F451650

General Info

Members Datasets Scaffolds Average Seq Length
477 187 477 211

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100896975|Ga0070707_1008969751
Length 232
Sequence MLIGIRRSCTRRRLIKERNVINRRLLSAGFGVLALALTVPLAGQVGKSLGVVDANIASEQDLLKFPNMTPAIVKGLLDRRPFNSVTELNAYLLSQGMTQSQAMEFYTKAFVHVNLNTATREEILLIPGAGTRMTREFPEYRPWKTFAQFDKEIGKYVGQEATDKLKQYVFIPVNLNTATDEDILSIPGAGPRMVREFKEYRPWKTKEQFDKEIGKYVGAKETARLWRFVVIQ

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
130 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
131 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
132 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
133 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
134 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
135 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
136 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
143 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
144 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
145 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
159 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
160 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
161 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
162 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
163 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
168 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.82
Nodule 0
Rhizoplane 0.84
Rhizosphere 94.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10166302 3300005289 Bacteria 1320
2 Ga0065712_10090004 3300005290 Bacteria 2442
3 Ga0065712_10093010 3300005290 Unclassified 2309
4 Ga0065715_10208662 3300005293 Bacteria 1325
5 Ga0065715_10220016 3300005293 Bacteria 1276
6 Ga0065715_10455712 3300005293 Bacteria 821
7 Ga0065715_10486927 3300005293 Unclassified 792
8 Ga0065707_10090992 3300005295 Bacteria 4026
9 Ga0065707_10248860 3300005295 Bacteria 1132
10 Ga0070676_10248037 3300005328 Bacteria 1187
11 Ga0070676_10321146 3300005328 Bacteria 1056
12 Ga0070676_10730636 3300005328 Bacteria 725
13 Ga0070690_100000471 3300005330 Bacteria 20213
14 Ga0070690_100105446 3300005330 Bacteria 1874
15 Ga0070690_100283665 3300005330 Bacteria 1182
16 Ga0070690_100588337 3300005330 Unclassified 843
17 Ga0070670_100006665 3300005331 Bacteria 9787
18 Ga0070670_100072155 3300005331 Bacteria 2965
19 Ga0070670_100096188 3300005331 Unclassified 2547
20 Ga0070670_100127477 3300005331 Bacteria 2197
21 Ga0070666_10010860 3300005335 Bacteria 5705
22 Ga0070666_10142932 3300005335 Bacteria 1667
23 Ga0070666_10192902 3300005335 Bacteria 1432
24 Ga0070666_10223545 3300005335 Bacteria 1328
25 Ga0070680_100338305 3300005336 Unclassified 1279
26 Ga0068868_100046890 3300005338 Unclassified 3383
27 Ga0070689_100045261 3300005340 Bacteria 3389
28 Ga0070689_100049768 3300005340 Bacteria 3236
29 Ga0070689_100168773 3300005340 Unclassified 1772
30 Ga0070689_100332361 3300005340 Bacteria 1271
31 Ga0070689_100387151 3300005340 Bacteria 1179
32 Ga0070689_100452234 3300005340 Bacteria 1093
33 Ga0070689_100458999 3300005340 Unclassified 1085
34 Ga0070661_100019349 3300005344 Unclassified 4853
35 Ga0070692_10311329 3300005345 Unclassified 965
36 Ga0070668_100055917 3300005347 Bacteria 3047
37 Ga0070669_100151180 3300005353 Unclassified 1797
38 Ga0070669_100234337 3300005353 Bacteria 1456
39 Ga0070675_100013921 3300005354 Bacteria 6331
40 Ga0070675_100146050 3300005354 Bacteria 2025
41 Ga0070675_100205077 3300005354 Bacteria 1712
42 Ga0070675_100514954 3300005354 Unclassified 1079
43 Ga0070675_100874543 3300005354 Bacteria 823
44 Ga0070671_100045418 3300005355 Unclassified 3652
45 Ga0070674_100528993 3300005356 Unclassified 986
46 Ga0070673_100042890 3300005364 Unclassified 3491
47 Ga0070673_100188458 3300005364 Bacteria 1770
48 Ga0070673_100441497 3300005364 Bacteria 1169
49 Ga0070673_100564656 3300005364 Bacteria 1035
50 Ga0070673_100718923 3300005364 Bacteria 918
51 Ga0070688_100029674 3300005365 Bacteria 3277
52 Ga0070688_100054558 3300005365 Bacteria 2504
53 Ga0070688_100101996 3300005365 Unclassified 1893
54 Ga0070667_100004308 3300005367 Bacteria 12011
55 Ga0070667_100045760 3300005367 Bacteria 3680
56 Ga0070701_10320698 3300005438 Bacteria 959
57 Ga0070711_101078374 3300005439 Unclassified 691
58 Ga0070705_100016162 3300005440 Unclassified 3874
59 Ga0070700_100033202 3300005441 Bacteria 3107
60 Ga0070678_100109290 3300005456 Bacteria 2160
61 Ga0070678_100142780 3300005456 Bacteria 1918
62 Ga0070678_100797618 3300005456 Unclassified 857
63 Ga0070678_101010391 3300005456 Unclassified 765
64 Ga0070662_100454738 3300005457 Bacteria 1063
65 Ga0068867_100100241 3300005459 Bacteria 2211
66 Ga0068867_100198648 3300005459 Bacteria 1604
67 Ga0068867_100612201 3300005459 Bacteria 951
68 Ga0070685_10079419 3300005466 Bacteria 1963
69 Ga0070685_10117346 3300005466 Bacteria 1648
70 Ga0070707_100262785 3300005468 Bacteria 1679
71 Ga0070707_100896975 3300005468 Bacteria 851
72 Ga0070698_100221779 3300005471 Bacteria 1824
73 Ga0070698_100478487 3300005471 Unclassified 1182
74 Ga0070699_100030986 3300005518 Bacteria 4618
75 Ga0070699_100323143 3300005518 Bacteria 1387
76 Ga0070697_100792796 3300005536 Unclassified 838
77 Ga0070672_100005634 3300005543 Bacteria 8330
78 Ga0070672_100043859 3300005543 Bacteria 3452
79 Ga0070686_100147674 3300005544 Unclassified 1643
80 Ga0070695_100100220 3300005545 Bacteria 1949
81 Ga0070695_100385697 3300005545 Bacteria 1058
82 Ga0070695_100868255 3300005545 Bacteria 727
83 Ga0070696_100080584 3300005546 Bacteria 2305
84 Ga0070696_100254168 3300005546 Bacteria 1330
85 Ga0070693_100017459 3300005547 Bacteria 3731
86 Ga0070704_100038564 3300005549 Bacteria 3274
87 Ga0070704_100340258 3300005549 Bacteria 1263
88 Ga0070664_100009305 3300005564 Bacteria 7972
89 Ga0070664_100616805 3300005564 Bacteria 1007
90 Ga0070702_100556670 3300005615 Unclassified 852
91 Ga0068859_100017581 3300005617 Bacteria 7189
92 Ga0068859_100226051 3300005617 Unclassified 1960
93 Ga0068859_100480527 3300005617 Bacteria 1338
94 Ga0068859_100562262 3300005617 Bacteria 1235
95 Ga0068859_101271406 3300005617 Bacteria 811
96 Ga0068859_101372708 3300005617 Bacteria 779
97 Ga0068864_100009728 3300005618 Bacteria 7931
98 Ga0068866_10283829 3300005718 Bacteria 1027
99 Ga0068861_100011768 3300005719 Bacteria 6089
100 Ga0068861_100415602 3300005719 Bacteria 1197
101 Ga0068851_10094778 3300005834 Unclassified 1576
102 Ga0068863_100017673 3300005841 Bacteria 6829
103 Ga0068863_100373999 3300005841 Bacteria 1391
104 Ga0068863_100616950 3300005841 Bacteria 1074
105 Ga0068858_100027264 3300005842 Bacteria 5308
106 Ga0068858_100180203 3300005842 Unclassified 1995
107 Ga0068858_100505522 3300005842 Unclassified 1168
108 Ga0068860_100158423 3300005843 Bacteria 2182
109 Ga0068860_100214208 3300005843 Bacteria 1869
110 Ga0068860_100322106 3300005843 Unclassified 1517
111 Ga0068860_100340222 3300005843 Bacteria 1475
112 Ga0068860_100394448 3300005843 Bacteria 1368
113 Ga0068862_100066195 3300005844 Bacteria 3113
