F451636

General Info

Members Datasets Scaffolds Average Seq Length
477 279 954 187

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10188642|Ga0070666_101886421
Length 198
Sequence MTDRAQYEPGPVSGARVQKDGEKWTLVLVRELRQSPEKVWQAITDPVHLREWAPFDADGNLGAAGSTVKLTTVGAPALHVTETTVTRADAPNLLEYKWGGFDMRWELEASLSGTRLTLWTNIGHRFIAMGAAGWHICFDVLDRFLASQPIGRIVGPEAMKLPGWQRLHAEYAKEFGVETLNWPPQTDNRLFEAGMSKK

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
193 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
194 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
195 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
196 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
208 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
209 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
210 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
211 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
220 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
221 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
225 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
226 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
227 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
270 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
271 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
272 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
273 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.32
Metatranscriptomes 1.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 0
Rhizoplane 3.77
Rhizosphere 94.55
Stem 0
Stem Tuber 0
Unclassified 5.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10188642 3300005335 Bacteria 1448
2 MBSR1b_contig_1299246 2162886012 Bacteria 1044
3 JGI24743J22301_10057851 3300001991 Bacteria 796
4 JGI24744J21845_10036775 3300002077 Bacteria 924
5 JGI24751J29686_10054229 3300002459 Bacteria 826
6 Ga0058863_10030263 3300004799 Bacteria 1391
7 Ga0065712_10174373 3300005290 Bacteria 1226
8 Ga0065715_10105294 3300005293 Bacteria 2903
9 Ga0065715_10153491 3300005293 Bacteria 1702
10 Ga0065715_10162419 3300005293 Unclassified 1617
11 Ga0070658_10018756 3300005327 Bacteria 5542
12 Ga0070658_10127637 3300005327 Bacteria 2118
13 Ga0070676_10015445 3300005328 Bacteria 4213
14 Ga0070676_10505667 3300005328 Bacteria 858
15 Ga0070683_100012103 3300005329 Bacteria 7486
16 Ga0070683_100036189 3300005329 Bacteria 4516
17 Ga0070683_100043778 3300005329 Bacteria 4126
18 Ga0070690_100019173 3300005330 Bacteria 4146
19 Ga0070670_100119388 3300005331 Bacteria 2274
20 Ga0070670_100689333 3300005331 Bacteria 918
21 Ga0070677_10000134 3300005333 Bacteria 24781
22 Ga0070677_10012674 3300005333 Bacteria 2931
23 Ga0068869_100017471 3300005334 Bacteria 4863
24 Ga0068869_100037532 3300005334 Bacteria 3445
25 Ga0070666_10022300 3300005335 Bacteria 4111
26 Ga0068868_100018789 3300005338 Bacteria 5170
27 Ga0068868_100371743 3300005338 Bacteria 1228
28 Ga0068868_100461011 3300005338 Bacteria 1107
29 Ga0070660_100072613 3300005339 Bacteria 2690
30 Ga0070660_100182660 3300005339 Bacteria 1697
31 Ga0070689_100000014 3300005340 Bacteria 185640
32 Ga0070689_100006232 3300005340 Bacteria 8233
33 Ga0070687_100000021 3300005343 Bacteria 52715
34 Ga0070661_100020661 3300005344 Bacteria 4696
35 Ga0070661_100194984 3300005344 Unclassified 1546
36 Ga0070692_10005748 3300005345 Bacteria 5327
37 Ga0070668_100000879 3300005347 Bacteria 20893
38 Ga0070669_100131513 3300005353 Bacteria 1920
39 Ga0070675_100805865 3300005354 Bacteria 858
40 Ga0070671_100040296 3300005355 Bacteria 3879
41 Ga0070674_100001013 3300005356 Bacteria 14683
