F451656

General Info

Members Datasets Scaffolds Average Seq Length
477 245 954 250

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100053534|Ga0070696_1000535341
Length 303
Sequence MPTAIVAEDEPILRAQLEGKLKKLWPELEIIASVEDGAAALEALEDRAPDFMFLDIQMPEMTGVEVARHVAGRSHVVFVTAYDQYAIQAFETGAVDYILKPATDDRLALTIERLKAKLATPPSDLNAVLARLTEQLSGKREKLQWIKATLGQNLRLIPVGDVLFFQSDEKYTRVVTAETEALIKTPIRELLDGLDPEVFWQIHRSTVVNVNAIAAVTRDFRGQAHVKIKGKDESLVVSRIYSHLFKHMYSSDSAPAKNKENDDEKSFALCRGLHAGPCRSGARTRCGGSREGRRRESHLPGLV

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
164 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
173 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
174 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
194 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
234 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
242 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.89
Nodule 0
Rhizoplane 3.35
Rhizosphere 93.5
Stem 0
Stem Tuber 0
Unclassified 1.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_100053534 3300005546 Bacteria 2810
2 rootH1_10193257 3300003323 Bacteria 1506
3 Ga0065712_10106034 3300005290 Bacteria 1926
4 Ga0070658_10010975 3300005327 Bacteria 7260
5 Ga0070658_10039796 3300005327 Bacteria 3793
6 Ga0070658_10106844 3300005327 Bacteria 2316
7 Ga0070676_10012868 3300005328 Bacteria 4580
8 Ga0070683_100018718 3300005329 Bacteria 6138
9 Ga0070683_100098695 3300005329 Bacteria 2749
10 Ga0070683_100105383 3300005329 Bacteria 2658
11 Ga0070690_100038457 3300005330 Bacteria 3020
12 Ga0070690_100083429 3300005330 Bacteria 2093
13 Ga0070670_100001714 3300005331 Bacteria 17851
14 Ga0070670_100040195 3300005331 Bacteria 4022
15 Ga0070670_100450673 3300005331 Bacteria 1140
16 Ga0068869_100002410 3300005334 Bacteria 11271
17 Ga0070666_10062749 3300005335 Bacteria 2518
18 Ga0070666_10121280 3300005335 Bacteria 1813
19 Ga0070680_100020141 3300005336 Bacteria 5292
20 Ga0068868_100020392 3300005338 Bacteria 4980
21 Ga0068868_100040228 3300005338 Bacteria 3638
22 Ga0070660_100029353 3300005339 Bacteria 4121
23 Ga0070660_100169857 3300005339 Bacteria 1761
24 Ga0070660_100231570 3300005339 Bacteria 1503
25 Ga0070689_100009203 3300005340 Bacteria 6992
26 Ga0070689_100055186 3300005340 Bacteria 3078
27 Ga0070687_100079427 3300005343 Bacteria 1786
28 Ga0070687_100165309 3300005343 Bacteria 1312
29 Ga0070687_100206781 3300005343 Bacteria 1193
30 Ga0070661_100017587 3300005344 Bacteria 5074
31 Ga0070692_10085304 3300005345 Bacteria 1708
32 Ga0070668_100066672 3300005347 Bacteria 2794
33 Ga0070669_100008330 3300005353 Bacteria 7401
34 Ga0070669_100077221 3300005353 Bacteria 2473
35 Ga0070675_100010095 3300005354 Bacteria 7362
36 Ga0070671_100128533 3300005355 Bacteria 2133
37 Ga0070674_100028982 3300005356 Bacteria 3640
38 Ga0070674_100040984 3300005356 Bacteria 3135
39 Ga0070673_100179017 3300005364 Bacteria 1814
40 Ga0070673_100231466 3300005364 Bacteria 1603
41 Ga0070659_100012726 3300005366 Bacteria 6244
42 Ga0070659_100013884 3300005366 Bacteria 6009
43 Ga0070659_100027976 3300005366 Bacteria 4349
44 Ga0070667_100016584 3300005367 Bacteria 6097
45 Ga0070667_100600706 3300005367 Bacteria 1014
46 Ga0070709_10075075 3300005434 Bacteria 2192
47 Ga0070709_10115152 3300005434 Bacteria 1813
48 Ga0070714_100054170 3300005435 Bacteria 3426
49 Ga0070713_100000032 3300005436 Bacteria 86800
50 Ga0070713_100003237 3300005436 Bacteria 10732
51 Ga0070713_100718105 3300005436 Bacteria 955
52 Ga0070701_10008380 3300005438 Bacteria 4469
53 Ga0070700_100259198 3300005441 Bacteria 1251
54 Ga0070708_100108918 3300005445 Bacteria 2545
55 Ga0070678_100005436 3300005456 Bacteria 7363
56 Ga0070678_100063381 3300005456 Bacteria 2735
57 Ga0070678_100224537 3300005456 Bacteria 1563
58 Ga0070662_100020759 3300005457 Bacteria 4479
59 Ga0070681_10004639 3300005458 Bacteria 13124
60 Ga0070681_10015984 3300005458 Bacteria 7483
61 Ga0070681_10287094 3300005458 Bacteria 1556
62 Ga0068867_100011308 3300005459 Bacteria 6297
63 Ga0068867_100013565 3300005459 Bacteria 5771
64 Ga0068867_100089832 3300005459 Bacteria 2330
65 Ga0068867_100272056 3300005459 Bacteria 1385
66 Ga0070707_100273540 3300005468 Bacteria 1642
67 Ga0070698_100148468 3300005471 Bacteria 2293
68 Ga0070699_100068813 3300005518 Bacteria 3076
69 Ga0070679_100043595 3300005530 Bacteria 4468
70 Ga0070679_100101744 3300005530 Bacteria 2860
71 Ga0070679_100172291 3300005530 Bacteria 2137
72 Ga0070684_100117045 3300005535 Bacteria 2394
73 Ga0070684_100119008 3300005535 Bacteria 2375
74 Ga0070684_100127484 3300005535 Bacteria 2293
75 Ga0070684_100478418 3300005535 Bacteria 1152
76 Ga0068853_100068795 3300005539 Bacteria 3079
77 Ga0068853_100122722 3300005539 Bacteria 2319
78 Ga0068853_100188171 3300005539 Bacteria 1874
79 Ga0070672_100002225 3300005543 Bacteria 12212
80 Ga0070672_100041473 3300005543 Bacteria 3538
81 Ga0070672_100051139 3300005543 Bacteria 3221
82 Ga0070672_100451349 3300005543 Bacteria 1107
83 Ga0070695_100039313 3300005545 Bacteria 2990
84 Ga0070696_100097252 3300005546 Bacteria 2105
