781 Ga0495662_0001946
782 Ga0495608_0024978
783 Ga0495608_0041770
784 Ga0495608_0126285
785 Ga0495618_0215958
786 Ga0495618_0251748
787 Ga0495630_0111868
788 Ga0495666_0010877
789 Ga0495652_0091696
790 Ga0495652_0113096
791 Ga0495665_0000530
792 Ga0495665_0068469
793 Ga0495640_0307251
794 Ga0495586_0180781
795 Ga0495667_0022497
796 Ga0495667_0042301
797 Ga0495656_0032341
798 Ga0495634_0016678
799 Ga0495635_0015081
800 Ga0495635_0028044
801 Ga0495657_0126949
802 Ga0495657_0177948
803 Ga0495623_0031419
804 Ga0495658_0004068
805 Ga0495658_0048497
806 Ga0495613_0006189
807 Ga0495600_0025981
808 Ga0495600_0186761
809 Ga0495581_0011490
810 Ga0495604_0006632
811 Ga0495674_0011137
812 Ga0495674_0035989
813 Ga0495676_0019173
814 Ga0495680_0002021
815 Ga0495680_0009515
816 Ga0495680_0042643
817 Ga0495680_0071256
818 Ga0495680_0252046
819 Ga0495684_0002378
820 Ga0495684_0005701
821 Ga0495593_0037974
822 Ga0495614_0052032
823 Ga0496100_0016481
824 Ga0496100_0054683
825 Ga0496101_0006608
826 Ga0496101_0012407
827 Ga0496102_0023207
828 Ga0496102_0103292
829 Ga0496102_0120675
830 Ga0496102_0395663
831 Ga0496103_0039179
832 Ga0496103_0144262
833 Ga0496104_0012688
834 Ga0496104_0020003
835 Ga0496104_0101325
836 Ga0496104_0101564
837 Ga0496105_0006413
838 Ga0496105_0042559
839 Ga0496105_0154179
840 Ga0496106_0029161
841 Ga0496106_0048183
842 Ga0496106_0229351
843 Ga0496107_0019501
844 Ga0496107_0057070
845 Ga0496107_0068301
846 Ga0496107_0114929
847 Ga0496108_0022167
848 Ga0496108_0137633
849 Ga0496108_0157000
850 Ga0496108_0242391
851 Ga0496109_0018369
852 Ga0496109_0031813
853 Ga0496109_0047642
854 Ga0496109_0074756
855 Ga0496109_0280355
856 Ga0496110_0023942
857 Ga0496110_0024364
858 Ga0496110_0267617
859 Ga0496110_0685808
860 Ga0496111_0024156
861 Ga0496111_0033065
862 Ga0496111_0084229
863 Ga0496111_0255153
864 Ga0496112_0349254
865 Ga0496114_0035863
866 Ga0496114_0041032
867 Ga0496114_0258286
868 Ga0496114_0303397
869 Ga0496114_0403898
870 Ga0496114_0522907
871 Ga0496115_0008791
872 Ga0496115_0015547
873 Ga0496115_0069646
874 Ga0501031_0029730
875 Ga0501031_0172062
876 Ga0501038_0046013
877 Ga0501038_0238168
878 Ga0501039_0113004
879 Ga0501039_0247549
880 Ga0501040_0015357
881 Ga0501040_0100541
882 Ga0501040_0333667
883 Ga0501042_0012520
884 Ga0501042_0059572
885 Ga0501042_0086588
886 Ga0501048_0094479
887 Ga0501048_0109983
888 Ga0501067_0097530
889 Ga0501071_0008639
890 Ga0501071_0144452
891 Ga0501071_0336877
892 Ga0501072_0018900
893 Ga0501072_0540571
894 Ga0501074_0171939
895 Ga0501074_0350551
896 Ga0501075_0029526
897 Ga0501075_0067569
898 Ga0501075_0180607
899 Ga0501076_0010553
900 Ga0501077_0013116
901 Ga0501077_0237434
902 Ga0501079_0037806
903 Ga0501079_0075796
904 Ga0501079_0246160
905 Ga0501081_0022388
906 Ga0501081_0144926
907 Ga0501081_0248103
908 Ga0501035_0185491
909 Ga0501045_0157852
910 Ga0501045_0372174
911 nmdc:mga03n38_12420_c1
912 nmdc:mga0yw44_21314_c1
913 nmdc:mga0yw44_76596_c1
914 nmdc:mga06z11_75131_c1
915 nmdc:mga05p37_4572_c1
916 nmdc:mga05p37_89478_c1
917 nmdc:mga09592_132593_c1
918 nmdc:mga09592_327366_c1
919 nmdc:mga09592_42413_c1
920 nmdc:mga09592_50154_c1
921 nmdc:mga09592_8557_c1
922 nmdc:mga0qj67_109230_c1
923 nmdc:mga0qj67_143788_c1
924 nmdc:mga0qj67_25730_c1
925 nmdc:mga0qj67_322753_c1
926 nmdc:mga0qj67_4858_c1
927 nmdc:mga06r32_111843_c1
928 nmdc:mga06r32_26276_c1
929 nmdc:mga06r32_67692_c1
930 nmdc:mga06r32_84374_c1
931 nmdc:mga08y16_120478_c1
932 nmdc:mga08y16_1814_c1
933 nmdc:mga08y16_36369_c1
934 nmdc:mga0n895_212932_c1
935 nmdc:mga0n895_479499_c1
936 nmdc:mga0rr50_145033_c1
937 nmdc:mga0rr50_62206_c1
938 nmdc:mga0a205_134599_c1
939 Ga0495655_0044743
940 Ga0495595_0001357
941 Ga0495595_0030731
942 Ga0495595_0062672
943 Ga0495619_0000841
944 Ga0495619_0004432
945 Ga0495619_0029856
946 Ga0495619_0087074
947 Ga0501084_0035258
948 Ga0501084_0185798
949 Ga0501082_0136907
950 Ga0466962_0009176
951 Ga0530510_0007173
952 Ga0530510_0021466
953 Ga0530510_0191554
954 Ga0530510_0480296

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

186

317

0.94

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

59

169

0.87

PF18029

Glyoxalase_6

Glyoxalase-like domain

59

170

0.78

PF18029

Glyoxalase_6

Glyoxalase-like domain

190

318

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.9556 1 279
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.9221 1 279
2r6u-assembly2.cif.gz_D crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.7411 5 128
7a76-assembly1.cif.gz_C bacillithiol disulfide reductase bdr (ypda) from bacillus cereus 0.7203 96 126
2r6u-assembly2.cif.gz_B crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.72 1 128
ID Description Score Start End Superfamily
3oxhA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.963 1 135 3.10.180.10
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9492 8 129 3.10.180.10
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9341 8 129 3.10.180.10
3oxhA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9322 8 128 3.10.180.10
3oxhA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9088 8 128 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A3D3QBZ6-F1-model_v4 Glyoxalase 0.9737 9 169
AF-A0A0H5RX42-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9667 3 279 GO:0051213
AF-A0A7J9ZBF9-F1-model_v4 VOC family protein 0.9657 1 276
AF-A0A3M1XX97-F1-model_v4 VOC family protein 0.956 1 278
AF-A0A6J4HAC9-F1-model_v4 VOC domain-containing protein 0.9538 3 279

Map