42 Ga0070674_100017114 3300005356 Bacteria 4553
43 Ga0070673_100011305 3300005364 Bacteria 6087
44 Ga0070688_100037685 3300005365 Bacteria 2947
45 Ga0070688_100798778 3300005365 Bacteria 738
46 Ga0070659_100000146 3300005366 Bacteria 54086
47 Ga0070667_100044764 3300005367 Bacteria 3718
48 Ga0070667_100353066 3300005367 Bacteria 1331
49 Ga0070667_100594578 3300005367 Bacteria 1019
50 Ga0070709_10128335 3300005434 Bacteria 1728
51 Ga0070714_100463188 3300005435 Unclassified 1205
52 Ga0070714_100543060 3300005435 Bacteria 1112
53 Ga0070713_100031064 3300005436 Bacteria 4250
54 Ga0070713_100052776 3300005436 Bacteria 3367
55 Ga0070713_100643861 3300005436 Bacteria 1009
56 Ga0070711_100002517 3300005439 Bacteria 10471
57 Ga0070705_100267718 3300005440 Bacteria 1209
58 Ga0070700_100049693 3300005441 Bacteria 2605
59 Ga0070663_100008874 3300005455 Bacteria 6206
60 Ga0070663_100020491 3300005455 Bacteria 4380
61 Ga0070678_100006771 3300005456 Bacteria 6752
62 Ga0070678_100437283 3300005456 Bacteria 1143
63 Ga0070678_100454639 3300005456 Bacteria 1122
64 Ga0070678_100464813 3300005456 Bacteria 1111
65 Ga0070662_100005962 3300005457 Bacteria 7815
66 Ga0070662_100293266 3300005457 Bacteria 1319
67 Ga0070681_10029603 3300005458 Bacteria 5498
68 Ga0068867_100011112 3300005459 Bacteria 6351
69 Ga0070685_10011504 3300005466 Bacteria 4632
70 Ga0070685_10013134 3300005466 Bacteria 4360
71 Ga0070707_100164279 3300005468 Bacteria 2163
72 Ga0070698_100374702 3300005471 Bacteria 1356
73 Ga0070699_100082356 3300005518 Bacteria 2805
74 Ga0070699_100104546 3300005518 Bacteria 2483
75 Ga0070679_100329014 3300005530 Bacteria 1477
76 Ga0070684_100009454 3300005535 Bacteria 7679
77 Ga0070684_100077388 3300005535 Bacteria 2938
78 Ga0070684_100254396 3300005535 Bacteria 1605
79 Ga0068853_100005291 3300005539 Bacteria 10103
80 Ga0068853_100286655 3300005539 Bacteria 1519
81 Ga0070672_100113916 3300005543 Bacteria 2207
82 Ga0070686_100000971 3300005544 Bacteria 16531
83 Ga0070695_100178016 3300005545 Bacteria 1505
84 Ga0070696_100102137 3300005546 Bacteria 2056
85 Ga0070693_100010383 3300005547 Bacteria 4666
86 Ga0070693_100092740 3300005547 Bacteria 1824
87 Ga0070665_100000430 3300005548 Bacteria 61209
88 Ga0070665_100073677 3300005548 Bacteria 3420
89 Ga0070704_100150316 3300005549 Unclassified 1830
90 Ga0068855_100003710 3300005563 Bacteria 18670
91 Ga0068855_100187408 3300005563 Bacteria 2336
92 Ga0068855_100498793 3300005563 Bacteria 1323
93 Ga0068855_100808247 3300005563 Bacteria 996
94 Ga0070664_100043728 3300005564 Bacteria 3780
95 Ga0068857_100010017 3300005577 Bacteria 8230
96 Ga0068854_100014804 3300005578 Bacteria 5149
97 Ga0068854_100228693 3300005578 Unclassified 1475
98 Ga0068856_100028570 3300005614 Bacteria 5446
99 Ga0068856_100041812 3300005614 Bacteria 4506
100 Ga0070702_100293666 3300005615 Bacteria 1121
101 Ga0068852_100015974 3300005616 Bacteria 5844
102 Ga0068852_100201443 3300005616 Bacteria 1884
103 Ga0068852_100232297 3300005616 Bacteria 1758
104 Ga0068859_100061371 3300005617 Bacteria 3788
105 Ga0068859_100411683 3300005617 Bacteria 1448
106 Ga0068859_100435260 3300005617 Bacteria 1408
107 Ga0068864_100135709 3300005618 Bacteria 2215
108 Ga0068866_10014471 3300005718 Bacteria 3485
109 Ga0068861_100236589 3300005719 Bacteria 1551
110 Ga0068851_10009407 3300005834 Bacteria 4543
111 Ga0068870_10309502 3300005840 Bacteria 1000
112 Ga0068863_100006060 3300005841 Bacteria 11864
113 Ga0068863_100040002 3300005841 Bacteria 4459
114 Ga0068863_100058241 3300005841 Bacteria 3656
115 Ga0068863_100331365 3300005841 Bacteria 1480