114 Ga0068862_100203731 3300005844 Bacteria 1785
115 Ga0068862_100429062 3300005844 Bacteria 1242
116 Ga0068862_100475788 3300005844 Bacteria 1182
117 Ga0081539_10095156 3300005985 Bacteria 1530
118 Ga0075365_10002965 3300006038 Bacteria 8579
119 Ga0075365_10025761 3300006038 Bacteria 3726
120 Ga0075368_10007797 3300006042 Bacteria 3792
121 Ga0075368_10071187 3300006042 Bacteria 1404
122 Ga0075364_10021040 3300006051 Bacteria 4109
123 Ga0075364_10022415 3300006051 Bacteria 3988
124 Ga0075364_10075303 3300006051 Bacteria 2227
125 Ga0075367_10007946 3300006178 Bacteria 5467
126 Ga0075367_10026970 3300006178 Bacteria 3263
127 Ga0075367_10032854 3300006178 Bacteria 2988
128 Ga0075366_10126692 3300006195 Bacteria 1540
129 Ga0075366_10174002 3300006195 Bacteria 1307
130 Ga0097621_100087540 3300006237 Unclassified 2601
131 Ga0097621_100217893 3300006237 Bacteria 1662
132 Ga0097621_100265129 3300006237 Unclassified 1508
133 Ga0075370_10025940 3300006353 Bacteria 3244
134 Ga0068871_100077060 3300006358 Unclassified 2755
135 Ga0068871_100425988 3300006358 Unclassified 1186
136 Ga0068871_100529203 3300006358 Bacteria 1065
137 Ga0068871_100594294 3300006358 Bacteria 1006
138 Ga0075428_100005410 3300006844 Bacteria 14196
139 Ga0075428_100024366 3300006844 Bacteria 6697
140 Ga0075428_100073009 3300006844 Bacteria 3747
141 Ga0075428_100102292 3300006844 Bacteria 3124
142 Ga0075428_100102806 3300006844 Unclassified 3116
143 Ga0075428_100117477 3300006844 Bacteria 2897
144 Ga0075430_100003990 3300006846 Bacteria 12440
145 Ga0075430_100101138 3300006846 Bacteria 2407
146 Ga0075430_100189303 3300006846 Unclassified 1711
147 Ga0075430_100208605 3300006846 Bacteria 1621
148 Ga0075430_100394742 3300006846 Bacteria 1142
149 Ga0075431_100017154 3300006847 Bacteria 7360
150 Ga0075431_100053664 3300006847 Bacteria 4156
151 Ga0075431_100067592 3300006847 Unclassified 3689
152 Ga0075431_100197774 3300006847 Bacteria 2058
153 Ga0075431_100297095 3300006847 Bacteria 1632
154 Ga0075431_100514862 3300006847 Unclassified 1186
155 Ga0075433_10058074 3300006852 Bacteria 3383
156 Ga0075433_10080114 3300006852 Bacteria 2878
157 Ga0075433_10110037 3300006852 Unclassified 2444
158 Ga0075434_100077455 3300006871 Bacteria 3320
159 Ga0075429_100013886 3300006880 Bacteria 6986
160 Ga0075429_100035801 3300006880 Bacteria 4318
161 Ga0075429_100049262 3300006880 Bacteria 3663
162 Ga0075429_100059726 3300006880 Unclassified 3321
163 Ga0075429_100126301 3300006880 Bacteria 2237
164 Ga0075429_100130392 3300006880 Bacteria 2199
165 Ga0075429_100322065 3300006880 Bacteria 1353
166 Ga0068865_100529013 3300006881 Bacteria 987
167 Ga0097620_100017581 3300006931 Bacteria 7189
168 Ga0097620_100226058 3300006931 Unclassified 1960
169 Ga0097620_100480545 3300006931 Bacteria 1338
170 Ga0097620_100562281 3300006931 Bacteria 1235
171 Ga0097620_100568479 3300006931 Unclassified 1228
172 Ga0097620_101271500 3300006931 Bacteria 811
173 Ga0097620_101373142 3300006931 Bacteria 779
174 Ga0075435_100253909 3300007076 Bacteria 1497
175 Ga0111539_10000126 3300009094 Bacteria 86123
176 Ga0111539_10000328 3300009094 Bacteria 58065
177 Ga0111539_10000876 3300009094 Bacteria 39324
178 Ga0111539_10001834 3300009094 Bacteria 28251
179 Ga0111539_10003059 3300009094 Bacteria 22162
180 Ga0111539_10007686 3300009094 Bacteria 13771
181 Ga0111539_10048755 3300009094 Bacteria 5055
182 Ga0111539_10273058 3300009094 Bacteria 1968
183 Ga0111539_10380790 3300009094 Unclassified 1643
184 Ga0111539_10387883 3300009094 Bacteria 1626
185 Ga0111539_10538454 3300009094 Unclassified 1360
186 Ga0105245_10037550 3300009098 Bacteria 4307
187 Ga0105245_10174432 3300009098 Bacteria 2049
188 Ga0105245_10264047 3300009098 Bacteria 1676
189 Ga0105245_11505287 3300009098 Unclassified 724
190 Ga0114129_10005861 3300009147 Bacteria 17396
191 Ga0114129_10008543 3300009147 Bacteria 14598
192 Ga0114129_10013261 3300009147 Bacteria 11741
193 Ga0114129_10016966 3300009147 Bacteria 10366
194 Ga0114129_10080829 3300009147 Bacteria 4517
195 Ga0114129_10128246 3300009147 Bacteria 3486
196 Ga0114129_10380083 3300009147 Bacteria 1865
197 Ga0114129_10492097 3300009147 Unclassified 1603
198 Ga0114129_10846657 3300009147 Unclassified 1163
199 Ga0114129_10950067 3300009147 Bacteria 1086
200 Ga0114129_11210315 3300009147 Bacteria 940
201 Ga0105243_10058407 3300009148 Bacteria 3074
202 Ga0105243_10446228 3300009148 Bacteria 1213
203 Ga0105243_10460604 3300009148 Bacteria 1195
204 Ga0105243_10915538 3300009148 Bacteria 873
205 Ga0105241_10474283 3300009174 Bacteria 1111
206 Ga0105242_10055666 3300009176 Bacteria 3235
207 Ga0105242_10240683 3300009176 Bacteria 1627
208 Ga0105242_10936404 3300009176 Bacteria 869
209 Ga0105248_10008599 3300009177 Bacteria 11211
210 Ga0105248_10042036 3300009177 Bacteria 5126
211 Ga0105248_10135195 3300009177 Bacteria 2781
212 Ga0105248_10244004 3300009177 Bacteria 2022
213 Ga0105248_10697228 3300009177 Bacteria 1146
214 Ga0105248_10977511 3300009177 Unclassified 956
215 Ga0105248_11322036 3300009177 Unclassified 815
216 Ga0105249_10004690 3300009553 Bacteria 11804
217 Ga0105249_10163141 3300009553 Bacteria 2155
218 Ga0105249_10177749 3300009553 Unclassified 2068
219 Ga0105249_10228493 3300009553 Unclassified 1834
220 Ga0105249_10273721 3300009553 Bacteria 1683
221 Ga0157378_10770545 3300013297 Bacteria 986
222 Ga0163162_10011807 3300013306 Bacteria 8520
223 Ga0163162_10101399 3300013306 Unclassified 2971
224 Ga0163162_10104032 3300013306 Unclassified 2933
225 Ga0157375_10009780 3300013308 Bacteria 8429
226 Ga0157375_10096459 3300013308 Bacteria 3030
227 Ga0163163_10001779 3300014325 Bacteria 18183
228 Ga0163163_10016801 3300014325 Bacteria 6812
229 Ga0163163_10624801 3300014325 Unclassified 1141
230 Ga0157380_10017259 3300014326 Bacteria 5340
231 Ga0157380_10036257 3300014326 Bacteria 3814
232 Ga0157380_10230187 3300014326 Bacteria 1664
233 Ga0157380_10243391 3300014326 Bacteria 1623
234 Ga0157380_10782807 3300014326 Unclassified 969
235 Ga0157377_10036059 3300014745 Bacteria 2718
236 Ga0157376_10035923 3300014969 Unclassified 4011
237 Ga0157376_10105800 3300014969 Bacteria 2468
238 Ga0157376_10158314 3300014969 Bacteria 2050
239 Ga0157376_10201802 3300014969 Bacteria 1830
240 Ga0157376_10747169 3300014969 Bacteria 987
241 Ga0207697_10096785 3300025315 Bacteria 1255
242 Ga0207697_10204699 3300025315 Unclassified 869
243 Ga0207680_10020296 3300025903 Unclassified 3572
244 Ga0207680_10353856 3300025903 Bacteria 1032
245 Ga0207680_10375211 3300025903 Bacteria 1002
246 Ga0207645_10128669 3300025907 Unclassified 1647
247 Ga0207654_10498472 3300025911 Unclassified 860
248 Ga0207662_10044849 3300025918 Unclassified 2612
249 Ga0207649_10016694 3300025920 Unclassified 4148
250 Ga0207646_10161563 3300025922 Bacteria 2022
251 Ga0207646_10868780 3300025922 Bacteria 801
252 Ga0207681_10010092 3300025923 Bacteria 5779
253 Ga0207681_10034059 3300025923 Bacteria 3346
254 Ga0207681_10594018 3300025923 Unclassified 914
255 Ga0207650_10002145 3300025925 Bacteria 13790
256 Ga0207650_10277406 3300025925 Bacteria 1364