85 Ga0070696_100201804 3300005546 Bacteria 1485
86 Ga0070693_100017279 3300005547 Bacteria 3747
87 Ga0070693_100023532 3300005547 Bacteria 3293
88 Ga0070693_100292055 3300005547 Bacteria 1096
89 Ga0070665_100002516 3300005548 Bacteria 20147
90 Ga0070704_100153162 3300005549 Bacteria 1815
91 Ga0068855_100001914 3300005563 Bacteria 25824
92 Ga0068855_100010163 3300005563 Bacteria 11343
93 Ga0068855_100034103 3300005563 Bacteria 6073
94 Ga0068855_100061531 3300005563 Bacteria 4386
95 Ga0068855_100176328 3300005563 Bacteria 2419
96 Ga0068855_100498802 3300005563 Bacteria 1323
97 Ga0070664_100040393 3300005564 Bacteria 3933
98 Ga0070664_100066513 3300005564 Bacteria 3078
99 Ga0070664_100105519 3300005564 Bacteria 2454
100 Ga0068857_100078583 3300005577 Bacteria 2945
101 Ga0068857_100182914 3300005577 Bacteria 1907
102 Ga0068854_100009632 3300005578 Bacteria 6238
103 Ga0068854_100046042 3300005578 Bacteria 3104
104 Ga0068856_100004198 3300005614 Bacteria 14389
105 Ga0068856_100018538 3300005614 Bacteria 6745
106 Ga0068856_100076158 3300005614 Bacteria 3324
107 Ga0068856_100183764 3300005614 Bacteria 2104
108 Ga0068856_100185896 3300005614 Bacteria 2092
109 Ga0068856_100402050 3300005614 Bacteria 1389
110 Ga0070702_100061146 3300005615 Bacteria 2192
111 Ga0068852_100002082 3300005616 Bacteria 13667
112 Ga0068852_100009767 3300005616 Bacteria 7134
113 Ga0068852_100215846 3300005616 Bacteria 1822
114 Ga0068852_100403120 3300005616 Bacteria 1346
115 Ga0068859_100011258 3300005617 Bacteria 9002
116 Ga0068859_100090088 3300005617 Bacteria 3118
117 Ga0068859_100190029 3300005617 Bacteria 2138
118 Ga0068859_100822582 3300005617 Bacteria 1016
119 Ga0068864_100001495 3300005618 Bacteria 19268
120 Ga0068864_100071095 3300005618 Bacteria 3029
121 Ga0068866_10211983 3300005718 Bacteria 1164
122 Ga0068861_100003094 3300005719 Bacteria 10994
123 Ga0068861_100009573 3300005719 Bacteria 6693
124 Ga0068861_100498863 3300005719 Bacteria 1100
125 Ga0068851_10000604 3300005834 Bacteria 15460
126 Ga0068851_10011617 3300005834 Bacteria 4132
127 Ga0068851_10105106 3300005834 Bacteria 1502
128 Ga0068851_10234615 3300005834 Bacteria 1035
129 Ga0068863_100013357 3300005841 Bacteria 7917
130 Ga0068863_100024637 3300005841 Bacteria 5738
131 Ga0068863_100105669 3300005841 Bacteria 2678
132 Ga0068863_100186622 3300005841 Bacteria 1992
133 Ga0068858_100001738 3300005842 Bacteria 22236
134 Ga0068858_100003164 3300005842 Bacteria 16479
135 Ga0068858_100036647 3300005842 Bacteria 4547
136 Ga0068860_100023312 3300005843 Bacteria 5982
137 Ga0068860_100073012 3300005843 Bacteria 3261
138 Ga0068860_100328701 3300005843 Bacteria 1501
139 Ga0068862_100117329 3300005844 Bacteria 2342
140 Ga0070717_10147227 3300006028 Bacteria 2035
141 Ga0075364_10202717 3300006051 Bacteria 1345
142 Ga0075369_10053155 3300006186 Bacteria 1757
143 Ga0075366_10021375 3300006195 Bacteria 3761
144 Ga0075366_10292647 3300006195 Bacteria 996
145 Ga0097621_100001530 3300006237 Bacteria 15845
146 Ga0097621_100013041 3300006237 Bacteria 6179
147 Ga0097621_100025208 3300006237 Bacteria 4650
148 Ga0097621_100159896 3300006237 Bacteria 1936
149 Ga0097621_100491452 3300006237 Bacteria 1111
150 Ga0068871_100010929 3300006358 Bacteria 6649
151 Ga0068871_100011498 3300006358 Bacteria 6492
152 Ga0068871_100031006 3300006358 Bacteria 4213
153 Ga0068871_100051816 3300006358 Bacteria 3323
154 Ga0068871_100298024 3300006358 Bacteria 1414
155 Ga0075428_100057727 3300006844 Bacteria 4249
156 Ga0075428_100104803 3300006844 Bacteria 3084
157 Ga0075433_10115589 3300006852 Bacteria 2380
158 Ga0075433_10118479 3300006852 Bacteria 2350
159 Ga0075434_100014488 3300006871 Bacteria 7537
160 Ga0075429_100555440 3300006880 Bacteria 1006
161 Ga0068865_100162104 3300006881 Bacteria 1707
162 Ga0068865_100196193 3300006881 Bacteria 1564
163 Ga0068865_100252785 3300006881 Bacteria 1392
164 Ga0068865_100402843 3300006881 Bacteria 1121
165 Ga0075436_100004037 3300006914 Bacteria 10064
166 Ga0075436_100006955 3300006914 Bacteria 7741
167 Ga0097620_100011258 3300006931 Bacteria 9002
168 Ga0097620_100090089 3300006931 Bacteria 3118
169 Ga0097620_100190037 3300006931 Bacteria 2138
170 Ga0097620_100822579 3300006931 Bacteria 1016
171 Ga0075435_100020189 3300007076 Bacteria 5100
172 Ga0105240_10089290 3300009093 Bacteria 3770
173 Ga0105240_10183058 3300009093 Bacteria 2471
174 Ga0105240_10343936 3300009093 Bacteria 1694
175 Ga0111539_10001276 3300009094 Bacteria 33625
176 Ga0111539_10003234 3300009094 Bacteria 21537
177 Ga0111539_10015658 3300009094 Bacteria 9426
178 Ga0105245_10011997 3300009098 Bacteria 7534
179 Ga0105245_10409326 3300009098 Bacteria 1357
180 Ga0105245_10588039 3300009098 Bacteria 1138
181 Ga0105245_10590155 3300009098 Bacteria 1136
182 Ga0105243_10324003 3300009148 Bacteria 1405
183 Ga0105241_10006603 3300009174 Bacteria 8547
184 Ga0105241_10157880 3300009174 Bacteria 1862
185 Ga0105241_10290526 3300009174 Bacteria 1399
186 Ga0105241_10529218 3300009174 Bacteria 1055
187 Ga0105242_10000115 3300009176 Bacteria 57986
