F451647

General Info

Members Datasets Scaffolds Average Seq Length
477 326 954 197

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_100034711|Ga0070662_1000347111
Length 222
Sequence MTARMRPSSPFDFDMARRETGIRMILPDGYSDVPAGKIAAVVTHLEMIVPPARRDDPPGAWTLRKVDAPALPWYRDLFRRVGEDWLWFSRPRMNDTELAAIIHAPGIEVYALVADGRDEGLLELDFREPGQCELVYFGVTAGLIGTGAGRFLMNRALEIAWSRNGSRVWVHTCTLDHPSAVAFYQRSGFRPFRRQIEIADDPRLDGTAPRDAARHVPIIDSP

Samples

Sample ID Description Type Environment
1 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
81 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
82 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
83 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
84 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
141 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
152 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
153 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
162 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
165 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
184 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
213 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
214 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
221 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
222 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
223 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
224 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
225 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
228 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
229 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
230 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
231 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
232 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
233 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
234 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
235 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
236 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
237 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
238 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
239 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
240 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
241 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
242 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
243 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
244 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
245 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
246 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
247 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
248 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
249 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
250 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
251 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
252 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
253 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
254 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
255 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
256 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
257 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
258 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
259 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
260 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
261 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
262 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
263 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
264 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
265 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
266 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
267 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
268 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
269 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
270 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
271 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
272 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
273 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
274 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
275 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
276 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
277 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
278 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
279 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
280 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
281 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
282 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
283 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
284 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
285 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
286 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
287 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
288 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
289 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
290 2922368715
291 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