257 Ga0207659_10085650 3300025926 Bacteria 2342
258 Ga0207659_10620334 3300025926 Unclassified 923
259 Ga0207687_10391054 3300025927 Unclassified 1141
260 Ga0207687_10420553 3300025927 Bacteria 1103
261 Ga0207644_10005394 3300025931 Bacteria 8341
262 Ga0207686_10386507 3300025934 Unclassified 1063
263 Ga0207709_10109481 3300025935 Bacteria 1844
264 Ga0207709_10308752 3300025935 Bacteria 1179
265 Ga0207709_11005040 3300025935 Bacteria 682
266 Ga0207670_10138905 3300025936 Unclassified 1790
267 Ga0207670_10168229 3300025936 Unclassified 1641
268 Ga0207670_10191907 3300025936 Bacteria 1546
269 Ga0207670_10240356 3300025936 Unclassified 1395
270 Ga0207670_10410433 3300025936 Unclassified 1085
271 Ga0207669_10279655 3300025937 Unclassified 1258
272 Ga0207669_10365982 3300025937 Unclassified 1119
273 Ga0207669_10445551 3300025937 Bacteria 1025
274 Ga0207704_10724798 3300025938 Bacteria 825
275 Ga0207704_10865341 3300025938 Bacteria 758
276 Ga0207691_10012561 3300025940 Bacteria 8119
277 Ga0207691_10083511 3300025940 Bacteria 2867
278 Ga0207691_10134498 3300025940 Bacteria 2182
279 Ga0207691_10358111 3300025940 Bacteria 1248
280 Ga0207691_10416009 3300025940 Bacteria 1146
281 Ga0207711_10012415 3300025941 Bacteria 7082
282 Ga0207711_10119348 3300025941 Bacteria 2353
283 Ga0207711_10386038 3300025941 Bacteria 1300
284 Ga0207711_10479608 3300025941 Unclassified 1159
285 Ga0207689_10050470 3300025942 Bacteria 3430
286 Ga0207689_10166364 3300025942 Bacteria 1817
287 Ga0207689_10234464 3300025942 Bacteria 1517
288 Ga0207689_10800312 3300025942 Unclassified 796
289 Ga0207679_10014859 3300025945 Bacteria 5129
290 Ga0207679_10106213 3300025945 Bacteria 2207
291 Ga0207651_10005679 3300025960 Bacteria 6435
292 Ga0207651_10015485 3300025960 Unclassified 4433
293 Ga0207651_11060173 3300025960 Unclassified 726
294 Ga0207712_10008325 3300025961 Bacteria 6555
295 Ga0207712_10024206 3300025961 Bacteria 4018
296 Ga0207712_10110449 3300025961 Bacteria 2061
297 Ga0207658_10012572 3300025986 Bacteria 5778
298 Ga0207658_10462636 3300025986 Bacteria 1125
299 Ga0207677_10205202 3300026023 Unclassified 1570
300 Ga0207677_10381757 3300026023 Bacteria 1189
301 Ga0207677_10434983 3300026023 Bacteria 1121
302 Ga0207703_10157837 3300026035 Unclassified 1984
303 Ga0207703_10179524 3300026035 Bacteria 1868
304 Ga0207703_10915028 3300026035 Bacteria 840
305 Ga0207703_11016130 3300026035 Unclassified 796
306 Ga0207708_10865159 3300026075 Unclassified 781
307 Ga0207641_10015189 3300026088 Bacteria 6311
308 Ga0207641_10020748 3300026088 Bacteria 5400
309 Ga0207641_10377192 3300026088 Bacteria 1357
310 Ga0207648_10239487 3300026089 Bacteria 1615
311 Ga0207676_10040133 3300026095 Unclassified 3585
312 Ga0207675_100003958 3300026118 Bacteria 14375
313 Ga0207675_100054650 3300026118 Bacteria 3726
314 Ga0207675_100628835 3300026118 Unclassified 1078
315 Ga0207683_10330535 3300026121 Bacteria 1397
316 Ga0207683_10543555 3300026121 Bacteria 1074
317 Ga0207683_10868249 3300026121 Unclassified 838
318 Ga0209813_10017846 3300027866 Bacteria 1952
319 Ga0207428_10026750 3300027907 Bacteria 4809
320 Ga0207428_10047578 3300027907 Bacteria 3444
321 Ga0207428_10062572 3300027907 Unclassified 2942
322 Ga0207428_10136772 3300027907 Unclassified 1873
323 Ga0207428_10290309 3300027907 Bacteria 1212
324 Ga0268265_10405935 3300028380 Unclassified 1261
325 Ga0268264_10123241 3300028381 Unclassified 2287
326 Ga0268264_10134794 3300028381 Bacteria 2194
327 Ga0268264_10412625 3300028381 Bacteria 1300
328 Ga0268264_10513259 3300028381 Bacteria 1170
329 Ga0268264_10586363 3300028381 Bacteria 1097
330 Ga0307408_100005806 3300031548 Bacteria 8214
331 Ga0307408_100207356 3300031548 Bacteria 1590
332 Ga0307408_100436009 3300031548 Bacteria 1133
333 Ga0307408_100453155 3300031548 Bacteria 1113
334 Ga0307408_100569019 3300031548 Bacteria 1002
335 Ga0307405_10079158 3300031731 Bacteria 2141
336 Ga0307405_10242021 3300031731 Unclassified 1337
337 Ga0307405_10465635 3300031731 Bacteria 1006
338 Ga0307406_10251878 3300031901 Bacteria 1331
339 Ga0307412_10014281 3300031911 Bacteria 4680
340 Ga0307412_10237395 3300031911 Bacteria 1408
341 Ga0307409_100183080 3300031995 Unclassified 1857
342 Ga0307409_101190422 3300031995 Unclassified 785
343 Ga0307416_100044413 3300032002 Bacteria 3489
344 Ga0307416_100046147 3300032002 Bacteria 3436
345 Ga0307416_100314646 3300032002 Bacteria 1564
346 Ga0307416_100498840 3300032002 Bacteria 1281
347 Ga0307416_101045606 3300032002 Bacteria 920
348 Ga0307414_10268611 3300032004 Bacteria 1427
349 Ga0307414_10516925 3300032004 Bacteria 1059
350 Ga0307411_10035389 3300032005 Unclassified 3118
351 Ga0307411_10075109 3300032005 Bacteria 2306
352 Ga0307415_100919406 3300032126 Bacteria 808
353 Ga0316574_0369271 3300035398 Bacteria 906
354 Ga0451795_1406805 3300041456 Bacteria 777
355 Ga0439450_003535 3300042008 Unclassified 2593
356 Ga0439451_071128 3300042009 Unclassified 697
357 Ga0439435_0003102 3300042436 Bacteria 3411
358 Ga0439464_0029230 3300042439 Unclassified 1539
359 Ga0439460_0044376 3300042461 Unclassified 1316
360 Ga0439460_0049076 3300042461 Bacteria 1261
361 Ga0453683_0898064 3300044673 Bacteria 586
362 Ga0495628_0049667 3300046516 Unclassified 3321
363 Ga0495602_0668296 3300048088 Unclassified 708
364 Ga0496104_0569864 3300048907 Bacteria 1043
365 Ga0496106_0451997 3300048909 Bacteria 1032
366 Ga0496107_0784855 3300048910 Bacteria 698
367 Ga0501295_010718 3300049518 Bacteria 1449
368 Ga0501298_064010 3300049521 Bacteria 783
369 Ga0501299_001549 3300049522 Bacteria 2989
370 Ga0501299_017774 3300049522 Bacteria 1272
371 Ga0501032_0229212 3300049569 Bacteria 1208
372 Ga0501033_0029420 3300049570 Unclassified 4128
373 Ga0501033_0244790 3300049570 Unclassified 1272
374 Ga0501039_0038119 3300049575 Bacteria 3713
375 Ga0501039_0216950 3300049575 Bacteria 1504
376 Ga0501040_0004920 3300049576 Bacteria 8647
377 Ga0501040_0221832 3300049576 Unclassified 1345
378 Ga0501041_0013901 3300049577 Bacteria 4773
379 Ga0501041_0295519 3300049577 Bacteria 1020
380 Ga0501042_0026750 3300049578 Bacteria 4053
381 Ga0501042_0045842 3300049578 Bacteria 3117
382 Ga0501042_0071578 3300049578 Unclassified 2481
383 Ga0501046_0049036 3300049580 Bacteria 3342
384 Ga0501046_0286175 3300049580 Unclassified 1206
385 Ga0501068_0354485 3300049584 Unclassified 943
386 Ga0501071_0075452 3300049587 Bacteria 2461
387 Ga0501072_0011510 3300049588 Bacteria 6761
388 Ga0501072_0425419 3300049588 Bacteria 1052
389 Ga0501073_0154729 3300049589 Unclassified 1589
390 Ga0501075_0180151 3300049591 Unclassified 1612
391 Ga0501076_0003368 3300049592 Bacteria 11220
392 Ga0501076_0024877 3300049592 Bacteria 4631
393 Ga0501076_0029949 3300049592 Bacteria 4237
394 Ga0501076_0042434 3300049592 Unclassified 3581
395 Ga0501208_009259 3300049655 Bacteria 1355
396 Ga0501217_006679 3300049661 Bacteria 2459
397 Ga0501233_136535 3300049668 Bacteria 674
398 Ga0501249_074689 3300049679 Unclassified 794
399 Ga0501259_063210 3300049688 Unclassified 778
400 Ga0501221_049301 3300049704 Unclassified 944