188 Ga0105242_10110095 3300009176 Bacteria 2346
189 Ga0105248_10036295 3300009177 Bacteria 5513
190 Ga0105248_10077973 3300009177 Bacteria 3726
191 Ga0105248_10377685 3300009177 Bacteria 1595
192 Ga0105248_10632603 3300009177 Bacteria 1207
193 Ga0105237_10010879 3300009545 Bacteria 9654
194 Ga0105237_10584223 3300009545 Bacteria 1124
195 Ga0105238_10060376 3300009551 Bacteria 3796
196 Ga0105238_10062629 3300009551 Bacteria 3720
197 Ga0105238_10106886 3300009551 Bacteria 2780
198 Ga0105238_10149461 3300009551 Bacteria 2311
199 Ga0105249_10410520 3300009553 Bacteria 1386
200 Ga0105239_10063535 3300010375 Bacteria 4053
201 Ga0157373_10127220 3300013100 Bacteria 1792
202 Ga0157371_10033221 3300013102 Bacteria 3708
203 Ga0157370_10013141 3300013104 Bacteria 8540
204 Ga0157370_10168596 3300013104 Bacteria 2036
205 Ga0157370_10480907 3300013104 Bacteria 1141
206 Ga0157370_10627870 3300013104 Bacteria 983
207 Ga0157369_10002024 3300013105 Bacteria 24454
208 Ga0157369_10041430 3300013105 Bacteria 5027
209 Ga0157374_10019483 3300013296 Bacteria 6005
210 Ga0157374_10119178 3300013296 Bacteria 2546
211 Ga0157374_10377663 3300013296 Bacteria 1411
212 Ga0157378_10697981 3300013297 Bacteria 1034
213 Ga0163162_10045820 3300013306 Bacteria 4382
214 Ga0163162_10071799 3300013306 Bacteria 3515
215 Ga0163162_10335933 3300013306 Bacteria 1643
216 Ga0157372_10001158 3300013307 Bacteria 28514
217 Ga0157372_10054405 3300013307 Bacteria 4464
218 Ga0157372_10203249 3300013307 Bacteria 2295
219 Ga0157372_10215029 3300013307 Bacteria 2228
220 Ga0157372_10588498 3300013307 Bacteria 1297
221 Ga0157375_10070115 3300013308 Bacteria 3514
222 Ga0157375_10664548 3300013308 Bacteria 1197
223 Ga0157375_10863665 3300013308 Bacteria 1051
224 Ga0163163_10005934 3300014325 Bacteria 10630
225 Ga0163163_10899077 3300014325 Bacteria 949
226 Ga0157380_10011793 3300014326 Bacteria 6322
227 Ga0157380_10153942 3300014326 Bacteria 1991
228 Ga0157377_10080505 3300014745 Bacteria 1903
229 Ga0157379_10005563 3300014968 Bacteria 10827
230 Ga0157379_10005798 3300014968 Bacteria 10628
231 Ga0157379_10053375 3300014968 Bacteria 3610
232 Ga0157379_10178550 3300014968 Bacteria 1918
233 Ga0157376_10008025 3300014969 Bacteria 7581
234 Ga0157376_10940430 3300014969 Eukaryota 884
235 Ga0182007_10069034 3300015262 Bacteria 1158
236 Ga0163161_10007253 3300017792 Bacteria 7658
237 Ga0163161_10030693 3300017792 Bacteria 3827
238 Ga0163161_10199257 3300017792 Bacteria 1542
239 Ga0163161_10215893 3300017792 Bacteria 1483
240 Ga0163161_10323523 3300017792 Bacteria 1220
241 Ga0213876_10063179 3300021384 Bacteria 1955
242 Ga0213876_10219032 3300021384 Bacteria 1012
243 Ga0209051_1003524 3300025303 Bacteria 10218
244 Ga0207697_10018824 3300025315 Bacteria 2830
245 Ga0207656_10021274 3300025321 Bacteria 2590
246 Ga0207656_10078224 3300025321 Bacteria 1482
247 Ga0207688_10012507 3300025901 Bacteria 4619
248 Ga0207680_10109403 3300025903 Bacteria 1789
249 Ga0207680_10179284 3300025903 Bacteria 1431
250 Ga0207647_10180017 3300025904 Bacteria 1228
251 Ga0207645_10007822 3300025907 Bacteria 7517
252 Ga0207645_10120245 3300025907 Bacteria 1705
253 Ga0207705_10092809 3300025909 Bacteria 2212
254 Ga0207654_10056994 3300025911 Bacteria 2269
255 Ga0207654_10074668 3300025911 Bacteria 2024
256 Ga0207707_10075618 3300025912 Bacteria 2939
257 Ga0207707_10186038 3300025912 Bacteria 1813
258 Ga0207695_10064012 3300025913 Bacteria 3789
259 Ga0207671_10026658 3300025914 Bacteria 4327
260 Ga0207671_10563912 3300025914 Bacteria 908
261 Ga0207663_10025207 3300025916 Bacteria 3434
262 Ga0207663_10068844 3300025916 Bacteria 2275
263 Ga0207660_10071180 3300025917 Bacteria 2529
264 Ga0207662_10271817 3300025918 Bacteria 1119
265 Ga0207657_10239490 3300025919 Bacteria 1449
266 Ga0207649_10293838 3300025920 Bacteria 1186
267 Ga0207649_10678141 3300025920 Bacteria 798
268 Ga0207652_10032986 3300025921 Bacteria 4359
269 Ga0207652_10154350 3300025921 Bacteria 2056
270 Ga0207652_10201124 3300025921 Bacteria 1793
271 Ga0207652_10412131 3300025921 Bacteria 1219
272 Ga0207681_10025210 3300025923 Bacteria 3822
273 Ga0207694_10027738 3300025924 Bacteria 4313
274 Ga0207694_10088214 3300025924 Bacteria 2445
275 Ga0207694_10099825 3300025924 Bacteria 2299
276 Ga0207694_10100209 3300025924 Bacteria 2295
277 Ga0207694_10115839 3300025924 Bacteria 2135
278 Ga0207694_10192045 3300025924 Bacteria 1659
279 Ga0207694_10632088 3300025924 Bacteria 901
280 Ga0207650_10001539 3300025925 Bacteria 16529
281 Ga0207650_10282340 3300025925 Bacteria 1352
282 Ga0207687_10246270 3300025927 Bacteria 1419
283 Ga0207700_10000148 3300025928 Bacteria 41738
284 Ga0207700_10037227 3300025928 Bacteria 3522
285 Ga0207700_10459737 3300025928 Bacteria 1123
286 Ga0207664_10272453 3300025929 Bacteria 1483
287 Ga0207690_10042462 3300025932 Bacteria 2987
288 Ga0207690_10119752 3300025932 Bacteria 1910
289 Ga0207690_10344431 3300025932 Bacteria 1177
290 Ga0207706_10009396 3300025933 Bacteria 8975
291 Ga0207686_10020675 3300025934 Bacteria 3764