292 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
293 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
294 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
295 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
296 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
297 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
298 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
299 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
300 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
301 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
302 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
303 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
304 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
305 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
306 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
307 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
308 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
309 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
310 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
311 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
312 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
313 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
314 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
315 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
316 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
317 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
318 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
319 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
320 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
321 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
322 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
323 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
324 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
325 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
326 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.45
Metatranscriptomes 0
Isolates 15.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.87
Nodule 11.74
Rhizoplane 7.34
Rhizosphere 52.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070662_100034711 3300005457 Bacteria 3558
2 JGI25406J46586_10000081 3300003203 Bacteria 43450
3 JGI25153J46596_10008416 3300003215 Bacteria 4932
4 JGI25153J46596_10009175 3300003215 Bacteria 4631
5 JGI25404J52841_10000666 3300003659 Bacteria 5246
6 Ga0055542_1006123 3300003762 Bacteria 2613
7 Ga0055529_1021236 3300003763 Bacteria 807
8 Ga0055531_10014188 3300003794 Bacteria 3609
9 Ga0055543_1003383 3300004625 Bacteria 4741
10 Ga0065165_1004479 3300005262 Bacteria 8607
11 Ga0065165_1012057 3300005262 Bacteria 3548
12 Ga0065165_1038552 3300005262 Bacteria 1439
13 Ga0070677_10235499 3300005333 Bacteria 901
14 Ga0068869_100650478 3300005334 Bacteria 895
15 Ga0070680_100358639 3300005336 Bacteria 1240
16 Ga0068868_100049544 3300005338 Bacteria 3296
17 Ga0068868_100978880 3300005338 Bacteria 773
18 Ga0070689_100472735 3300005340 Bacteria 1070
19 Ga0070668_100018823 3300005347 Bacteria 5187
20 Ga0070668_100241712 3300005347 Bacteria 1496
21 Ga0070668_100262822 3300005347 Bacteria 1436
22 Ga0070669_100635625 3300005353 Bacteria 897
23 Ga0070675_100153019 3300005354 Bacteria 1979
24 Ga0070671_100178559 3300005355 Bacteria 1797
25 Ga0070674_100021123 3300005356 Bacteria 4173
26 Ga0070674_100906706 3300005356 Bacteria 768
27 Ga0070673_100605075 3300005364 Bacteria 1000
28 Ga0070688_100310925 3300005365 Bacteria 1142
29 Ga0070667_100328236 3300005367 Bacteria 1382
30 Ga0070667_100490152 3300005367 Bacteria 1126
31 Ga0070663_100052167 3300005455 Bacteria 2916
32 Ga0070663_100481440 3300005455 Bacteria 1028
33 Ga0070663_100914550 3300005455 Bacteria 758
34 Ga0070678_100152712 3300005456 Bacteria 1862
35 Ga0070678_100356146 3300005456 Bacteria 1260
36 Ga0070678_100410909 3300005456 Bacteria 1178
37 Ga0070662_100027498 3300005457 Bacteria 3949
38 Ga0070662_100193106 3300005457 Bacteria 1611
39 Ga0068867_100485072 3300005459 Bacteria 1060
40 Ga0070685_10275620 3300005466 Bacteria 1124
41 Ga0070672_100110113 3300005543 Bacteria 2244
42 Ga0070686_100129673 3300005544 Bacteria 1742
43 Ga0070696_100263959 3300005546 Bacteria 1307
44 Ga0070665_100043934 3300005548 Bacteria 4489
45 Ga0070665_100163332 3300005548 Bacteria 2229
46 Ga0070665_100226383 3300005548 Bacteria 1870
47 Ga0068855_101320786 3300005563 Bacteria 746
48 Ga0070664_100336857 3300005564 Bacteria 1369
49 Ga0068854_101166228 3300005578 Bacteria 689
50 Ga0068856_100042641 3300005614 Bacteria 4464
51 Ga0070702_100569366 3300005615 Bacteria 844
52 Ga0068852_101266059 3300005616 Bacteria 759
53 Ga0068859_100360609 3300005617 Bacteria 1548
54 Ga0068864_100289184 3300005618 Bacteria 1532
55 Ga0068866_10134282 3300005718 Bacteria 1412
56 Ga0068870_10128301 3300005840 Bacteria 1470
57 Ga0068863_100135195 3300005841 Bacteria 2355
58 Ga0068863_100478903 3300005841 Bacteria 1224
59 Ga0068858_100050145 3300005842 Bacteria 3863
60 Ga0068860_100419880 3300005843 Bacteria 1326
61 Ga0068862_100140396 3300005844 Bacteria 2144
62 Ga0068862_100222191 3300005844 Bacteria 1711
63 Ga0068862_100276540 3300005844 Bacteria 1537