401 Ga0501079_0048363 3300049741 Bacteria 3282
402 Ga0501079_0351054 3300049741 Unclassified 1156
403 Ga0501080_0196674 3300049742 Bacteria 1852
404 Ga0501080_0200122 3300049742 Unclassified 1834
405 Ga0501080_0947784 3300049742 Bacteria 748
406 Ga0501081_0004650 3300049743 Bacteria 8825
407 Ga0501081_0263692 3300049743 Bacteria 1259
408 Ga0501083_0183707 3300049744 Bacteria 1365
409 Ga0501265_027810 3300049762 Unclassified 800
410 Ga0501045_0002148 3300049824 Bacteria 13344
411 Ga0501204_025453 3300049850 Bacteria 796
412 nmdc:mga00v17_121239_c1 3300050491 Unclassified 1665
413 nmdc:mga00v17_14892_c1 3300050491 Bacteria 4351
414 nmdc:mga0yw44_106905_c1 3300050492 Bacteria 1789
415 nmdc:mga0k408_18175_c1 3300050493 Bacteria 3922
416 nmdc:mga06z11_22608_c1 3300050494 Bacteria 2940
417 nmdc:mga06z11_40224_c1 3300050494 Bacteria 2332
418 nmdc:mga06z11_54021_c1 3300050494 Bacteria 2069
419 nmdc:mga04h51_35211_c1 3300050495 Bacteria 1604
420 nmdc:mga07m45_26462_c1 3300050496 Bacteria 3189
421 nmdc:mga05p37_127401_c1 3300050507 Bacteria 3126
422 nmdc:mga05p37_13384_c2 3300050507 Bacteria 4799
423 nmdc:mga05p37_163607_c1 3300050507 Bacteria 2716
424 nmdc:mga05p37_1826_c1 3300050507 Bacteria 24822
425 nmdc:mga05p37_235535_c1 3300050507 Bacteria 2204
426 nmdc:mga05p37_24728_c1 3300050507 Bacteria 7301
427 nmdc:mga05p37_279823_c1 3300050507 Unclassified 1990
428 nmdc:mga05p37_390670_c1 3300050507 Bacteria 1627
429 nmdc:mga05p37_41992_c1 3300050507 Bacteria 4582
430 nmdc:mga05p37_716759_c1 3300050507 Bacteria 1109
431 nmdc:mga09592_233287_c1 3300050508 Unclassified 1594
432 nmdc:mga09592_359596_c1 3300050508 Bacteria 1260
433 nmdc:mga09592_467335_c1 3300050508 Bacteria 1088
434 nmdc:mga09592_56677_c1 3300050508 Bacteria 3311
435 nmdc:mga09592_6919_c1 3300050508 Bacteria 9219
436 nmdc:mga0qj67_122148_c1 3300050509 Unclassified 2107
437 nmdc:mga0qj67_15998_c1 3300050509 Bacteria 5681
438 nmdc:mga0qj67_172889_c1 3300050509 Bacteria 1754
439 nmdc:mga0qj67_190707_c1 3300050509 Bacteria 1666
440 nmdc:mga06r32_115016_c1 3300050510 Unclassified 2649
441 nmdc:mga06r32_116424_c1 3300050510 Bacteria 2633
442 nmdc:mga06r32_33121_c1 3300050510 Bacteria 4866
443 nmdc:mga06r32_344878_c1 3300050510 Bacteria 1474
444 nmdc:mga06r32_46723_c2 3300050510 Bacteria 3131
445 nmdc:mga06r32_519195_c1 3300050510 Bacteria 1167
446 nmdc:mga06r32_557186_c1 3300050510 Unclassified 1120
447 nmdc:mga08y16_10734_c1 3300050511 Bacteria 9611
448 nmdc:mga08y16_122202_c1 3300050511 Bacteria 2710
449 nmdc:mga08y16_1431_c1 3300050511 Bacteria 23934
450 nmdc:mga08y16_217980_c1 3300050511 Bacteria 1976
451 nmdc:mga08y16_219605_c1 3300050511 Bacteria 1968
452 nmdc:mga08y16_261337_c1 3300050511 Unclassified 1788
453 nmdc:mga08y16_483941_c1 3300050511 Unclassified 1259
454 nmdc:mga08y16_51706_c1 3300050511 Unclassified 4300
455 nmdc:mga08y16_693807_c1 3300050511 Unclassified 1019
456 nmdc:mga08y16_916200_c1 3300050511 Unclassified 862
457 nmdc:mga0n895_368675_c1 3300050512 Unclassified 1454
458 nmdc:mga0rr50_235790_c1 3300050513 Bacteria 1515
459 nmdc:mga0a205_119025_c1 3300050515 Bacteria 2540
460 nmdc:mga0a205_203376_c1 3300050515 Bacteria 1870
461 nmdc:mga0a205_22832_c1 3300050515 Bacteria 5931
462 nmdc:mga0a205_343899_c1 3300050515 Bacteria 1360
463 nmdc:mga0a205_55504_c1 3300050515 Bacteria 3826
464 nmdc:mga0a205_68022_c1 3300050515 Bacteria 3440
465 nmdc:mga0a205_89122_c1 3300050515 Unclassified 2982
466 Ga0501084_0005742 3300054114 Bacteria 10203
467 Ga0501084_0099799 3300054114 Unclassified 2438
468 Ga0501084_0111724 3300054114 Bacteria 2296
469 Ga0501084_0140214 3300054114 Unclassified 2036
470 Ga0501084_0578553 3300054114 Unclassified 949
471 Ga0501084_0586739 3300054114 Bacteria 942
472 Ga0501082_0005380 3300060353 Bacteria 11110
473 Ga0501082_0079419 3300060353 Bacteria 2831
474 Ga0501082_0081790 3300060353 Unclassified 2787
475 Ga0501082_0291047 3300060353 Unclassified 1422
476 Ga0501082_0827630 3300060353 Unclassified 810
477 Ga0530510_0016561 3300061734 Bacteria 5219

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050513 nmdc:mga0rr50_235790_c1 nmdc:mga0rr50_235790_c1_446_1084 146
2 3300050515 nmdc:mga0a205_119025_c1 nmdc:mga0a205_119025_c1_1423_2061 146
3 3300050507 nmdc:mga05p37_13384_c2 nmdc:mga05p37_13384_c2_481_1089 147
4 3300006852 Ga0075433_10058074 Ga0075433_100580744 150
5 3300006880 Ga0075429_100130392 Ga0075429_1001303923 150
6 3300007076 Ga0075435_100253909 Ga0075435_1002539092 150
7 3300009147 Ga0114129_10016966 Ga0114129_100169662 150
8 3300005330 Ga0070690_100283665 Ga0070690_1002836652 153
9 3300005544 Ga0070686_100147674 Ga0070686_1001476742 153
10 3300005843 Ga0068860_100322106 Ga0068860_1003221062 153
11 3300006871 Ga0075434_100077455 Ga0075434_1000774554 153
12 3300009094 Ga0111539_10003059 Ga0111539_1000305910 153
13 3300009553 Ga0105249_10228493 Ga0105249_102284933 153
14 3300025918 Ga0207662_10044849 Ga0207662_100448493 153
15 3300027907 Ga0207428_10136772 Ga0207428_101367723 153
16 3300028381 Ga0268264_10412625 Ga0268264_104126252 153
17 3300050511 nmdc:mga08y16_261337_c1 nmdc:mga08y16_261337_c1_1068_1715 153
18 3300050512 nmdc:mga0n895_368675_c1 nmdc:mga0n895_368675_c1_787_1434 153
19 3300050515 nmdc:mga0a205_343899_c1 nmdc:mga0a205_343899_c1_391_1038 153
20 3300044673 Ga0453683_0898064 Ga0453683_0898064_39_572 177
21 3300049743 Ga0501081_0263692 Ga0501081_0263692_680_1243 186
22 3300060353 Ga0501082_0081790 Ga0501082_0081790_27_590 186
23 3300005328 Ga0070676_10730636 Ga0070676_107306361 190
24 3300005456 Ga0070678_100797618 Ga0070678_1007976182 190
25 3300025907 Ga0207645_10128669 Ga0207645_101286692 190
26 3300026121 Ga0207683_10868249 Ga0207683_108682491 190
27 3300046516 Ga0495628_0049667 Ga0495628_0049667_1553_2203 192
28 3300048088 Ga0495602_0668296 Ga0495602_0668296_45_695 192
29 3300006881 Ga0068865_100529013 Ga0068865_1005290132 193
30 3300009098 Ga0105245_10174432 Ga0105245_101744322 193
31 3300009553 Ga0105249_10273721 Ga0105249_102737211 193
32 3300025942 Ga0207689_10050470 Ga0207689_100504703 195
33 3300050507 nmdc:mga05p37_41992_c1 nmdc:mga05p37_41992_c1_10_597 195
34 3300005440 Ga0070705_100016162 Ga0070705_1000161622 197
35 3300050515 nmdc:mga0a205_203376_c1 nmdc:mga0a205_203376_c1_232_831 197
36 3300006051 Ga0075364_10021040 Ga0075364_100210403 199
37 3300026088 Ga0207641_10015189 Ga0207641_100151896 199
38 3300050491 nmdc:mga00v17_14892_c1 nmdc:mga00v17_14892_c1_2114_2728 199
39 3300050510 nmdc:mga06r32_519195_c1 nmdc:mga06r32_519195_c1_55_654 199
40 3300005290 Ga0065712_10090004 Ga0065712_100900044 200
41 3300005331 Ga0070670_100096188 Ga0070670_1000961881 200
42 3300005844 Ga0068862_100429062 Ga0068862_1004290622 200
43 3300006038 Ga0075365_10025761 Ga0075365_100257614 200
44 3300006042 Ga0075368_10071187 Ga0075368_100711871 200
45 3300006178 Ga0075367_10032854 Ga0075367_100328542 200
46 3300006353 Ga0075370_10025940 Ga0075370_100259402 200
47 3300014969 Ga0157376_10035923 Ga0157376_100359234 200
48 3300025937 Ga0207669_10365982 Ga0207669_103659822 200