292 Ga0207686_10174471 3300025934 Bacteria 1519
293 Ga0207709_10594953 3300025935 Bacteria 875
294 Ga0207670_10024310 3300025936 Bacteria 3785
295 Ga0207670_10038689 3300025936 Bacteria 3117
296 Ga0207670_10429109 3300025936 Bacteria 1062
297 Ga0207669_10270827 3300025937 Bacteria 1275
298 Ga0207704_10030323 3300025938 Bacteria 3031
299 Ga0207691_10010737 3300025940 Bacteria 8792
300 Ga0207691_10011884 3300025940 Bacteria 8355
301 Ga0207691_10024290 3300025940 Bacteria 5700
302 Ga0207691_10037113 3300025940 Bacteria 4513
303 Ga0207691_10099372 3300025940 Bacteria 2598
304 Ga0207691_10208013 3300025940 Bacteria 1701
305 Ga0207711_10017488 3300025941 Bacteria 5956
306 Ga0207711_10216548 3300025941 Bacteria 1750
307 Ga0207711_10290404 3300025941 Bacteria 1507
308 Ga0207711_10322954 3300025941 Bacteria 1427
309 Ga0207711_10431187 3300025941 Bacteria 1227
310 Ga0207689_10000591 3300025942 Bacteria 34621
311 Ga0207689_10001685 3300025942 Bacteria 20991
312 Ga0207689_10044586 3300025942 Bacteria 3667
313 Ga0207661_10254408 3300025944 Bacteria 1562
314 Ga0207679_10015386 3300025945 Bacteria 5054
315 Ga0207679_10041656 3300025945 Bacteria 3295
316 Ga0207679_10195024 3300025945 Bacteria 1687
317 Ga0207679_10514005 3300025945 Bacteria 1070
318 Ga0207667_10084275 3300025949 Bacteria 3291
319 Ga0207667_10091226 3300025949 Bacteria 3148
320 Ga0207667_10363209 3300025949 Bacteria 1476
321 Ga0207667_10410836 3300025949 Bacteria 1378
322 Ga0207667_10651297 3300025949 Bacteria 1059
323 Ga0207651_10033413 3300025960 Bacteria 3318
324 Ga0207712_10450864 3300025961 Bacteria 1091
325 Ga0207668_10200340 3300025972 Bacteria 1589
326 Ga0207640_10321161 3300025981 Bacteria 1233
327 Ga0207640_10474537 3300025981 Bacteria 1036
328 Ga0207640_10526640 3300025981 Bacteria 989
329 Ga0207658_10023948 3300025986 Bacteria 4266
330 Ga0207658_10074510 3300025986 Bacteria 2579
331 Ga0207658_10169628 3300025986 Bacteria 1797
332 Ga0207677_10042641 3300026023 Bacteria 3010
333 Ga0207677_10101227 3300026023 Bacteria 2121
334 Ga0207677_10591122 3300026023 Bacteria 973
335 Ga0207703_10001729 3300026035 Bacteria 19633
336 Ga0207703_10005461 3300026035 Bacteria 10223
337 Ga0207703_10013156 3300026035 Bacteria 6448
338 Ga0207639_10140791 3300026041 Bacteria 2009
339 Ga0207708_10159644 3300026075 Bacteria 1780
340 Ga0207702_10035167 3300026078 Bacteria 4189
341 Ga0207702_10125420 3300026078 Bacteria 2304
342 Ga0207702_10314376 3300026078 Bacteria 1490
343 Ga0207702_10539508 3300026078 Bacteria 1140
344 Ga0207641_10008653 3300026088 Bacteria 8404
345 Ga0207641_10126507 3300026088 Bacteria 2288
346 Ga0207641_10199688 3300026088 Bacteria 1843
347 Ga0207641_10284506 3300026088 Bacteria 1556
348 Ga0207648_10031249 3300026089 Bacteria 4708
349 Ga0207676_10006970 3300026095 Bacteria 8010
350 Ga0207676_10027487 3300026095 Unclassified 4237
351 Ga0207676_10208027 3300026095 Bacteria 1734
352 Ga0207674_10019948 3300026116 Bacteria 7254
353 Ga0207674_10036178 3300026116 Bacteria 5148
354 Ga0207674_10234555 3300026116 Bacteria 1782
355 Ga0207674_10436221 3300026116 Bacteria 1266
356 Ga0207674_10438130 3300026116 Bacteria 1263
357 Ga0207675_100007108 3300026118 Bacteria 10579
358 Ga0207675_100076948 3300026118 Bacteria 3125
359 Ga0207683_10002223 3300026121 Bacteria 17073
360 Ga0207683_10031577 3300026121 Bacteria 4597
361 Ga0207683_10128881 3300026121 Bacteria 2275
362 Ga0207683_10807519 3300026121 Bacteria 871
363 Ga0207698_10000553 3300026142 Bacteria 21782
364 Ga0207698_10017736 3300026142 Bacteria 4838
365 Ga0207698_10266049 3300026142 Bacteria 1578
366 Ga0207428_10010983 3300027907 Bacteria 8053
367 Ga0207428_10082813 3300027907 Bacteria 2503
368 Ga0207428_10301816 3300027907 Bacteria 1185
369 Ga0268266_10015321 3300028379 Bacteria 6579
370 Ga0268265_10084637 3300028380 Bacteria 2514
371 Ga0268264_10001258 3300028381 Bacteria 24122
372 Ga0268264_10055009 3300028381 Bacteria 3325
373 Ga0268264_10300893 3300028381 Bacteria 1510
374 Ga0265334_10036864 3300028573 Bacteria 1930
375 Ga0307517_10092408 3300028786 Bacteria 2462
376 Ga0265338_10268646 3300028800 Bacteria 1251
377 Ga0265324_10037914 3300029957 Bacteria 1674
378 Ga0265331_10103639 3300031250 Bacteria 1308
379 Ga0307408_100249933 3300031548 Bacteria 1462
380 Ga0307413_10277256 3300031824 Bacteria 1259
381 Ga0307416_100797996 3300032002 Bacteria 1040
382 Ga0307415_100390498 3300032126 Bacteria 1185
383 Ga0373930_0019218 3300034816 Bacteria 1321
384 Ga0373958_0013507 3300034819 Bacteria 1416
385 Ga0373957_0116625 3300035120 Unclassified 1078
386 Ga0373943_0215518 3300035170 Bacteria 1068
387 Ga0373955_0066564 3300035172 Bacteria 2003
388 Ga0373924_0015969 3300035410 Bacteria 2861
389 Ga0373924_0041386 3300035410 Bacteria 1888
390 Ga0373931_0022489 3300035691 Bacteria 3174
391 Ga0373931_0259708 3300035691 Bacteria 1059
392 Ga0373927_0148248 3300035695 Bacteria 1536
393 Ga0373933_0063828 3300035724 Bacteria 2227
394 Ga0373937_0137485 3300036401 Bacteria 2285
395 Ga0373937_0141199 3300036401 Bacteria 2253
396 Ga0373925_0034078 3300037068 Bacteria 3753