64 Ga0068862_100513045 3300005844 Bacteria 1140
65 Ga0081455_10027780 3300005937 Bacteria 5181
66 Ga0081540_1002505 3300005983 Bacteria 14938
67 Ga0081540_1005660 3300005983 Bacteria 9291
68 Ga0081540_1011106 3300005983 Bacteria 6045
69 Ga0081540_1063997 3300005983 Bacteria 1738
70 Ga0081539_10000461 3300005985 Bacteria 86158
71 Ga0075365_10035982 3300006038 Bacteria 3206
72 Ga0075365_10061533 3300006038 Bacteria 2507
73 Ga0075365_10324891 3300006038 Bacteria 1083
74 Ga0075365_10381545 3300006038 Bacteria 994
75 Ga0075365_10452363 3300006038 Bacteria 907
76 Ga0075365_10750769 3300006038 Bacteria 689
77 Ga0075363_100088781 3300006048 Bacteria 1699
78 Ga0075369_10073695 3300006186 Bacteria 1506
79 Ga0075366_10029544 3300006195 Bacteria 3220
80 Ga0075366_10224472 3300006195 Bacteria 1144
81 Ga0075370_10025304 3300006353 Bacteria 3282
82 Ga0075429_101031916 3300006880 Bacteria 719
83 Ga0068865_100032051 3300006881 Bacteria 3508
84 Ga0097620_100360629 3300006931 Bacteria 1548
85 Ga0105250_10215057 3300009092 Bacteria 813
86 Ga0105240_10168768 3300009093 Bacteria 2593
87 Ga0105240_10494252 3300009093 Bacteria 1362
88 Ga0111539_10250083 3300009094 Bacteria 2064
89 Ga0105245_10282960 3300009098 Bacteria 1622
90 Ga0105247_10041891 3300009101 Bacteria 2802
91 Ga0105247_10702521 3300009101 Bacteria 761
92 Ga0114129_11097957 3300009147 Bacteria 996
93 Ga0105243_10027429 3300009148 Bacteria 4364
94 Ga0105242_10136656 3300009176 Bacteria 2123
95 Ga0105242_10510411 3300009176 Bacteria 1145
96 Ga0105248_10107196 3300009177 Bacteria 3150
97 Ga0105248_10122066 3300009177 Bacteria 2939
98 Ga0105248_10637441 3300009177 Bacteria 1202
99 Ga0105237_10070977 3300009545 Bacteria 3478
100 Ga0105237_11510536 3300009545 Bacteria 678
101 Ga0105238_10594298 3300009551 Bacteria 1114
102 Ga0105238_10614718 3300009551 Bacteria 1095
103 Ga0105249_10531594 3300009553 Bacteria 1224
104 Ga0105239_10070735 3300010375 Bacteria 3833
105 Ga0105239_10141514 3300010375 Bacteria 2681
106 Ga0105239_10672639 3300010375 Bacteria 1183
107 Ga0105239_10847124 3300010375 Bacteria 1048
108 Ga0105246_10428877 3300011119 Bacteria 1105
109 Ga0157370_10325640 3300013104 Bacteria 1417
110 Ga0157378_10481281 3300013297 Bacteria 1237
111 Ga0157375_10173609 3300013308 Bacteria 2304
112 Ga0157375_10556289 3300013308 Bacteria 1309
113 Ga0163163_10556443 3300014325 Bacteria 1210
114 Ga0163163_10620065 3300014325 Bacteria 1145
115 Ga0163163_11181848 3300014325 Bacteria 828
116 Ga0157380_10174042 3300014326 Bacteria 1884
117 Ga0157379_10139689 3300014968 Bacteria 2184
118 Ga0157379_10919181 3300014968 Bacteria 831
119 Ga0157379_11130541 3300014968 Bacteria 751
120 Ga0157376_10130187 3300014969 Bacteria 2244
121 Ga0182006_1203363 3300015261 Bacteria 656
122 Ga0182007_10042267 3300015262 Bacteria 1517
123 Ga0163161_10489647 3300017792 Bacteria 1000
124 Ga0163161_10570056 3300017792 Bacteria 930
125 Ga0214544_1017666 3300021320 Bacteria 6286
126 Ga0214544_1025509 3300021320 Bacteria 2820
127 Ga0214544_1036861 3300021320 Bacteria 1237
128 Ga0214542_1024906 3300021321 Bacteria 3240
129 Ga0214545_1017468 3300021324 Bacteria 6923
130 Ga0214543_1026034 3300021327 Bacteria 3240
131 Ga0209677_102313 3300025253 Bacteria 7319
132 Ga0209148_1000321 3300025254 Bacteria 66604
133 Ga0209233_1005711 3300025261 Bacteria 4103
134 Ga0209233_1027343 3300025261 Bacteria 1383
135 Ga0209455_1001375 3300025272 Bacteria 11113
136 Ga0209455_1031822 3300025272 Bacteria 882
137 Ga0209758_1000206 3300025297 Bacteria 130177
138 Ga0209758_1000536 3300025297 Bacteria 60374
139 Ga0209758_1001539 3300025297 Bacteria 26507
140 Ga0209758_1001550 3300025297 Bacteria 26398
141 Ga0209758_1002309 3300025297 Bacteria 19718
142 Ga0209758_1008949 3300025297 Bacteria 6344
143 Ga0209758_1032285 3300025297 Bacteria 2128
144 Ga0209758_1044884 3300025297 Bacteria 1610
145 Ga0209256_1007408 3300025299 Bacteria 5418
146 Ga0207426_1000773 3300025302 Bacteria 35199
147 Ga0207426_1005553 3300025302 Bacteria 5725
148 Ga0207426_1082499 3300025302 Bacteria 869
149 Ga0209051_1074973 3300025303 Bacteria 1001
150 Ga0209257_1000394 3300025304 Bacteria 86654
151 Ga0209257_1010549 3300025304 Bacteria 4649
152 Ga0207642_10085999 3300025899 Bacteria 1540
153 Ga0207710_10023982 3300025900 Bacteria 2625
154 Ga0207688_10059153 3300025901 Bacteria 2157
155 Ga0207688_10091678 3300025901 Bacteria 1745
156 Ga0207647_10002508 3300025904 Bacteria 13900
157 Ga0207645_10345546 3300025907 Bacteria 995
158 Ga0207643_10133911 3300025908 Bacteria 1476
159 Ga0207654_10054535 3300025911 Bacteria 2310
160 Ga0207671_10051509 3300025914 Bacteria 3051
161 Ga0207657_10687732 3300025919 Bacteria 795
162 Ga0207694_10204175 3300025924 Bacteria 1608
163 Ga0207650_10396467 3300025925 Bacteria 1142
164 Ga0207659_10124064 3300025926 Bacteria 1983
165 Ga0207687_10017108 3300025927 Bacteria 4767
166 Ga0207644_10035964 3300025931 Bacteria 3474
167 Ga0207644_10081010 3300025931 Bacteria 2398
168 Ga0207690_10785256 3300025932 Bacteria 786
169 Ga0207706_10136999 3300025933 Bacteria 2154
170 Ga0207706_10236595 3300025933 Bacteria 1597
171 Ga0207686_10194758 3300025934 Bacteria 1447
172 Ga0207709_10179523 3300025935 Bacteria 1494