49 3300048910 Ga0496107_0784855 Ga0496107_0784855_10_615 200
50 3300050492 nmdc:mga0yw44_106905_c1 nmdc:mga0yw44_106905_c1_978_1589 200
51 3300050494 nmdc:mga06z11_54021_c1 nmdc:mga06z11_54021_c1_55_666 200
52 3300050496 nmdc:mga07m45_26462_c1 nmdc:mga07m45_26462_c1_1369_1980 200
53 3300005985 Ga0081539_10095156 Ga0081539_100951562 201
54 3300005365 Ga0070688_100029674 Ga0070688_1000296745 202
55 3300025315 Ga0207697_10204699 Ga0207697_102046992 202
56 3300028381 Ga0268264_10586363 Ga0268264_105863632 202
57 3300049742 Ga0501080_0947784 Ga0501080_0947784_24_632 202
58 3300054114 Ga0501084_0578553 Ga0501084_0578553_151_759 202
59 3300005340 Ga0070689_100332361 Ga0070689_1003323612 203
60 3300005340 Ga0070689_100387151 Ga0070689_1003871512 203
61 3300005439 Ga0070711_101078374 Ga0070711_1010783741 203
62 3300005545 Ga0070695_100868255 Ga0070695_1008682551 203
63 3300005546 Ga0070696_100254168 Ga0070696_1002541681 203
64 3300005547 Ga0070693_100017459 Ga0070693_1000174592 203
65 3300006038 Ga0075365_10002965 Ga0075365_100029655 203
66 3300006051 Ga0075364_10022415 Ga0075364_100224154 203
67 3300009094 Ga0111539_10001834 Ga0111539_1000183427 203
68 3300009148 Ga0105243_10058407 Ga0105243_100584074 203
69 3300009148 Ga0105243_10915538 Ga0105243_109155381 203
70 3300009174 Ga0105241_10474283 Ga0105241_104742831 203
71 3300026088 Ga0207641_10377192 Ga0207641_103771922 203
72 3300031995 Ga0307409_101190422 Ga0307409_1011904222 203
73 3300005347 Ga0070668_100055917 Ga0070668_1000559174 204
74 3300005549 Ga0070704_100340258 Ga0070704_1003402582 204
75 3300005844 Ga0068862_100066195 Ga0068862_1000661952 204
76 3300009094 Ga0111539_10387883 Ga0111539_103878832 204
77 3300009147 Ga0114129_10380083 Ga0114129_103800832 204
78 3300014326 Ga0157380_10017259 Ga0157380_100172594 204
79 3300025926 Ga0207659_10620334 Ga0207659_106203342 204
80 3300025961 Ga0207712_10024206 Ga0207712_100242062 204
81 3300026118 Ga0207675_100003958 Ga0207675_10000395810 204
82 3300049569 Ga0501032_0229212 Ga0501032_0229212_29_643 204
83 3300049575 Ga0501039_0216950 Ga0501039_0216950_209_823 204
84 3300049577 Ga0501041_0295519 Ga0501041_0295519_187_801 204
85 3300049578 Ga0501042_0045842 Ga0501042_0045842_192_806 204
86 3300049580 Ga0501046_0049036 Ga0501046_0049036_1726_2340 204
87 3300049587 Ga0501071_0075452 Ga0501071_0075452_52_666 204
88 3300049588 Ga0501072_0425419 Ga0501072_0425419_374_988 204
89 3300049592 Ga0501076_0024877 Ga0501076_0024877_2940_3554 204
90 3300050511 nmdc:mga08y16_483941_c1 nmdc:mga08y16_483941_c1_518_1132 204
91 3300054114 Ga0501084_0111724 Ga0501084_0111724_176_790 204
92 3300060353 Ga0501082_0079419 Ga0501082_0079419_532_1146 204
93 3300061734 Ga0530510_0016561 Ga0530510_0016561_2211_2825 204
94 3300005438 Ga0070701_10320698 Ga0070701_103206982 205
95 3300005545 Ga0070695_100385697 Ga0070695_1003856971 205
96 3300049518 Ga0501295_010718 Ga0501295_010718_89_709 205
97 3300049521 Ga0501298_064010 Ga0501298_064010_116_736 205
98 3300049522 Ga0501299_001549 Ga0501299_001549_592_1212 205
99 3300049655 Ga0501208_009259 Ga0501208_009259_16_636 205
100 3300049661 Ga0501217_006679 Ga0501217_006679_1757_2377 205
101 3300049668 Ga0501233_136535 Ga0501233_136535_15_635 205
102 3300049688 Ga0501259_063210 Ga0501259_063210_33_653 205
103 3300049704 Ga0501221_049301 Ga0501221_049301_116_736 205
104 3300049850 Ga0501204_025453 Ga0501204_025453_53_673 205
105 3300050491 nmdc:mga00v17_121239_c1 nmdc:mga00v17_121239_c1_856_1482 205
106 3300050494 nmdc:mga06z11_40224_c1 nmdc:mga06z11_40224_c1_374_1000 205
107 3300050495 nmdc:mga04h51_35211_c1 nmdc:mga04h51_35211_c1_328_954 205
108 3300005330 Ga0070690_100588337 Ga0070690_1005883371 206
109 3300005353 Ga0070669_100151180 Ga0070669_1001511802 206
110 3300005518 Ga0070699_100323143 Ga0070699_1003231432 206
111 3300005536 Ga0070697_100792796 Ga0070697_1007927961 206
112 3300005617 Ga0068859_100562262 Ga0068859_1005622622 206
113 3300006931 Ga0097620_100562281 Ga0097620_1005622812 206
114 3300009098 Ga0105245_10037550 Ga0105245_100375502 206
115 3300025927 Ga0207687_10391054 Ga0207687_103910542 206
116 3300005328 Ga0070676_10248037 Ga0070676_102480372 207
117 3300005340 Ga0070689_100045261 Ga0070689_1000452612 207
118 3300005354 Ga0070675_100013921 Ga0070675_1000139217 207
119 3300005365 Ga0070688_100054558 Ga0070688_1000545582 207
120 3300005466 Ga0070685_10117346 Ga0070685_101173462 207
121 3300005518 Ga0070699_100030986 Ga0070699_1000309863 207
122 3300009094 Ga0111539_10273058 Ga0111539_102730581 207
123 3300009147 Ga0114129_11210315 Ga0114129_112103152 207
124 3300009148 Ga0105243_10460604 Ga0105243_104606042 207
125 3300009177 Ga0105248_10244004 Ga0105248_102440041 207
126 3300009553 Ga0105249_10163141 Ga0105249_101631412 207
127 3300013306 Ga0163162_10011807 Ga0163162_100118072 207
128 3300014325 Ga0163163_10624801 Ga0163163_106248012 207
129 3300014326 Ga0157380_10782807 Ga0157380_107828072 207
130 3300025923 Ga0207681_10034059 Ga0207681_100340592 207
131 3300025935 Ga0207709_10308752 Ga0207709_103087522 207
132 3300025936 Ga0207670_10168229 Ga0207670_101682292 207
133 3300025937 Ga0207669_10279655 Ga0207669_102796553 207
134 3300025938 Ga0207704_10865341 Ga0207704_108653411 207
135 3300025940 Ga0207691_10416009 Ga0207691_104160091 207
136 3300025941 Ga0207711_10386038 Ga0207711_103860381 207
137 3300025942 Ga0207689_10234464 Ga0207689_102344641 207
138 3300025960 Ga0207651_10005679 Ga0207651_100056795 207
139 3300025961 Ga0207712_10110449 Ga0207712_101104491 207
140 3300050511 nmdc:mga08y16_219605_c1 nmdc:mga08y16_219605_c1_1240_1863 207
141 3300005335 Ga0070666_10223545 Ga0070666_102235452 208
142 3300005336 Ga0070680_100338305 Ga0070680_1003383052 208
143 3300005340 Ga0070689_100049768 Ga0070689_1000497682 208
144 3300005364 Ga0070673_100718923 Ga0070673_1007189232 208
145 3300005367 Ga0070667_100045760 Ga0070667_1000457604 208
146 3300005459 Ga0068867_100100241 Ga0068867_1001002413 208
147 3300005459 Ga0068867_100198648 Ga0068867_1001986482 208
148 3300005617 Ga0068859_100017581 Ga0068859_1000175812 208
149 3300005617 Ga0068859_100480527 Ga0068859_1004805273 208
150 3300005719 Ga0068861_100415602 Ga0068861_1004156022 208
151 3300005843 Ga0068860_100158423 Ga0068860_1001584233 208
152 3300006178 Ga0075367_10007946 Ga0075367_100079465 208
153 3300006195 Ga0075366_10126692 Ga0075366_101266922 208
154 3300006844 Ga0075428_100102292 Ga0075428_1001022923 208
155 3300006846 Ga0075430_100189303 Ga0075430_1001893033 208
156 3300006846 Ga0075430_100208605 Ga0075430_1002086052 208
157 3300006847 Ga0075431_100297095 Ga0075431_1002970953 208
158 3300006847 Ga0075431_100514862 Ga0075431_1005148622 208
159 3300006880 Ga0075429_100049262 Ga0075429_1000492622 208
160 3300006931 Ga0097620_100017581 Ga0097620_1000175816 208
161 3300006931 Ga0097620_100480545 Ga0097620_1004805453 208
162 3300009094 Ga0111539_10000126 Ga0111539_1000012642 208
163 3300009098 Ga0105245_11505287 Ga0105245_115052871 208
164 3300009147 Ga0114129_10005861 Ga0114129_1000586115 208
165 3300009177 Ga0105248_10135195 Ga0105248_101351954 208