397 Ga0395900_0073598 3300037418 Bacteria 3513
398 Ga0436365_0132097 3300039437 Bacteria 3553
399 Ga0436365_1061862 3300039437 Bacteria 4081
400 Ga0451577_0192950 3300042876 Bacteria 1838
401 Ga0466966_0090704 3300044684 Bacteria 1898
402 Ga0466963_0245111 3300044694 Bacteria 1257
403 Ga0453684_0063516 3300044712 Bacteria 4723
404 Ga0453684_0887272 3300044712 Bacteria 956
405 Ga0453684_1055934 3300044712 Bacteria 861
406 Ga0451576_0113985 3300045051 Bacteria 2814
407 Ga0466958_0079863 3300045836 Bacteria 2012
408 Ga0495603_0276796 3300046455 Bacteria 965
409 Ga0495651_0030162 3300046462 Bacteria 4229
410 Ga0495651_0320541 3300046462 Unclassified 1033
411 Ga0495650_0007643 3300046471 Bacteria 6449
412 Ga0495608_0042802 3300046511 Bacteria 3028
413 Ga0495628_0265279 3300046516 Bacteria 1279
414 Ga0495642_0104649 3300046528 Bacteria 1207
415 Ga0495652_0077896 3300046529 Bacteria 2746
416 Ga0495621_0048276 3300046539 Bacteria 1515
417 Ga0495621_0095705 3300046539 Bacteria 1125
418 Ga0495645_0001593 3300046543 Bacteria 15344
419 Ga0495667_0108623 3300046559 Bacteria 1792
420 Ga0495625_0013100 3300046660 Bacteria 6680
421 Ga0495657_0117273 3300046675 Bacteria 1680
422 Ga0495657_0180654 3300046675 Unclassified 1295
423 Ga0495599_0106919 3300046678 Bacteria 1743
424 Ga0495600_0368845 3300046809 Bacteria 897
425 Ga0495604_0040879 3300047317 Bacteria 3639
426 Ga0495680_0145452 3300047322 Bacteria 1732
427 Ga0495675_0060715 3300047444 Bacteria 2396
428 Ga0495684_0225757 3300047471 Bacteria 1371
429 Ga0495602_0083939 3300048088 Bacteria 2666
430 Ga0495615_0004946 3300048090 Bacteria 2364
431 Ga0496101_0020702 3300048904 Bacteria 4510
432 Ga0496102_0479223 3300048905 Bacteria 1165
433 Ga0496102_0835689 3300048905 Bacteria 843
434 Ga0496104_0022955 3300048907 Bacteria 5734
435 Ga0496105_0307577 3300048908 Unclassified 1273
436 Ga0496106_0004306 3300048909 Bacteria 10570
437 Ga0496107_0010565 3300048910 Bacteria 6418
438 Ga0496109_0004487 3300048912 Bacteria 11665
439 Ga0496110_0028516 3300048913 Bacteria 4796
440 Ga0496111_0034719 3300048914 Bacteria 3602
441 Ga0496111_0414235 3300048914 Bacteria 995
442 Ga0496112_0500618 3300048915 Bacteria 1150
443 Ga0496113_0438580 3300048916 Bacteria 1049
444 Ga0496113_0678123 3300048916 Bacteria 823
445 Ga0496114_0129229 3300048917 Bacteria 2180
446 Ga0496115_0003898 3300048918 Bacteria 10750
447 Ga0501046_0233456 3300049580 Bacteria 1358
448 Ga0501047_0001870 3300049581 Bacteria 20262
449 Ga0501069_0003981 3300049585 Bacteria 7624
450 Ga0501070_0002611 3300049586 Bacteria 15741
451 Ga0501073_0000259 3300049589 Bacteria 34932
452 Ga0501079_0017360 3300049741 Bacteria 5496
453 Ga0501080_0136207 3300049742 Bacteria 2273
454 Ga0501080_0244118 3300049742 Bacteria 1638
455 Ga0501083_0009157 3300049744 Bacteria 6994
456 nmdc:mga00v17_246697_c1 3300050491 Bacteria 1158
457 nmdc:mga0k408_129969_c1 3300050493 Bacteria 1495
458 nmdc:mga0k408_6263_c1 3300050493 Bacteria 6347
459 nmdc:mga06z11_53971_c1 3300050494 Bacteria 2069
460 nmdc:mga09592_492937_c1 3300050508 Bacteria 1055
461 nmdc:mga08y16_306314_c1 3300050511 Bacteria 1637
462 nmdc:mga08y16_47975_c1 3300050511 Bacteria 4470
463 nmdc:mga08y16_656_c1 3300050511 Bacteria 32525
464 nmdc:mga0n895_406999_c1 3300050512 Unclassified 1376
465 nmdc:mga0n895_703233_c1 3300050512 Bacteria 1007
466 nmdc:mga0rr50_15436_c1 3300050513 Bacteria 5043
467 nmdc:mga0rr50_22972_c1 3300050513 Bacteria 4290
468 nmdc:mga08x19_117481_c1 3300050514 Bacteria 1779
469 nmdc:mga08x19_25057_c1 3300050514 Bacteria 3714
470 nmdc:mga08x19_34029_c1 3300050514 Bacteria 3219
471 nmdc:mga0a205_130432_c2 3300050515 Bacteria 2096
472 nmdc:mga0a205_1459_c1 3300050515 Bacteria 20172
473 Ga0495601_0004082 3300053077 Bacteria 8421
474 Ga0495595_0094249 3300053084 Bacteria 1439
475 Ga0495619_0065135 3300053085 Bacteria 2431
476 Ga0501084_0241619 3300054114 Bacteria 1524
477 Ga0501082_0159315 3300060353 Bacteria 1961
478 Ga0070696_100053534
479 rootH1_10193257
480 Ga0065712_10106034
481 Ga0070658_10010975
482 Ga0070658_10039796
483 Ga0070658_10106844
484 Ga0070676_10012868
485 Ga0070683_100018718
486 Ga0070683_100098695
487 Ga0070683_100105383
488 Ga0070690_100038457
489 Ga0070690_100083429
490 Ga0070670_100001714
491 Ga0070670_100040195
492 Ga0070670_100450673
493 Ga0068869_100002410
494 Ga0070666_10062749
495 Ga0070666_10121280
496 Ga0070680_100020141
497 Ga0068868_100020392
498 Ga0068868_100040228
499 Ga0070660_100029353
500 Ga0070660_100169857
501 Ga0070660_100231570
502 Ga0070689_100009203
503 Ga0070689_100055186
504 Ga0070687_100079427
505 Ga0070687_100165309
506 Ga0070687_100206781
507 Ga0070661_100017587
508 Ga0070692_10085304
509 Ga0070668_100066672
510 Ga0070669_100008330
511 Ga0070669_100077221
512 Ga0070675_100010095
513 Ga0070671_100128533
514 Ga0070674_100028982
515 Ga0070674_100040984
516 Ga0070673_100179017
517 Ga0070673_100231466
518 Ga0070659_100012726
519 Ga0070659_100013884
520 Ga0070659_100027976
521 Ga0070667_100016584
522 Ga0070667_100600706
523 Ga0070709_10075075