173 Ga0207670_10439372 3300025936 Bacteria 1050
174 Ga0207669_10012524 3300025937 Bacteria 4174
175 Ga0207669_10321184 3300025937 Bacteria 1185
176 Ga0207704_10426243 3300025938 Bacteria 1053
177 Ga0207691_10051529 3300025940 Bacteria 3763
178 Ga0207711_10124530 3300025941 Bacteria 2304
179 Ga0207711_10319675 3300025941 Bacteria 1434
180 Ga0207689_10062370 3300025942 Bacteria 3065
181 Ga0207689_10972131 3300025942 Bacteria 716
182 Ga0207689_10973487 3300025942 Bacteria 716
183 Ga0207651_10197900 3300025960 Bacteria 1608
184 Ga0207651_10342196 3300025960 Bacteria 1257
185 Ga0207668_10073651 3300025972 Bacteria 2448
186 Ga0207668_10082195 3300025972 Bacteria 2339
187 Ga0207668_10114339 3300025972 Bacteria 2031
188 Ga0207668_10197590 3300025972 Bacteria 1599
189 Ga0207668_10304016 3300025972 Bacteria 1317
190 Ga0207668_10368756 3300025972 Bacteria 1205
191 Ga0207668_10619588 3300025972 Bacteria 944
192 Ga0207640_10234463 3300025981 Bacteria 1414
193 Ga0207640_10844831 3300025981 Bacteria 796
194 Ga0207658_10717895 3300025986 Bacteria 904
195 Ga0207677_10037001 3300026023 Bacteria 3186
196 Ga0207703_10089340 3300026035 Bacteria 2587
197 Ga0207703_10186722 3300026035 Bacteria 1833
198 Ga0207703_10442256 3300026035 Bacteria 1213
199 Ga0207703_10617362 3300026035 Bacteria 1026
200 Ga0207639_10098339 3300026041 Bacteria 2358
201 Ga0207678_10109835 3300026067 Bacteria 2352
202 Ga0207678_10127106 3300026067 Bacteria 2174
203 Ga0207678_10147365 3300026067 Bacteria 2009
204 Ga0207678_10255386 3300026067 Bacteria 1502
205 Ga0207678_10294653 3300026067 Bacteria 1394
206 Ga0207708_10375196 3300026075 Bacteria 1172
207 Ga0207702_10398274 3300026078 Bacteria 1327
208 Ga0207648_10047295 3300026089 Bacteria 3772
209 Ga0207648_10217587 3300026089 Bacteria 1697
210 Ga0207648_10929294 3300026089 Bacteria 813
211 Ga0207676_10534966 3300026095 Bacteria 1117
212 Ga0207676_10859708 3300026095 Bacteria 888
213 Ga0207674_10267015 3300026116 Bacteria 1658
214 Ga0207675_100016261 3300026118 Bacteria 6946
215 Ga0207675_100048272 3300026118 Bacteria 3974
216 Ga0207675_100157194 3300026118 Bacteria 2167
217 Ga0207683_10180841 3300026121 Bacteria 1912
218 Ga0207683_10285117 3300026121 Bacteria 1510
219 Ga0207683_10376768 3300026121 Bacteria 1304
220 Ga0207698_10253345 3300026142 Bacteria 1612
221 Ga0209813_10048711 3300027866 Bacteria 1317
222 Ga0268266_10023446 3300028379 Bacteria 5256
223 Ga0268266_10027118 3300028379 Bacteria 4873
224 Ga0268266_10186743 3300028379 Bacteria 1890
225 Ga0268266_10766152 3300028379 Bacteria 932
226 Ga0268266_10797007 3300028379 Bacteria 912
227 Ga0268265_10140968 3300028380 Bacteria 2018
228 Ga0268265_10271628 3300028380 Bacteria 1512
229 Ga0268265_10603168 3300028380 Bacteria 1049
230 Ga0268264_10301334 3300028381 Bacteria 1509
231 Ga0268264_10743939 3300028381 Bacteria 976
232 Ga0307517_10112818 3300028786 Bacteria 2056
233 Ga0307513_10127279 3300031456 Bacteria 2500
234 Ga0307513_10147734 3300031456 Bacteria 2266
235 Ga0307509_10040641 3300031507 Bacteria 5056
236 Ga0307516_10112795 3300031730 Bacteria 2518
237 Ga0307516_10367088 3300031730 Bacteria 1103
238 Ga0307507_10198277 3300033179 Bacteria 1395
239 Ga0307510_10002798 3300033180 Bacteria 20009
240 Ga0373927_0287388 3300035695 Bacteria 1082
241 Ga0373933_0000267 3300035724 Bacteria 34008
242 Ga0373937_1054489 3300036401 Bacteria 762
243 Ga0373925_0092239 3300037068 Bacteria 2317
244 Ga0373925_0654681 3300037068 Bacteria 866
245 Ga0395905_0530580 3300037471 Bacteria 1078
246 Ga0436365_1432189 3300039437 Bacteria 1124
247 Ga0451793_1122759 3300041452 Bacteria 1005
248 Ga0466972_0084225 3300044658 Bacteria 1512
249 Ga0466965_0031003 3300044683 Bacteria 2606
250 Ga0466964_0168297 3300044706 Bacteria 1030
251 Ga0466964_0210551 3300044706 Bacteria 939
252 Ga0466960_0379700 3300044901 Bacteria 811
253 Ga0466967_0315592 3300045976 Bacteria 1506
254 Ga0495592_0169850 3300046454 Bacteria 1494
255 Ga0495603_0046893 3300046455 Bacteria 2574
256 Ga0495603_0066160 3300046455 Bacteria 2129
257 Ga0495603_0180886 3300046455 Bacteria 1220
258 Ga0495603_0455846 3300046455 Bacteria 732
259 Ga0495590_0052614 3300046457 Bacteria 1422
260 Ga0495638_0178800 3300046460 Bacteria 1212
261 Ga0495651_0053913 3300046462 Bacteria 3094
262 Ga0495653_0145296 3300046463 Bacteria 1663
263 Ga0495605_0217516 3300046474 Bacteria 827
264 Ga0495639_0244611 3300046475 Bacteria 886
265 Ga0495664_0026216 3300046477 Bacteria 3395
266 Ga0495584_0322737 3300046491 Bacteria 784
267 Ga0495596_0117055 3300046500 Bacteria 1035
268 Ga0495596_0177509 3300046500 Bacteria 828
269 Ga0495606_0002903 3300046507 Bacteria 18933
270 Ga0495608_0075072 3300046511 Bacteria 2203
271 Ga0495616_0147327 3300046513 Bacteria 1067
272 Ga0495616_0182344 3300046513 Bacteria 932
273 Ga0495628_0080092 3300046516 Bacteria 2539
274 Ga0495632_0162220 3300046519 Bacteria 1029
275 Ga0495652_0002672 3300046529 Bacteria 18127
276 Ga0495640_0033827 3300046533 Bacteria 3630
277 Ga0495622_0030058 3300046557 Bacteria 2538
278 Ga0495667_0030745 3300046559 Bacteria 3608
279 Ga0495656_0030768 3300046615 Bacteria 2172
280 Ga0495656_0301462 3300046615 Bacteria 821
281 Ga0495668_0095089 3300046616 Bacteria 1631