166 3300025903 Ga0207680_10353856 Ga0207680_103538562 208
167 3300025935 Ga0207709_10109481 Ga0207709_101094812 208
168 3300025936 Ga0207670_10191907 Ga0207670_101919072 208
169 3300025936 Ga0207670_10240356 Ga0207670_102403562 208
170 3300025942 Ga0207689_10166364 Ga0207689_101663643 208
171 3300026035 Ga0207703_10915028 Ga0207703_109150282 208
172 3300026089 Ga0207648_10239487 Ga0207648_102394873 208
173 3300027907 Ga0207428_10026750 Ga0207428_100267503 208
174 3300028381 Ga0268264_10134794 Ga0268264_101347943 208
175 3300031548 Ga0307408_100453155 Ga0307408_1004531552 208
176 3300031731 Ga0307405_10465635 Ga0307405_104656352 208
177 3300032002 Ga0307416_100044413 Ga0307416_1000444134 208
178 3300049576 Ga0501040_0221832 Ga0501040_0221832_161_793 208
179 3300049578 Ga0501042_0071578 Ga0501042_0071578_139_771 208
180 3300049588 Ga0501072_0011510 Ga0501072_0011510_5312_5944 208
181 3300049591 Ga0501075_0180151 Ga0501075_0180151_538_1170 208
182 3300049592 Ga0501076_0029949 Ga0501076_0029949_3539_4171 208
183 3300049741 Ga0501079_0048363 Ga0501079_0048363_1229_1861 208
184 3300049742 Ga0501080_0196674 Ga0501080_0196674_144_776 208
185 3300050493 nmdc:mga0k408_18175_c1 nmdc:mga0k408_18175_c1_2621_3250 208
186 3300050494 nmdc:mga06z11_22608_c1 nmdc:mga06z11_22608_c1_1350_1979 208
187 3300050507 nmdc:mga05p37_1826_c1 nmdc:mga05p37_1826_c1_474_1100 208
188 3300050508 nmdc:mga09592_56677_c1 nmdc:mga09592_56677_c1_962_1603 208
189 3300050509 nmdc:mga0qj67_172889_c1 nmdc:mga0qj67_172889_c1_292_927 208
190 3300050509 nmdc:mga0qj67_190707_c1 nmdc:mga0qj67_190707_c1_440_1084 208
191 3300050510 nmdc:mga06r32_557186_c1 nmdc:mga06r32_557186_c1_380_1021 208
192 3300050511 nmdc:mga08y16_122202_c1 nmdc:mga08y16_122202_c1_2031_2666 208
193 3300050511 nmdc:mga08y16_1431_c1 nmdc:mga08y16_1431_c1_18457_19107 208
194 3300050511 nmdc:mga08y16_693807_c1 nmdc:mga08y16_693807_c1_197_832 208
195 3300050511 nmdc:mga08y16_916200_c1 nmdc:mga08y16_916200_c1_58_693 208
196 3300050515 nmdc:mga0a205_89122_c1 nmdc:mga0a205_89122_c1_2065_2700 208
197 3300054114 Ga0501084_0099799 Ga0501084_0099799_246_878 208
198 3300054114 Ga0501084_0586739 Ga0501084_0586739_263_895 208
199 3300060353 Ga0501082_0291047 Ga0501082_0291047_463_1095 208
200 3300060353 Ga0501082_0827630 Ga0501082_0827630_15_656 208
201 3300005354 Ga0070675_100146050 Ga0070675_1001460503 209
202 3300005364 Ga0070673_100188458 Ga0070673_1001884581 209
203 3300005468 Ga0070707_100262785 Ga0070707_1002627853 209
204 3300005545 Ga0070695_100100220 Ga0070695_1001002203 209
205 3300005546 Ga0070696_100080584 Ga0070696_1000805843 209
206 3300005549 Ga0070704_100038564 Ga0070704_1000385645 209
207 3300005719 Ga0068861_100011768 Ga0068861_1000117688 209
208 3300006358 Ga0068871_100529203 Ga0068871_1005292031 209
209 3300006852 Ga0075433_10080114 Ga0075433_100801143 209
210 3300009147 Ga0114129_10013261 Ga0114129_1001326111 209
211 3300009176 Ga0105242_10055666 Ga0105242_100556662 209
212 3300014969 Ga0157376_10201802 Ga0157376_102018022 209
213 3300025922 Ga0207646_10161563 Ga0207646_101615632 209
214 3300025925 Ga0207650_10277406 Ga0207650_102774062 209
215 3300032004 Ga0307414_10516925 Ga0307414_105169252 209
216 3300041456 Ga0451795_1406805 Ga0451795_1406805_86_727 209
217 3300049570 Ga0501033_0244790 Ga0501033_0244790_614_1261 209
218 3300049741 Ga0501079_0351054 Ga0501079_0351054_79_720 209
219 3300050507 nmdc:mga05p37_716759_c1 nmdc:mga05p37_716759_c1_227_865 209
220 3300050515 nmdc:mga0a205_68022_c1 nmdc:mga0a205_68022_c1_1369_2007 209
221 3300005293 Ga0065715_10455712 Ga0065715_104557121 210
222 3300005293 Ga0065715_10486927 Ga0065715_104869271 210
223 3300005295 Ga0065707_10248860 Ga0065707_102488602 210
224 3300005330 Ga0070690_100105446 Ga0070690_1001054461 210
225 3300005331 Ga0070670_100127477 Ga0070670_1001274773 210
226 3300005354 Ga0070675_100514954 Ga0070675_1005149541 210
227 3300005365 Ga0070688_100101996 Ga0070688_1001019963 210
228 3300005456 Ga0070678_100142780 Ga0070678_1001427802 210
229 3300005471 Ga0070698_100221779 Ga0070698_1002217793 210
230 3300005471 Ga0070698_100478487 Ga0070698_1004784872 210
231 3300005564 Ga0070664_100616805 Ga0070664_1006168052 210
232 3300005617 Ga0068859_100226051 Ga0068859_1002260513 210
233 3300005718 Ga0068866_10283829 Ga0068866_102838291 210
234 3300005842 Ga0068858_100505522 Ga0068858_1005055222 210
235 3300005843 Ga0068860_100214208 Ga0068860_1002142083 210
236 3300006844 Ga0075428_100102806 Ga0075428_1001028062 210
237 3300006931 Ga0097620_100226058 Ga0097620_1002260583 210
238 3300009094 Ga0111539_10007686 Ga0111539_100076864 210
239 3300009176 Ga0105242_10936404 Ga0105242_109364042 210
240 3300009177 Ga0105248_10977511 Ga0105248_109775111 210
241 3300009553 Ga0105249_10177749 Ga0105249_101777493 210
242 3300025934 Ga0207686_10386507 Ga0207686_103865072 210
243 3300025940 Ga0207691_10358111 Ga0207691_103581112 210
244 3300025942 Ga0207689_10800312 Ga0207689_108003122 210
245 3300025945 Ga0207679_10106213 Ga0207679_101062133 210
246 3300026023 Ga0207677_10381757 Ga0207677_103817571 210
247 3300026035 Ga0207703_11016130 Ga0207703_110161302 210
248 3300026121 Ga0207683_10330535 Ga0207683_103305352 210
249 3300027907 Ga0207428_10290309 Ga0207428_102903092 210
250 3300035398 Ga0316574_0369271 Ga0316574_0369271_192_830 210
251 3300042461 Ga0439460_0044376 Ga0439460_0044376_520_1158 210
252 3300049584 Ga0501068_0354485 Ga0501068_0354485_168_818 210
253 3300049589 Ga0501073_0154729 Ga0501073_0154729_712_1362 210
254 3300049592 Ga0501076_0042434 Ga0501076_0042434_2297_2947 210
255 3300049744 Ga0501083_0183707 Ga0501083_0183707_661_1311 210
256 3300050507 nmdc:mga05p37_163607_c1 nmdc:mga05p37_163607_c1_1032_1673 210
257 3300054114 Ga0501084_0140214 Ga0501084_0140214_26_676 210
258 3300005290 Ga0065712_10093010 Ga0065712_100930103 211
259 3300005293 Ga0065715_10220016 Ga0065715_102200161 211
260 3300005330 Ga0070690_100000471 Ga0070690_10000047110 211
261 3300005331 Ga0070670_100006665 Ga0070670_1000066654 211
262 3300005335 Ga0070666_10010860 Ga0070666_100108603 211
263 3300005335 Ga0070666_10142932 Ga0070666_101429322 211
264 3300005335 Ga0070666_10192902 Ga0070666_101929022 211
265 3300005338 Ga0068868_100046890 Ga0068868_1000468904 211
266 3300005340 Ga0070689_100168773 Ga0070689_1001687731 211
267 3300005340 Ga0070689_100458999 Ga0070689_1004589991 211
268 3300005344 Ga0070661_100019349 Ga0070661_1000193493 211
269 3300005354 Ga0070675_100874543 Ga0070675_1008745431 211
270 3300005355 Ga0070671_100045418 Ga0070671_1000454183 211
271 3300005356 Ga0070674_100528993 Ga0070674_1005289931 211
272 3300005364 Ga0070673_100042890 Ga0070673_1000428904 211
273 3300005367 Ga0070667_100004308 Ga0070667_1000043089 211
274 3300005456 Ga0070678_100109290 Ga0070678_1001092904 211
275 3300005456 Ga0070678_101010391 Ga0070678_1010103911 211
276 3300005459 Ga0068867_100612201 Ga0068867_1006122011 211
277 3300005468 Ga0070707_100896975 Ga0070707_1008969751 211
278 3300005543 Ga0070672_100005634 Ga0070672_1000056343 211