524 Ga0070709_10115152
525 Ga0070714_100054170
526 Ga0070713_100000032
527 Ga0070713_100003237
528 Ga0070713_100718105
529 Ga0070701_10008380
530 Ga0070700_100259198
531 Ga0070708_100108918
532 Ga0070678_100005436
533 Ga0070678_100063381
534 Ga0070678_100224537
535 Ga0070662_100020759
536 Ga0070681_10004639
537 Ga0070681_10015984
538 Ga0070681_10287094
539 Ga0068867_100011308
540 Ga0068867_100013565
541 Ga0068867_100089832
542 Ga0068867_100272056
543 Ga0070707_100273540
544 Ga0070698_100148468
545 Ga0070699_100068813
546 Ga0070679_100043595
547 Ga0070679_100101744
548 Ga0070679_100172291
549 Ga0070684_100117045
550 Ga0070684_100119008
551 Ga0070684_100127484
552 Ga0070684_100478418
553 Ga0068853_100068795
554 Ga0068853_100122722
555 Ga0068853_100188171
556 Ga0070672_100002225
557 Ga0070672_100041473
558 Ga0070672_100051139
559 Ga0070672_100451349
560 Ga0070695_100039313
561 Ga0070696_100097252
562 Ga0070696_100201804
563 Ga0070693_100017279
564 Ga0070693_100023532
565 Ga0070693_100292055
566 Ga0070665_100002516
567 Ga0070704_100153162
568 Ga0068855_100001914
569 Ga0068855_100010163
570 Ga0068855_100034103
571 Ga0068855_100061531
572 Ga0068855_100176328
573 Ga0068855_100498802
574 Ga0070664_100040393
575 Ga0070664_100066513
576 Ga0070664_100105519
577 Ga0068857_100078583
578 Ga0068857_100182914
579 Ga0068854_100009632
580 Ga0068854_100046042
581 Ga0068856_100004198
582 Ga0068856_100018538
583 Ga0068856_100076158
584 Ga0068856_100183764
585 Ga0068856_100185896
586 Ga0068856_100402050
587 Ga0070702_100061146
588 Ga0068852_100002082
589 Ga0068852_100009767
590 Ga0068852_100215846
591 Ga0068852_100403120
592 Ga0068859_100011258
593 Ga0068859_100090088
594 Ga0068859_100190029
595 Ga0068859_100822582
596 Ga0068864_100001495
597 Ga0068864_100071095
598 Ga0068866_10211983
599 Ga0068861_100003094
600 Ga0068861_100009573
601 Ga0068861_100498863
602 Ga0068851_10000604
603 Ga0068851_10011617
604 Ga0068851_10105106
605 Ga0068851_10234615
606 Ga0068863_100013357
607 Ga0068863_100024637
608 Ga0068863_100105669
609 Ga0068863_100186622
610 Ga0068858_100001738
611 Ga0068858_100003164
612 Ga0068858_100036647
613 Ga0068860_100023312
614 Ga0068860_100073012
615 Ga0068860_100328701
616 Ga0068862_100117329
617 Ga0070717_10147227
618 Ga0075364_10202717
619 Ga0075369_10053155
620 Ga0075366_10021375
621 Ga0075366_10292647
622 Ga0097621_100001530
623 Ga0097621_100013041
624 Ga0097621_100025208
625 Ga0097621_100159896
626 Ga0097621_100491452
627 Ga0068871_100010929
628 Ga0068871_100011498
629 Ga0068871_100031006
630 Ga0068871_100051816
631 Ga0068871_100298024
632 Ga0075428_100057727
633 Ga0075428_100104803
634 Ga0075433_10115589
635 Ga0075433_10118479
636 Ga0075434_100014488
637 Ga0075429_100555440
638 Ga0068865_100162104
639 Ga0068865_100196193
640 Ga0068865_100252785
641 Ga0068865_100402843
642 Ga0075436_100004037
643 Ga0075436_100006955
644 Ga0097620_100011258
645 Ga0097620_100090089
646 Ga0097620_100190037
647 Ga0097620_100822579
648 Ga0075435_100020189
649 Ga0105240_10089290
650 Ga0105240_10183058
651 Ga0105240_10343936
652 Ga0111539_10001276
653 Ga0111539_10003234
654 Ga0111539_10015658
655 Ga0105245_10011997
656 Ga0105245_10409326
657 Ga0105245_10588039
658 Ga0105245_10590155
659 Ga0105243_10324003
660 Ga0105241_10006603
661 Ga0105241_10157880
662 Ga0105241_10290526
663 Ga0105241_10529218
664 Ga0105242_10000115
665 Ga0105242_10110095
666 Ga0105248_10036295
667 Ga0105248_10077973
668 Ga0105248_10377685
669 Ga0105248_10632603
670 Ga0105237_10010879
671 Ga0105237_10584223
672 Ga0105238_10060376
673 Ga0105238_10062629
674 Ga0105238_10106886
675 Ga0105238_10149461
676 Ga0105249_10410520
677 Ga0105239_10063535
678 Ga0157373_10127220
679 Ga0157371_10033221
680 Ga0157370_10013141
681 Ga0157370_10168596
682 Ga0157370_10480907
683 Ga0157370_10627870
684 Ga0157369_10002024
685 Ga0157369_10041430
686 Ga0157374_10019483
687 Ga0157374_10119178
688 Ga0157374_10377663
689 Ga0157378_10697981
690 Ga0163162_10045820
691 Ga0163162_10071799
692 Ga0163162_10335933
693 Ga0157372_10001158
694 Ga0157372_10054405
695 Ga0157372_10203249
696 Ga0157372_10215029
697 Ga0157372_10588498
698 Ga0157375_10070115
699 Ga0157375_10664548
700 Ga0157375_10863665
701 Ga0163163_10005934
702 Ga0163163_10899077
703 Ga0157380_10011793
704 Ga0157380_10153942
705 Ga0157377_10080505
706 Ga0157379_10005563
707 Ga0157379_10005798
708 Ga0157379_10053375
709 Ga0157379_10178550
710 Ga0157376_10008025
711 Ga0157376_10940430
712 Ga0182007_10069034
713 Ga0163161_10007253
714 Ga0163161_10030693
715 Ga0163161_10199257
716 Ga0163161_10215893
717 Ga0163161_10323523
718 Ga0213876_10063179
719 Ga0213876_10219032
720 Ga0209051_1003524
721 Ga0207697_10018824
722 Ga0207656_10021274
723 Ga0207656_10078224
724 Ga0207688_10012507
725 Ga0207680_10109403
726 Ga0207680_10179284
727 Ga0207647_10180017
728 Ga0207645_10007822
729 Ga0207645_10120245
730 Ga0207705_10092809
731 Ga0207654_10056994
732 Ga0207654_10074668
733 Ga0207707_10075618
734 Ga0207707_10186038
735 Ga0207695_10064012
736 Ga0207671_10026658