282 Ga0495634_0050461 3300046642 Bacteria 2794
283 Ga0495611_0220522 3300046648 Bacteria 882
284 Ga0495611_0276444 3300046648 Bacteria 776
285 Ga0495625_0087745 3300046660 Bacteria 2156
286 Ga0495625_0137420 3300046660 Bacteria 1651
287 Ga0495625_0188162 3300046660 Bacteria 1369
288 Ga0495657_0029977 3300046675 Bacteria 3812
289 Ga0495599_0071423 3300046678 Bacteria 2167
290 Ga0495623_0009962 3300046679 Bacteria 6157
291 Ga0495669_0002213 3300046684 Bacteria 7982
292 Ga0495671_0040091 3300046692 Bacteria 2363
293 Ga0495671_0302600 3300046692 Bacteria 769
294 Ga0495600_0022094 3300046809 Bacteria 4082
295 Ga0495600_0216988 3300046809 Bacteria 1224
296 Ga0495581_0107091 3300047315 Bacteria 1625
297 Ga0495604_0024091 3300047317 Bacteria 4858
298 Ga0495604_0274942 3300047317 Bacteria 1140
299 Ga0495636_0098648 3300047318 Bacteria 1275
300 Ga0495680_0001308 3300047322 Bacteria 27152
301 Ga0495680_0210070 3300047322 Bacteria 1394
302 Ga0495683_0050697 3300047323 Bacteria 2077
303 Ga0495687_013600 3300047443 Bacteria 4235
304 Ga0495675_0047869 3300047444 Bacteria 2720
305 Ga0495602_0011004 3300048088 Bacteria 9371
306 Ga0496100_0129795 3300048903 Bacteria 1774
307 Ga0496100_0591112 3300048903 Bacteria 861
308 Ga0496100_0697314 3300048903 Bacteria 792
309 Ga0496101_0089913 3300048904 Bacteria 2283
310 Ga0496101_0319860 3300048904 Bacteria 1217
311 Ga0496102_0141392 3300048905 Bacteria 2257
312 Ga0496102_0540051 3300048905 Bacteria 1088
313 Ga0496103_0104591 3300048906 Bacteria 1794
314 Ga0496103_0106423 3300048906 Bacteria 1779
315 Ga0496103_0268429 3300048906 Bacteria 1098
316 Ga0496104_0018777 3300048907 Bacteria 6314
317 Ga0496105_0048660 3300048908 Bacteria 3499
318 Ga0496105_0451959 3300048908 Bacteria 1014
319 Ga0496106_0131647 3300048909 Bacteria 1962
320 Ga0496106_0209277 3300048909 Bacteria 1553
321 Ga0496107_0312746 3300048910 Bacteria 1169
322 Ga0496108_0385265 3300048911 Bacteria 1224
323 Ga0496108_0836844 3300048911 Bacteria 792
324 Ga0496109_0261860 3300048912 Bacteria 1629
325 Ga0496110_0091923 3300048913 Bacteria 2715
326 Ga0496110_0407751 3300048913 Bacteria 1239
327 Ga0496111_0064407 3300048914 Bacteria 2659
328 Ga0496112_0000090 3300048915 Bacteria 59721
329 Ga0496112_0105076 3300048915 Bacteria 2794
330 Ga0496112_0178502 3300048915 Bacteria 2087
331 Ga0496112_0247738 3300048915 Bacteria 1733
332 Ga0496112_0422555 3300048915 Bacteria 1272
333 Ga0496113_0017151 3300048916 Bacteria 5020
334 Ga0496113_0238347 3300048916 Bacteria 1451
335 Ga0496113_0441801 3300048916 Bacteria 1045
336 Ga0496113_0491531 3300048916 Bacteria 985
337 Ga0496114_0224491 3300048917 Bacteria 1649
338 Ga0496114_0726275 3300048917 Bacteria 870
339 Ga0496115_0618193 3300048918 Bacteria 860
340 Ga0496116_0035057 3300048919 Bacteria 3529
341 Ga0496117_0247025 3300048920 Bacteria 976
342 Ga0496121_0082694 3300048924 Bacteria 2537
343 Ga0496121_0105047 3300048924 Bacteria 2168
344 Ga0496121_0121301 3300048924 Bacteria 1974
345 Ga0496122_0179122 3300048925 Bacteria 1267
346 Ga0496123_0092061 3300048926 Bacteria 1796
347 Ga0496124_0209692 3300048927 Bacteria 1475
348 Ga0496124_0392455 3300048927 Bacteria 966
349 Ga0496125_0038420 3300048928 Bacteria 4143
350 Ga0496126_0056218 3300048929 Bacteria 3558
351 Ga0496126_0086342 3300048929 Bacteria 2765
352 Ga0495682_0032723 3300049460 Bacteria 1921
353 nmdc:mga0yw44_135528_c1 3300050492 Bacteria 1203
354 nmdc:mga0yw44_169475_c1 3300050492 Bacteria 1433
355 nmdc:mga0yw44_26337_c1 3300050492 Bacteria 2843
356 nmdc:mga0yw44_538011_c1 3300050492 Bacteria 793
357 nmdc:mga0k408_176299_c1 3300050493 Bacteria 1274
358 nmdc:mga0k408_22918_c1 3300050493 Bacteria 3519
359 nmdc:mga0k408_91605_c1 3300050493 Bacteria 1786
360 nmdc:mga06z11_227951_c1 3300050494 Bacteria 1091
361 nmdc:mga04h51_40661_c1 3300050495 Bacteria 1516
362 nmdc:mga04h51_48849_c1 3300050495 Bacteria 1411
363 nmdc:mga04h51_61322_c1 3300050495 Bacteria 1290
364 nmdc:mga07m45_180931_c1 3300050496 Bacteria 1226
365 nmdc:mga07m45_222960_c1 3300050496 Bacteria 1097
366 nmdc:mga0sz30_18693_c1 3300050516 Bacteria 2776
367 Ga0500635_0026375 3300053080 Bacteria 1838
368 Ga0495619_0069006 3300053085 Bacteria 2362
369 Ga0495619_0406293 3300053085 Bacteria 940
370 Ga0500647_0074392 3300053091 Bacteria 1630
371 Ga0500647_0105597 3300053091 Bacteria 1342
372 Ga0500566_0002542 3300053094 Bacteria 10842
373 Ga0500640_006550 3300053095 Bacteria 4458
374 Ga0500641_0054854 3300053096 Bacteria 1649
375 Ga0500648_178952 3300053097 Bacteria 1094
376 Ga0500650_0159420 3300053098 Bacteria 1041
377 Ga0500554_002013 3300053102 Bacteria 3941
378 Ga0500557_000032 3300053105 Bacteria 74032
379 Ga0500572_000507 3300053111 Bacteria 13393
380 Ga0500592_055790 3300053116 Bacteria 644
381 Ga0500595_046978 3300053119 Bacteria 1355
382 Ga0500608_244805 3300053122 Bacteria 704
383 Ga0500614_000565 3300053123 Bacteria 9551
384 Ga0500614_015031 3300053123 Bacteria 1722
385 Ga0500559_0002230 3300053136 Bacteria 10238
386 Ga0500559_0039891 3300053136 Bacteria 2043
387 Ga0500564_165362 3300053138 Bacteria 933
388 Ga0500603_000460 3300053150 Bacteria 10515
389 Ga0500603_000628 3300053150 Bacteria 8704
390 Ga0500630_000433 3300053159 Bacteria 18090