279 3300005564 Ga0070664_100009305 Ga0070664_1000093053 211
280 3300005615 Ga0070702_100556670 Ga0070702_1005566701 211
281 3300005617 Ga0068859_101271406 Ga0068859_1012714061 211
282 3300005617 Ga0068859_101372708 Ga0068859_1013727081 211
283 3300005618 Ga0068864_100009728 Ga0068864_1000097286 211
284 3300005834 Ga0068851_10094778 Ga0068851_100947782 211
285 3300005841 Ga0068863_100017673 Ga0068863_1000176734 211
286 3300005841 Ga0068863_100373999 Ga0068863_1003739992 211
287 3300005841 Ga0068863_100616950 Ga0068863_1006169502 211
288 3300005842 Ga0068858_100027264 Ga0068858_1000272643 211
289 3300005842 Ga0068858_100180203 Ga0068858_1001802032 211
290 3300005843 Ga0068860_100340222 Ga0068860_1003402221 211
291 3300005844 Ga0068862_100203731 Ga0068862_1002037312 211
292 3300005844 Ga0068862_100475788 Ga0068862_1004757882 211
293 3300006042 Ga0075368_10007797 Ga0075368_100077974 211
294 3300006051 Ga0075364_10075303 Ga0075364_100753033 211
295 3300006178 Ga0075367_10026970 Ga0075367_100269703 211
296 3300006195 Ga0075366_10174002 Ga0075366_101740022 211
297 3300006237 Ga0097621_100087540 Ga0097621_1000875404 211
298 3300006237 Ga0097621_100265129 Ga0097621_1002651292 211
299 3300006358 Ga0068871_100077060 Ga0068871_1000770603 211
300 3300006358 Ga0068871_100594294 Ga0068871_1005942942 211
301 3300006844 Ga0075428_100005410 Ga0075428_1000054106 211
302 3300006844 Ga0075428_100117477 Ga0075428_1001174773 211
303 3300006846 Ga0075430_100003990 Ga0075430_1000039906 211
304 3300006846 Ga0075430_100101138 Ga0075430_1001011382 211
305 3300006847 Ga0075431_100017154 Ga0075431_1000171543 211
306 3300006847 Ga0075431_100067592 Ga0075431_1000675921 211
307 3300006847 Ga0075431_100197774 Ga0075431_1001977742 211
308 3300006880 Ga0075429_100059726 Ga0075429_1000597262 211
309 3300006880 Ga0075429_100322065 Ga0075429_1003220653 211
310 3300006931 Ga0097620_101271500 Ga0097620_1012715001 211
311 3300006931 Ga0097620_101373142 Ga0097620_1013731421 211
312 3300009094 Ga0111539_10000328 Ga0111539_100003288 211
313 3300009094 Ga0111539_10380790 Ga0111539_103807902 211
314 3300009147 Ga0114129_10008543 Ga0114129_100085436 211
315 3300009147 Ga0114129_10128246 Ga0114129_101282462 211
316 3300009147 Ga0114129_10846657 Ga0114129_108466571 211
317 3300009148 Ga0105243_10446228 Ga0105243_104462282 211
318 3300009177 Ga0105248_10008599 Ga0105248_100085994 211
319 3300009177 Ga0105248_10697228 Ga0105248_106972281 211
320 3300009177 Ga0105248_11322036 Ga0105248_113220361 211
321 3300013297 Ga0157378_10770545 Ga0157378_107705451 211
322 3300013306 Ga0163162_10101399 Ga0163162_101013992 211
323 3300013306 Ga0163162_10104032 Ga0163162_101040324 211
324 3300013308 Ga0157375_10009780 Ga0157375_100097806 211
325 3300014325 Ga0163163_10001779 Ga0163163_100017799 211
326 3300014325 Ga0163163_10016801 Ga0163163_100168016 211
327 3300014326 Ga0157380_10036257 Ga0157380_100362572 211
328 3300014326 Ga0157380_10243391 Ga0157380_102433912 211
329 3300014969 Ga0157376_10105800 Ga0157376_101058002 211
330 3300014969 Ga0157376_10747169 Ga0157376_107471692 211
331 3300025903 Ga0207680_10020296 Ga0207680_100202961 211
332 3300025903 Ga0207680_10375211 Ga0207680_103752112 211
333 3300025920 Ga0207649_10016694 Ga0207649_100166942 211
334 3300025922 Ga0207646_10868780 Ga0207646_108687801 211
335 3300025925 Ga0207650_10002145 Ga0207650_100021456 211
336 3300025931 Ga0207644_10005394 Ga0207644_100053946 211
337 3300025935 Ga0207709_11005040 Ga0207709_110050401 211
338 3300025936 Ga0207670_10138905 Ga0207670_101389051 211
339 3300025936 Ga0207670_10410433 Ga0207670_104104331 211
340 3300025938 Ga0207704_10724798 Ga0207704_107247981 211
341 3300025940 Ga0207691_10012561 Ga0207691_100125616 211
342 3300025941 Ga0207711_10012415 Ga0207711_100124153 211
343 3300025941 Ga0207711_10119348 Ga0207711_101193484 211
344 3300025941 Ga0207711_10479608 Ga0207711_104796081 211
345 3300025945 Ga0207679_10014859 Ga0207679_100148593 211
346 3300025960 Ga0207651_10015485 Ga0207651_100154855 211
347 3300025986 Ga0207658_10012572 Ga0207658_100125723 211
348 3300025986 Ga0207658_10462636 Ga0207658_104626362 211
349 3300026023 Ga0207677_10205202 Ga0207677_102052022 211
350 3300026023 Ga0207677_10434983 Ga0207677_104349831 211
351 3300026035 Ga0207703_10157837 Ga0207703_101578372 211
352 3300026035 Ga0207703_10179524 Ga0207703_101795242 211
353 3300026088 Ga0207641_10020748 Ga0207641_100207485 211
354 3300026095 Ga0207676_10040133 Ga0207676_100401333 211
355 3300026121 Ga0207683_10543555 Ga0207683_105435551 211
356 3300027866 Ga0209813_10017846 Ga0209813_100178462 211
357 3300027907 Ga0207428_10062572 Ga0207428_100625721 211
358 3300028380 Ga0268265_10405935 Ga0268265_104059352 211
359 3300028381 Ga0268264_10123241 Ga0268264_101232411 211
360 3300028381 Ga0268264_10513259 Ga0268264_105132592 211
361 3300031548 Ga0307408_100005806 Ga0307408_1000058063 211
362 3300031548 Ga0307408_100207356 Ga0307408_1002073561 211
363 3300031548 Ga0307408_100436009 Ga0307408_1004360091 211
364 3300031548 Ga0307408_100569019 Ga0307408_1005690191 211
365 3300031731 Ga0307405_10079158 Ga0307405_100791583 211
366 3300031731 Ga0307405_10242021 Ga0307405_102420211 211
367 3300031901 Ga0307406_10251878 Ga0307406_102518781 211
368 3300031911 Ga0307412_10014281 Ga0307412_100142814 211
369 3300031911 Ga0307412_10237395 Ga0307412_102373953 211
370 3300031995 Ga0307409_100183080 Ga0307409_1001830802 211
371 3300032002 Ga0307416_100046147 Ga0307416_1000461473 211
372 3300032002 Ga0307416_100314646 Ga0307416_1003146462 211
373 3300032002 Ga0307416_100498840 Ga0307416_1004988402 211
374 3300032002 Ga0307416_101045606 Ga0307416_1010456062 211
375 3300032004 Ga0307414_10268611 Ga0307414_102686111 211
376 3300032005 Ga0307411_10035389 Ga0307411_100353893 211
377 3300032005 Ga0307411_10075109 Ga0307411_100751092 211
378 3300032126 Ga0307415_100919406 Ga0307415_1009194062 211
379 3300042008 Ga0439450_003535 Ga0439450_003535_1781_2419 211
380 3300042009 Ga0439451_071128 Ga0439451_071128_39_686 211
381 3300042436 Ga0439435_0003102 Ga0439435_0003102_182_829 211
382 3300042439 Ga0439464_0029230 Ga0439464_0029230_162_800 211
383 3300042461 Ga0439460_0049076 Ga0439460_0049076_148_786 211
384 3300048909 Ga0496106_0451997 Ga0496106_0451997_266_913 211
385 3300049522 Ga0501299_017774 Ga0501299_017774_230_868 211
386 3300049570 Ga0501033_0029420 Ga0501033_0029420_2804_3451 211
387 3300049575 Ga0501039_0038119 Ga0501039_0038119_1037_1684 211
388 3300049576 Ga0501040_0004920 Ga0501040_0004920_6555_7202 211
389 3300049577 Ga0501041_0013901 Ga0501041_0013901_3332_3979 211
390 3300049578 Ga0501042_0026750 Ga0501042_0026750_968_1615 211
391 3300049580 Ga0501046_0286175 Ga0501046_0286175_463_1110 211
392 3300049592 Ga0501076_0003368 Ga0501076_0003368_9350_9997 211
393 3300049679 Ga0501249_074689 Ga0501249_074689_29_673 211
394 3300049742 Ga0501080_0200122 Ga0501080_0200122_453_1100 211
395 3300049743 Ga0501081_0004650 Ga0501081_0004650_1390_2037 211
396 3300049762 Ga0501265_027810 Ga0501265_027810_79_723 211