737 Ga0207671_10563912
738 Ga0207663_10025207
739 Ga0207663_10068844
740 Ga0207660_10071180
741 Ga0207662_10271817
742 Ga0207657_10239490
743 Ga0207649_10293838
744 Ga0207649_10678141
745 Ga0207652_10032986
746 Ga0207652_10154350
747 Ga0207652_10201124
748 Ga0207652_10412131
749 Ga0207681_10025210
750 Ga0207694_10027738
751 Ga0207694_10088214
752 Ga0207694_10099825
753 Ga0207694_10100209
754 Ga0207694_10115839
755 Ga0207694_10192045
756 Ga0207694_10632088
757 Ga0207650_10001539
758 Ga0207650_10282340
759 Ga0207687_10246270
760 Ga0207700_10000148
761 Ga0207700_10037227
762 Ga0207700_10459737
763 Ga0207664_10272453
764 Ga0207690_10042462
765 Ga0207690_10119752
766 Ga0207690_10344431
767 Ga0207706_10009396
768 Ga0207686_10020675
769 Ga0207686_10174471
770 Ga0207709_10594953
771 Ga0207670_10024310
772 Ga0207670_10038689
773 Ga0207670_10429109
774 Ga0207669_10270827
775 Ga0207704_10030323
776 Ga0207691_10010737
777 Ga0207691_10011884
778 Ga0207691_10024290
779 Ga0207691_10037113
780 Ga0207691_10099372
781 Ga0207691_10208013
782 Ga0207711_10017488
783 Ga0207711_10216548
784 Ga0207711_10290404
785 Ga0207711_10322954
786 Ga0207711_10431187
787 Ga0207689_10000591
788 Ga0207689_10001685
789 Ga0207689_10044586
790 Ga0207661_10254408
791 Ga0207679_10015386
792 Ga0207679_10041656
793 Ga0207679_10195024
794 Ga0207679_10514005
795 Ga0207667_10084275
796 Ga0207667_10091226
797 Ga0207667_10363209
798 Ga0207667_10410836
799 Ga0207667_10651297
800 Ga0207651_10033413
801 Ga0207712_10450864
802 Ga0207668_10200340
803 Ga0207640_10321161
804 Ga0207640_10474537
805 Ga0207640_10526640
806 Ga0207658_10023948
807 Ga0207658_10074510
808 Ga0207658_10169628
809 Ga0207677_10042641
810 Ga0207677_10101227
811 Ga0207677_10591122
812 Ga0207703_10001729
813 Ga0207703_10005461
814 Ga0207703_10013156
815 Ga0207639_10140791
816 Ga0207708_10159644
817 Ga0207702_10035167
818 Ga0207702_10125420
819 Ga0207702_10314376
820 Ga0207702_10539508
821 Ga0207641_10008653
822 Ga0207641_10126507
823 Ga0207641_10199688
824 Ga0207641_10284506
825 Ga0207648_10031249
826 Ga0207676_10006970
827 Ga0207676_10027487
828 Ga0207676_10208027
829 Ga0207674_10019948
830 Ga0207674_10036178
831 Ga0207674_10234555
832 Ga0207674_10436221
833 Ga0207674_10438130
834 Ga0207675_100007108
835 Ga0207675_100076948
836 Ga0207683_10002223
837 Ga0207683_10031577
838 Ga0207683_10128881
839 Ga0207683_10807519
840 Ga0207698_10000553
841 Ga0207698_10017736
842 Ga0207698_10266049
843 Ga0207428_10010983
844 Ga0207428_10082813
845 Ga0207428_10301816
846 Ga0268266_10015321
847 Ga0268265_10084637
848 Ga0268264_10001258
849 Ga0268264_10055009
850 Ga0268264_10300893
851 Ga0265334_10036864
852 Ga0307517_10092408
853 Ga0265338_10268646
854 Ga0265324_10037914
855 Ga0265331_10103639
856 Ga0307408_100249933
857 Ga0307413_10277256
858 Ga0307416_100797996
859 Ga0307415_100390498
860 Ga0373930_0019218
861 Ga0373958_0013507
862 Ga0373957_0116625
863 Ga0373943_0215518
864 Ga0373955_0066564
865 Ga0373924_0015969
866 Ga0373924_0041386
867 Ga0373931_0022489
868 Ga0373931_0259708
869 Ga0373927_0148248
870 Ga0373933_0063828
871 Ga0373937_0137485
872 Ga0373937_0141199
873 Ga0373925_0034078
874 Ga0395900_0073598
875 Ga0436365_0132097
876 Ga0436365_1061862
877 Ga0451577_0192950
878 Ga0466966_0090704
879 Ga0466963_0245111
880 Ga0453684_0063516
881 Ga0453684_0887272
882 Ga0453684_1055934
883 Ga0451576_0113985
884 Ga0466958_0079863
885 Ga0495603_0276796
886 Ga0495651_0030162
887 Ga0495651_0320541
888 Ga0495650_0007643
889 Ga0495608_0042802
890 Ga0495628_0265279
891 Ga0495642_0104649
892 Ga0495652_0077896
893 Ga0495621_0048276
894 Ga0495621_0095705
895 Ga0495645_0001593
896 Ga0495667_0108623
897 Ga0495625_0013100
898 Ga0495657_0117273
899 Ga0495657_0180654
900 Ga0495599_0106919
901 Ga0495600_0368845
902 Ga0495604_0040879
903 Ga0495680_0145452
904 Ga0495675_0060715
905 Ga0495684_0225757
906 Ga0495602_0083939
907 Ga0495615_0004946
908 Ga0496101_0020702
909 Ga0496102_0479223
910 Ga0496102_0835689
911 Ga0496104_0022955
912 Ga0496105_0307577
913 Ga0496106_0004306
914 Ga0496107_0010565
915 Ga0496109_0004487
916 Ga0496110_0028516
917 Ga0496111_0034719
918 Ga0496111_0414235
919 Ga0496112_0500618
920 Ga0496113_0438580
921 Ga0496113_0678123
922 Ga0496114_0129229
923 Ga0496115_0003898
924 Ga0501046_0233456
925 Ga0501047_0001870
926 Ga0501069_0003981
927 Ga0501070_0002611
928 Ga0501073_0000259
929 Ga0501079_0017360
930 Ga0501080_0136207
931 Ga0501080_0244118
932 Ga0501083_0009157
933 nmdc:mga00v17_246697_c1
934 nmdc:mga0k408_129969_c1
935 nmdc:mga0k408_6263_c1
936 nmdc:mga06z11_53971_c1
937 nmdc:mga09592_492937_c1
938 nmdc:mga08y16_306314_c1
939 nmdc:mga08y16_47975_c1
940 nmdc:mga08y16_656_c1
941 nmdc:mga0n895_406999_c1
942 nmdc:mga0n895_703233_c1
943 nmdc:mga0rr50_15436_c1
944 nmdc:mga0rr50_22972_c1
945 nmdc:mga08x19_117481_c1
946 nmdc:mga08x19_25057_c1
947 nmdc:mga08x19_34029_c1
948 nmdc:mga0a205_130432_c2
949 nmdc:mga0a205_1459_c1
950 Ga0495601_0004082
951 Ga0495595_0094249
952 Ga0495619_0065135
953 Ga0501084_0241619
954 Ga0501082_0159315