391 Ga0500638_011076 3300053162 Bacteria 3984
392 Ga0500638_028673 3300053162 Bacteria 2676
393 Ga0500639_000031 3300053163 Bacteria 69938
394 Ga0500637_0042544 3300053178 Bacteria 2569
395 Ga0500637_0078410 3300053178 Bacteria 1906
396 Ga0500637_0410496 3300053178 Bacteria 700
397 Ga0500625_000232 3300053729 Bacteria 12898
398 Ga0500645_014493 3300053730 Bacteria 2509
399 Ga0500609_010442 3300053731 Bacteria 1251
400 Ga0500596_000212 3300053735 Bacteria 9767
401 Ga0500601_001494 3300053737 Bacteria 2558
402 Ga0500601_003485 3300053737 Bacteria 1706
403 2513700232 2513237102 Bacteria 7703324
404 2514014615 2513237161 Bacteria 8871253
405 2517103111 2517093001 Bacteria 9002274
406 2528858325 2528768022 Bacteria 10457665
407 2617347809 2617270735 Bacteria 9163226
408 2617374730 2617270741 Bacteria 8201522
409 2818240562 2816332527 Bacteria 8933356
410 2824623203 2824617872 Bacteria 8814715
411 2824632199 2824626560 Bacteria 8813858
412 2824640808 2824635225 Bacteria 8785348
413 2824647960 2824644064 Bacteria 8743947
414 2824667350 2824661429 Bacteria 9877870
415 2824709926 2824704595 Bacteria 9667483
416 2824717983 2824714736 Bacteria 8717648
417 2824728199 2824723954 Bacteria 8758240
418 2824737761 2824732956 Bacteria 7810675
419 2824750809 2824746037 Bacteria 7911610
420 2824762468 2824753945 Bacteria 9787441
421 2824772188 2824763712 Bacteria 9792355
422 2824775709 2824773399 Bacteria 8360218
423 2838125085 2838122688 Bacteria 8803140
424 2841945823 2841941048 Bacteria 8688029
425 2841956922 2841949485 Bacteria 8680857
426 2841963957 2841957949 Bacteria 8652217
427 2841973366 2841966195 Bacteria 8673214
428 2841982004 2841974524 Bacteria 8931498
429 2841989405 2841983080 Bacteria 8395090
430 2842044395 2842038055 Bacteria 8002051
431 2842051616 2842045827 Bacteria 8006841
432 2849082177 2849076700 Bacteria 7039503
433 2857513346 2857509624 Bacteria 7472071
434 2874622481 2874620515 Bacteria 8290088
435 2874633312 2874628541 Bacteria 8630250
436 2888387240 2888378607 Bacteria 9652610
437 2904671512 2904666416 Bacteria 8226587
438 2904719812 2904711408 Bacteria 9771557
439 2906650662 2906643746 Bacteria 8722424
440 2908777213 2908775508 Bacteria 8092255
441 2922377416
442 2922398505 2922393267 Bacteria 8285685
443 2929622206 2929615660 Bacteria 9193770
444 2929630147 2929624759 Bacteria 9339455
445 2932787921 2932784394 Bacteria 9704911
446 2932835051 2932828146 Bacteria 9745859
447 2933584180 2933577622 Bacteria 9116884
448 2935620427 2935616580 Bacteria 9032984
449 2935640751 2935638405 Bacteria 10015038
450 2935668943 2935665750 Bacteria 9571747
451 2935681331 2935675223 Bacteria 9928132
452 2935696777 2935694250 Bacteria 9291695
453 2935709131 2935703347 Bacteria 10242284
454 2935809070 2935801545 Bacteria 9301974
455 2935816010 2935810662 Bacteria 9401221
456 2935832258 2935827899 Bacteria 10038562
457 2935840912 2935837841 Bacteria 9454360
458 2935859313 2935855204 Bacteria 9035059
459 2935864497 2935864058 Bacteria 9784707
460 2935875151 2935873716 Bacteria 9632195
461 2935964978 2935959822 Bacteria 7869783
462 2935995874 2935992306 Bacteria 9802711
463 2936005785 2936002035 Bacteria 9362176
464 2936041913 2936037263 Bacteria 9446081
465 2941541826 2941538514 Bacteria 9402094
466 3005491075 3005483717 Bacteria 7877331
467 3005510916 3005506211 Bacteria 6943378
468 3005595872 3005594810 Bacteria 8716512
469 3005719066 3005718088 Bacteria 8283608
470 8006930180 8006926726 Bacteria 6749210
471 8016517258 8016511872 Bacteria 9921665
472 8017059337 8017057580 Bacteria 10023680
473 8019576289 8019576017 Bacteria 10049540
474 8019594163 8019586578 Bacteria 10212056
475 8019607400 8019597564 Bacteria 10041141
476 8019611112 8019608314 Bacteria 10042931
477 8055743545 8055742211 Bacteria 9226248
478 Ga0070662_100034711
479 JGI25406J46586_10000081
480 JGI25153J46596_10008416
481 JGI25153J46596_10009175
482 JGI25404J52841_10000666
483 Ga0055542_1006123
484 Ga0055529_1021236
485 Ga0055531_10014188
486 Ga0055543_1003383
487 Ga0065165_1004479
488 Ga0065165_1012057
489 Ga0065165_1038552
490 Ga0070677_10235499
491 Ga0068869_100650478
492 Ga0070680_100358639
493 Ga0068868_100049544
494 Ga0068868_100978880
495 Ga0070689_100472735
496 Ga0070668_100018823
497 Ga0070668_100241712
498 Ga0070668_100262822
499 Ga0070669_100635625
500 Ga0070675_100153019
501 Ga0070671_100178559
502 Ga0070674_100021123
503 Ga0070674_100906706
504 Ga0070673_100605075
505 Ga0070688_100310925
506 Ga0070667_100328236
507 Ga0070667_100490152
508 Ga0070663_100052167
509 Ga0070663_100481440
510 Ga0070663_100914550
511 Ga0070678_100152712
512 Ga0070678_100356146
513 Ga0070678_100410909
514 Ga0070662_100027498
515 Ga0070662_100193106
516 Ga0068867_100485072
517 Ga0070685_10275620
518 Ga0070672_100110113
519 Ga0070686_100129673
520 Ga0070696_100263959
521 Ga0070665_100043934
522 Ga0070665_100163332
523 Ga0070665_100226383
524 Ga0068855_101320786
525 Ga0070664_100336857
526 Ga0068854_101166228
527 Ga0068856_100042641
528 Ga0070702_100569366
529 Ga0068852_101266059
530 Ga0068859_100360609
531 Ga0068864_100289184
532 Ga0068866_10134282
533 Ga0068870_10128301
534 Ga0068863_100135195
535 Ga0068863_100478903
536 Ga0068858_100050145
537 Ga0068860_100419880