397 3300049824 Ga0501045_0002148 Ga0501045_0002148_1772_2419 211
398 3300050507 nmdc:mga05p37_127401_c1 nmdc:mga05p37_127401_c1_937_1578 211
399 3300050507 nmdc:mga05p37_24728_c1 nmdc:mga05p37_24728_c1_1419_2063 211
400 3300050508 nmdc:mga09592_233287_c1 nmdc:mga09592_233287_c1_300_941 211
401 3300050508 nmdc:mga09592_359596_c1 nmdc:mga09592_359596_c1_603_1247 211
402 3300050509 nmdc:mga0qj67_122148_c1 nmdc:mga0qj67_122148_c1_757_1395 211
403 3300050509 nmdc:mga0qj67_15998_c1 nmdc:mga0qj67_15998_c1_4980_5624 211
404 3300050510 nmdc:mga06r32_115016_c1 nmdc:mga06r32_115016_c1_1807_2445 211
405 3300050510 nmdc:mga06r32_344878_c1 nmdc:mga06r32_344878_c1_374_1018 211
406 3300050511 nmdc:mga08y16_51706_c1 nmdc:mga08y16_51706_c1_3069_3707 211
407 3300050515 nmdc:mga0a205_22832_c1 nmdc:mga0a205_22832_c1_3897_4538 211
408 3300054114 Ga0501084_0005742 Ga0501084_0005742_448_1095 211
409 3300060353 Ga0501082_0005380 Ga0501082_0005380_10045_10692 211
410 3300005364 Ga0070673_100564656 Ga0070673_1005646562 212
411 3300005843 Ga0068860_100394448 Ga0068860_1003944482 212
412 3300006237 Ga0097621_100217893 Ga0097621_1002178932 212
413 3300006358 Ga0068871_100425988 Ga0068871_1004259881 212
414 3300006844 Ga0075428_100073009 Ga0075428_1000730092 212
415 3300006880 Ga0075429_100035801 Ga0075429_1000358014 212
416 3300006931 Ga0097620_100568479 Ga0097620_1005684792 212
417 3300009098 Ga0105245_10264047 Ga0105245_102640471 212
418 3300009147 Ga0114129_10950067 Ga0114129_109500672 212
419 3300009176 Ga0105242_10240683 Ga0105242_102406833 212
420 3300009177 Ga0105248_10042036 Ga0105248_100420361 212
421 3300013308 Ga0157375_10096459 Ga0157375_100964592 212
422 3300014969 Ga0157376_10158314 Ga0157376_101583142 212
423 3300025911 Ga0207654_10498472 Ga0207654_104984722 212
424 3300025960 Ga0207651_11060173 Ga0207651_110601731 212
425 3300026118 Ga0207675_100628835 Ga0207675_1006288352 212
426 3300048907 Ga0496104_0569864 Ga0496104_0569864_299_949 212
427 3300050507 nmdc:mga05p37_235535_c1 nmdc:mga05p37_235535_c1_731_1378 212
428 3300050507 nmdc:mga05p37_279823_c1 nmdc:mga05p37_279823_c1_12_665 212
429 3300050507 nmdc:mga05p37_390670_c1 nmdc:mga05p37_390670_c1_554_1204 212
430 3300050508 nmdc:mga09592_467335_c1 nmdc:mga09592_467335_c1_189_836 212
431 3300005328 Ga0070676_10321146 Ga0070676_103211462 213
432 3300005345 Ga0070692_10311329 Ga0070692_103113291 213
433 3300005353 Ga0070669_100234337 Ga0070669_1002343373 213
434 3300005364 Ga0070673_100441497 Ga0070673_1004414972 213
435 3300005457 Ga0070662_100454738 Ga0070662_1004547382 213
436 3300005466 Ga0070685_10079419 Ga0070685_100794192 213
437 3300006844 Ga0075428_100024366 Ga0075428_1000243663 213
438 3300006846 Ga0075430_100394742 Ga0075430_1003947421 213
439 3300006847 Ga0075431_100053664 Ga0075431_1000536643 213
440 3300006852 Ga0075433_10110037 Ga0075433_101100371 213
441 3300006880 Ga0075429_100013886 Ga0075429_1000138864 213
442 3300009094 Ga0111539_10048755 Ga0111539_100487554 213
443 3300009094 Ga0111539_10538454 Ga0111539_105384542 213
444 3300009147 Ga0114129_10492097 Ga0114129_104920971 213
445 3300025923 Ga0207681_10594018 Ga0207681_105940182 213
446 3300025937 Ga0207669_10445551 Ga0207669_104455511 213
447 3300025940 Ga0207691_10134498 Ga0207691_101344983 213
448 3300050508 nmdc:mga09592_6919_c1 nmdc:mga09592_6919_c1_1290_1946 213
449 3300050510 nmdc:mga06r32_33121_c1 nmdc:mga06r32_33121_c1_1351_2007 213
450 3300050510 nmdc:mga06r32_46723_c2 nmdc:mga06r32_46723_c2_1335_1988 213
451 3300050511 nmdc:mga08y16_217980_c1 nmdc:mga08y16_217980_c1_646_1302 213
452 3300050515 nmdc:mga0a205_55504_c1 nmdc:mga0a205_55504_c1_27_683 213
453 3300005289 Ga0065704_10166302 Ga0065704_101663021 214
454 3300005293 Ga0065715_10208662 Ga0065715_102086622 214
455 3300005295 Ga0065707_10090992 Ga0065707_100909925 214
456 3300005331 Ga0070670_100072155 Ga0070670_1000721552 214
457 3300005340 Ga0070689_100452234 Ga0070689_1004522342 214
458 3300005354 Ga0070675_100205077 Ga0070675_1002050772 214
459 3300005441 Ga0070700_100033202 Ga0070700_1000332023 214
460 3300005543 Ga0070672_100043859 Ga0070672_1000438592 214
461 3300006880 Ga0075429_100126301 Ga0075429_1001263014 214
462 3300009094 Ga0111539_10000876 Ga0111539_100008766 214
463 3300009147 Ga0114129_10080829 Ga0114129_100808293 214
464 3300009553 Ga0105249_10004690 Ga0105249_100046907 214
465 3300014326 Ga0157380_10230187 Ga0157380_102301872 214
466 3300014745 Ga0157377_10036059 Ga0157377_100360592 214
467 3300025315 Ga0207697_10096785 Ga0207697_100967852 214
468 3300025923 Ga0207681_10010092 Ga0207681_100100924 214
469 3300025926 Ga0207659_10085650 Ga0207659_100856502 214
470 3300025927 Ga0207687_10420553 Ga0207687_104205532 214
471 3300025940 Ga0207691_10083511 Ga0207691_100835113 214
472 3300025961 Ga0207712_10008325 Ga0207712_100083252 214
473 3300026075 Ga0207708_10865159 Ga0207708_108651591 214
474 3300026118 Ga0207675_100054650 Ga0207675_1000546503 214
475 3300027907 Ga0207428_10047578 Ga0207428_100475782 214
476 3300050510 nmdc:mga06r32_116424_c1 nmdc:mga06r32_116424_c1_865_1521 214
477 3300050511 nmdc:mga08y16_10734_c1 nmdc:mga08y16_10734_c1_2573_3217 214

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xwy-assembly1.cif.gz_A crystal structure of spfft3 n-terminal truncation 0.8309 36 69
8dss-assembly1.cif.gz_B x-ray crystal structure of geobacillus stearothermophilus comea 0.7921 154 214
2duy-assembly1.cif.gz_A crystal structure of competence protein comea-related protein from thermus thermophilus hb8 0.7585 27 92
2duy-assembly1.cif.gz_A crystal structure of competence protein comea-related protein from thermus thermophilus hb8 0.7297 27 92
8eqm-assembly1.cif.gz_u structure of a dimeric photosystem ii complex acclimated to far-red light 0.6468 34 83
ID Description Score Start End Superfamily
af_Q6TEQ0_116_189_1.10.150.280 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;AF1531-like domain 0.8274 93 153 1.10.150.280
af_Q7L9B9_134_199_1.10.150.280 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;AF1531-like domain 0.7733 34 94 1.10.150.280
2duyA00 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Photosystem II 12 kDa extrinsic protein 0.7461 27 92 1.10.150.320
2duyA00 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Photosystem II 12 kDa extrinsic protein 0.7177 27 92 1.10.150.320
af_Q7L9B9_134_199_1.10.150.280 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;AF1531-like domain 0.7152 34 94 1.10.150.280
ID Description Score Start End GO Terms
AF-A0A7W1E8F2-F1-model_v4 Helix-hairpin-helix domain-containing protein 0.9847 153 214
AF-A0A7V9TNJ0-F1-model_v4 Helix-hairpin-helix domain-containing protein 0.9845 153 214
AF-A0A2E6ECD4-F1-model_v4 Helix-hairpin-helix domain-containing protein 0.9743 25 214
AF-A0A7W1JRK9-F1-model_v4 Helix-hairpin-helix domain-containing protein 0.9724 153 214
AF-A0A1F2V7E0-F1-model_v4 Helix-hairpin-helix DNA-binding motif class 1 domain-containing protein 0.9607 10 214

Feature Viewer

pLDDT pTM Quality
90.11 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map