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04397

LytTR

LytTr DNA-binding domain

152

250

0.96

PF00072

Response_reg

Response regulator receiver domain

4

112

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d6w-assembly1.cif.gz_A lyttr dna-binding domain of putative methyl-accepting/dna response regulator from bacillus cereus. 0.8957 144 248
6swf-assembly1.cif.gz_A selenomethionine derivative of the rec domain of arat, a response regulator from geobacillus stearothermophilus 0.8727 1 120
2qv0-assembly1.cif.gz_A crystal structure of the response regulatory domain of protein mrke from klebsiella pneumoniae 0.8603 4 120
1mb0-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 8.0 in complex with mn2+ 0.855 3 115
4qyw-assembly1.cif.gz_A structure of phosphono-chey from t.maritima 0.8536 4 115
ID Description Score Start End Superfamily
3d6wB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.9149 144 212 2.40.50.40
af_P0AFT5_129_238_2.40.50.1020 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);LytTr DNA-binding domain 0.9062 143 248 2.40.50.1020
af_Q2FVQ7_36_146_2.40.50.1020 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);LytTr DNA-binding domain 0.8973 142 248 2.40.50.1020
af_I1NCE1_621_722_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8964 3 70 3.40.50.2300
af_P0AFT5_1_126_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.892 3 123 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1M3M8J3-F1-model_v4 HTH LytTR-type domain-containing protein 0.9451 140 248 GO:0000156
GO:0003677
GO:0016020
AF-A0A7C7WMN0-F1-model_v4 LytTR family transcriptional regulator 0.9379 160 248 GO:0000156
GO:0003677
AF-A0A511CXI3-F1-model_v4 HTH LytTR-type domain-containing protein 0.9315 145 248 GO:0000156
GO:0003677
AF-A0A3D4TPM5-F1-model_v4 DNA-binding response regulator 0.9296 1 123 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7T9QH55-F1-model_v4 deleted 0.9227 1 118

Map