538 Ga0068862_100140396
539 Ga0068862_100222191
540 Ga0068862_100276540
541 Ga0068862_100513045
542 Ga0081455_10027780
543 Ga0081540_1002505
544 Ga0081540_1005660
545 Ga0081540_1011106
546 Ga0081540_1063997
547 Ga0081539_10000461
548 Ga0075365_10035982
549 Ga0075365_10061533
550 Ga0075365_10324891
551 Ga0075365_10381545
552 Ga0075365_10452363
553 Ga0075365_10750769
554 Ga0075363_100088781
555 Ga0075369_10073695
556 Ga0075366_10029544
557 Ga0075366_10224472
558 Ga0075370_10025304
559 Ga0075429_101031916
560 Ga0068865_100032051
561 Ga0097620_100360629
562 Ga0105250_10215057
563 Ga0105240_10168768
564 Ga0105240_10494252
565 Ga0111539_10250083
566 Ga0105245_10282960
567 Ga0105247_10041891
568 Ga0105247_10702521
569 Ga0114129_11097957
570 Ga0105243_10027429
571 Ga0105242_10136656
572 Ga0105242_10510411
573 Ga0105248_10107196
574 Ga0105248_10122066
575 Ga0105248_10637441
576 Ga0105237_10070977
577 Ga0105237_11510536
578 Ga0105238_10594298
579 Ga0105238_10614718
580 Ga0105249_10531594
581 Ga0105239_10070735
582 Ga0105239_10141514
583 Ga0105239_10672639
584 Ga0105239_10847124
585 Ga0105246_10428877
586 Ga0157370_10325640
587 Ga0157378_10481281
588 Ga0157375_10173609
589 Ga0157375_10556289
590 Ga0163163_10556443
591 Ga0163163_10620065
592 Ga0163163_11181848
593 Ga0157380_10174042
594 Ga0157379_10139689
595 Ga0157379_10919181
596 Ga0157379_11130541
597 Ga0157376_10130187
598 Ga0182006_1203363
599 Ga0182007_10042267
600 Ga0163161_10489647
601 Ga0163161_10570056
602 Ga0214544_1017666
603 Ga0214544_1025509
604 Ga0214544_1036861
605 Ga0214542_1024906
606 Ga0214545_1017468
607 Ga0214543_1026034
608 Ga0209677_102313
609 Ga0209148_1000321
610 Ga0209233_1005711
611 Ga0209233_1027343
612 Ga0209455_1001375
613 Ga0209455_1031822
614 Ga0209758_1000206
615 Ga0209758_1000536
616 Ga0209758_1001539
617 Ga0209758_1001550
618 Ga0209758_1002309
619 Ga0209758_1008949
620 Ga0209758_1032285
621 Ga0209758_1044884
622 Ga0209256_1007408
623 Ga0207426_1000773
624 Ga0207426_1005553
625 Ga0207426_1082499
626 Ga0209051_1074973
627 Ga0209257_1000394
628 Ga0209257_1010549
629 Ga0207642_10085999
630 Ga0207710_10023982
631 Ga0207688_10059153
632 Ga0207688_10091678
633 Ga0207647_10002508
634 Ga0207645_10345546
635 Ga0207643_10133911
636 Ga0207654_10054535
637 Ga0207671_10051509
638 Ga0207657_10687732
639 Ga0207694_10204175
640 Ga0207650_10396467
641 Ga0207659_10124064
642 Ga0207687_10017108
643 Ga0207644_10035964
644 Ga0207644_10081010
645 Ga0207690_10785256
646 Ga0207706_10136999
647 Ga0207706_10236595
648 Ga0207686_10194758
649 Ga0207709_10179523
650 Ga0207670_10439372
651 Ga0207669_10012524
652 Ga0207669_10321184
653 Ga0207704_10426243
654 Ga0207691_10051529
655 Ga0207711_10124530
656 Ga0207711_10319675
657 Ga0207689_10062370
658 Ga0207689_10972131
659 Ga0207689_10973487
660 Ga0207651_10197900
661 Ga0207651_10342196
662 Ga0207668_10073651
663 Ga0207668_10082195
664 Ga0207668_10114339
665 Ga0207668_10197590
666 Ga0207668_10304016
667 Ga0207668_10368756
668 Ga0207668_10619588
669 Ga0207640_10234463
670 Ga0207640_10844831
671 Ga0207658_10717895
672 Ga0207677_10037001
673 Ga0207703_10089340
674 Ga0207703_10186722
675 Ga0207703_10442256
676 Ga0207703_10617362
677 Ga0207639_10098339
678 Ga0207678_10109835
679 Ga0207678_10127106
680 Ga0207678_10147365
681 Ga0207678_10255386
682 Ga0207678_10294653
683 Ga0207708_10375196
684 Ga0207702_10398274
685 Ga0207648_10047295
686 Ga0207648_10217587
687 Ga0207648_10929294
688 Ga0207676_10534966
689 Ga0207676_10859708
690 Ga0207674_10267015
691 Ga0207675_100016261
692 Ga0207675_100048272
693 Ga0207675_100157194
694 Ga0207683_10180841
695 Ga0207683_10285117
696 Ga0207683_10376768
697 Ga0207698_10253345
698 Ga0209813_10048711
699 Ga0268266_10023446
700 Ga0268266_10027118
701 Ga0268266_10186743
702 Ga0268266_10766152
703 Ga0268266_10797007
704 Ga0268265_10140968
705 Ga0268265_10271628
706 Ga0268265_10603168
707 Ga0268264_10301334
708 Ga0268264_10743939
709 Ga0307517_10112818
710 Ga0307513_10127279
711 Ga0307513_10147734
712 Ga0307509_10040641
713 Ga0307516_10112795
714 Ga0307516_10367088
715 Ga0307507_10198277
716 Ga0307510_10002798
717 Ga0373927_0287388
718 Ga0373933_0000267
719 Ga0373937_1054489
720 Ga0373925_0092239
721 Ga0373925_0654681
722 Ga0395905_0530580
723 Ga0436365_1432189
724 Ga0451793_1122759
725 Ga0466972_0084225
726 Ga0466965_0031003
727 Ga0466964_0168297
728 Ga0466964_0210551
729 Ga0466960_0379700
730 Ga0466967_0315592
731 Ga0495592_0169850
732 Ga0495603_0046893
733 Ga0495603_0066160
734 Ga0495603_0180886
735 Ga0495603_0455846
736 Ga0495590_0052614
737 Ga0495638_0178800
738 Ga0495651_0053913
739 Ga0495653_0145296
740 Ga0495605_0217516
741 Ga0495639_0244611
742 Ga0495664_0026216
743 Ga0495584_0322737
744 Ga0495596_0117055
745 Ga0495596_0177509
746 Ga0495606_0002903
747 Ga0495608_0075072
748 Ga0495616_0147327
749 Ga0495616_0182344
750 Ga0495628_0080092
751 Ga0495632_0162220
752 Ga0495652_0002672
753 Ga0495640_0033827
754 Ga0495622_0030058
755 Ga0495667_0030745
756 Ga0495656_0030768
757 Ga0495656_0301462
758 Ga0495668_0095089
759 Ga0495634_0050461
760 Ga0495611_0220522
761 Ga0495611_0276444
762 Ga0495625_0087745
763 Ga0495625_0137420
764 Ga0495625_0188162
765 Ga0495657_0029977
766 Ga0495599_0071423
767 Ga0495623_0009962
768 Ga0495669_0002213
769 Ga0495671_0040091
770 Ga0495671_0302600
771 Ga0495600_0022094
772 Ga0495600_0216988
773 Ga0495581_0107091
774 Ga0495604_0024091
775 Ga0495604_0274942
776 Ga0495636_0098648
777 Ga0495680_0001308
778 Ga0495680_0210070
779 Ga0495683_0050697
780 Ga0495687_013600
781 Ga0495675_0047869
782 Ga0495602_0011004
783 Ga0496100_0129795
784 Ga0496100_0591112
785 Ga0496100_0697314
786 Ga0496101_0089913
787 Ga0496101_0319860
788 Ga0496102_0141392
789 Ga0496102_0540051
790 Ga0496103_0104591
791 Ga0496103_0106423
792 Ga0496103_0268429
793 Ga0496104_0018777
794 Ga0496105_0048660
795 Ga0496105_0451959
796 Ga0496106_0131647
797 Ga0496106_0209277
798 Ga0496107_0312746
799 Ga0496108_0385265
800 Ga0496108_0836844
801 Ga0496109_0261860
802 Ga0496110_0091923
803 Ga0496110_0407751
804 Ga0496111_0064407
805 Ga0496112_0000090
806 Ga0496112_0105076
807 Ga0496112_0178502
808 Ga0496112_0247738
809 Ga0496112_0422555
810 Ga0496113_0017151
811 Ga0496113_0238347
812 Ga0496113_0441801
813 Ga0496113_0491531
814 Ga0496114_0224491
815 Ga0496114_0726275
816 Ga0496115_0618193
817 Ga0496116_0035057
818 Ga0496117_0247025
819 Ga0496121_0082694
820 Ga0496121_0105047
821 Ga0496121_0121301
822 Ga0496122_0179122
823 Ga0496123_0092061
824 Ga0496124_0209692
825 Ga0496124_0392455
826 Ga0496125_0038420
827 Ga0496126_0056218
828 Ga0496126_0086342
829 Ga0495682_0032723
830 nmdc:mga0yw44_135528_c1
831 nmdc:mga0yw44_169475_c1
832 nmdc:mga0yw44_26337_c1
833 nmdc:mga0yw44_538011_c1
834 nmdc:mga0k408_176299_c1
835 nmdc:mga0k408_22918_c1
836 nmdc:mga0k408_91605_c1
837 nmdc:mga06z11_227951_c1
838 nmdc:mga04h51_40661_c1
839 nmdc:mga04h51_48849_c1
840 nmdc:mga04h51_61322_c1
841 nmdc:mga07m45_180931_c1
842 nmdc:mga07m45_222960_c1
843 nmdc:mga0sz30_18693_c1
844 Ga0500635_0026375
845 Ga0495619_0069006
846 Ga0495619_0406293
847 Ga0500647_0074392
848 Ga0500647_0105597
849 Ga0500566_0002542
850 Ga0500640_006550
851 Ga0500641_0054854
852 Ga0500648_178952
853 Ga0500650_0159420
854 Ga0500554_002013
855 Ga0500557_000032
856 Ga0500572_000507
857 Ga0500592_055790
858 Ga0500595_046978
859 Ga0500608_244805
860 Ga0500614_000565
861 Ga0500614_015031
862 Ga0500559_0002230
863 Ga0500559_0039891
864 Ga0500564_165362
865 Ga0500603_000460
866 Ga0500603_000628
867 Ga0500630_000433
868 Ga0500638_011076
869 Ga0500638_028673
870 Ga0500639_000031
871 Ga0500637_0042544
872 Ga0500637_0078410
873 Ga0500637_0410496
874 Ga0500625_000232
875 Ga0500645_014493
876 Ga0500609_010442
877 Ga0500596_000212
878 Ga0500601_001494
879 Ga0500601_003485
880 2513700232
881 2514014615
882 2517103111
883 2528858325
884 2617347809
885 2617374730
886 2818240562
887 2824623203
888 2824632199
889 2824640808
890 2824647960
891 2824667350
892 2824709926
893 2824717983
894 2824728199
895 2824737761
896 2824750809
897 2824762468
898 2824772188
899 2824775709
900 2838125085
901 2841945823
902 2841956922
903 2841963957
904 2841973366
905 2841982004
906 2841989405
907 2842044395
908 2842051616
909 2849082177
910 2857513346
911 2874622481
912 2874633312
913 2888387240
914 2904671512
915 2904719812
916 2906650662
917 2908777213
918 2922377416
919 2922398505
920 2929622206
921 2929630147
922 2932787921
923 2932835051
924 2933584180
925 2935620427
926 2935640751
927 2935668943
928 2935681331
929 2935696777
930 2935709131
931 2935809070
932 2935816010
933 2935832258
934 2935840912
935 2935859313
936 2935864497
937 2935875151
938 2935964978
939 2935995874
940 2936005785
941 2936041913
942 2941541826
943 3005491075
944 3005510916
945 3005595872
946 3005719066
947 8006930180
948 8016517258
949 8017059337
950 8019576289
951 8019594163
952 8019607400
953 8019611112
954 8055743545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

68

189

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pp9-assembly2.cif.gz_B 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8733 81 167
7ypu-assembly4.cif.gz_H orfe-coa-glycylthricin complex 0.8678 83 167
7ypu-assembly4.cif.gz_G orfe-coa-glycylthricin complex 0.8675 84 167
7ypu-assembly2.cif.gz_D orfe-coa-glycylthricin complex 0.8636 83 167
5c82-assembly1.cif.gz_A-2 crystal structure of nourseothricin acetyltransferase 0.8567 82 167
ID Description Score Start End Superfamily
af_K7KMF1_95_188_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8387 82 147 3.40.630.30
af_K7LZ12_255_436_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8233 95 167 3.40.630.30
af_Q2FVP9_1_111_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8181 88 170 3.40.630.30
af_A0A1D6G8A0_124_211_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8173 83 170 3.40.630.30
af_A0A0P0WGU7_189_301_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8124 83 170 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2M9PBQ9-F1-model_v4 N-acetyltransferase domain-containing protein 0.9783 41 172 GO:0016747
AF-A0A845QBS5-F1-model_v4 GNAT family N-acetyltransferase 0.9661 14 178 GO:0016747
AF-A0A368E3S0-F1-model_v4 GNAT family N-acetyltransferase 0.9656 14 180 GO:0016747
AF-A0A2E8CZ77-F1-model_v4 GNAT family N-acetyltransferase 0.9647 14 178 GO:0016747
AF-A0A3B9YT72-F1-model_v4 GNAT family N-acetyltransferase 0.9622 14 175 GO:0016747

Map