116 Ga0068858_100006749 3300005842 Bacteria 11171
117 Ga0068858_100066450 3300005842 Bacteria 3338
118 Ga0068858_100577112 3300005842 Bacteria 1090
119 Ga0068860_100006592 3300005843 Bacteria 11657
120 Ga0068860_100157383 3300005843 Bacteria 2190
121 Ga0068860_100278045 3300005843 Bacteria 1635
122 Ga0068862_100065800 3300005844 Bacteria 3122
123 Ga0070717_10528694 3300006028 Bacteria 1067
124 Ga0070715_10026732 3300006163 Bacteria 2299
125 Ga0070716_100028659 3300006173 Bacteria 3002
126 Ga0070712_100000192 3300006175 Bacteria 33875
127 Ga0070712_100583007 3300006175 Unclassified 945
128 Ga0097621_100001121 3300006237 Bacteria 18657
129 Ga0097621_100026492 3300006237 Bacteria 4548
130 Ga0097621_100417419 3300006237 Bacteria 1204
131 Ga0068871_100000554 3300006358 Bacteria 25473
132 Ga0068871_100138076 3300006358 Bacteria 2071
133 Ga0068871_100497234 3300006358 Bacteria 1099
134 Ga0068871_101092210 3300006358 Bacteria 746
135 Ga0075428_100179306 3300006844 Bacteria 2293
136 Ga0075430_101066349 3300006846 Bacteria 666
137 Ga0075433_10243101 3300006852 Bacteria 1598
138 Ga0075433_10251937 3300006852 Unclassified 1566
139 Ga0075434_100009621 3300006871 Bacteria 9027
140 Ga0075434_100033935 3300006871 Bacteria 5038
141 Ga0075434_100088113 3300006871 Bacteria 3105
142 Ga0075434_100127831 3300006871 Unclassified 2558
143 Ga0075434_100140092 3300006871 Unclassified 2438
144 Ga0075434_100634777 3300006871 Bacteria 1087
145 Ga0075429_100111929 3300006880 Bacteria 2386
146 Ga0068865_100015533 3300006881 Bacteria 4858
147 Ga0075436_100057628 3300006914 Bacteria 2683
148 Ga0075436_100087342 3300006914 Bacteria 2166
149 Ga0075436_100103664 3300006914 Bacteria 1982
150 Ga0097620_100061376 3300006931 Bacteria 3788
151 Ga0097620_100411719 3300006931 Bacteria 1448
152 Ga0097620_100435264 3300006931 Bacteria 1408
153 Ga0075435_100064273 3300007076 Bacteria 2981
154 Ga0099795_10101317 3300007788 Bacteria 1130
155 Ga0105250_10068954 3300009092 Bacteria 1428
156 Ga0105240_10002245 3300009093 Bacteria 31383
157 Ga0105240_10080962 3300009093 Bacteria 3992
158 Ga0111539_10012439 3300009094 Bacteria 10669
159 Ga0105245_10012430 3300009098 Bacteria 7409
160 Ga0105245_10036304 3300009098 Bacteria 4378
161 Ga0105247_10077130 3300009101 Bacteria 2094
162 Ga0114129_10000420 3300009147 Bacteria 50180
163 Ga0114129_10006204 3300009147 Bacteria 16952
164 Ga0114129_10338559 3300009147 Bacteria 1996
165 Ga0105243_10119844 3300009148 Bacteria 2216
166 Ga0105243_10822241 3300009148 Bacteria 917
167 Ga0105241_10029887 3300009174 Bacteria 4069
168 Ga0105241_10270588 3300009174 Bacteria 1447
169 Ga0105241_10433111 3300009174 Bacteria 1160
170 Ga0105242_10155369 3300009176 Bacteria 1998
171 Ga0105242_10958896 3300009176 Bacteria 860
172 Ga0105248_10019515 3300009177 Bacteria 7502
173 Ga0105248_10257750 3300009177 Bacteria 1963
174 Ga0105248_10697352 3300009177 Bacteria 1146
175 Ga0105248_10764225 3300009177 Bacteria 1090
176 Ga0105237_10000705 3300009545 Bacteria 46265
177 Ga0105237_10068511 3300009545 Bacteria 3542
178 Ga0105237_10221662 3300009545 Bacteria 1891
179 Ga0105237_10240230 3300009545 Bacteria 1812
180 Ga0105237_10256127 3300009545 Bacteria 1752
181 Ga0105238_10000349 3300009551 Bacteria 49771
182 Ga0105238_10035513 3300009551 Bacteria 5068
183 Ga0105249_10101348 3300009553 Bacteria 2708
184 Ga0105239_10063197 3300010375 Bacteria 4064
185 Ga0105239_10204879 3300010375 Bacteria 2210
186 Ga0105239_10256666 3300010375 Bacteria 1964
187 Ga0105246_10092326 3300011119 Bacteria 2184
188 Ga0157373_10001682 3300013100 Bacteria 16885
189 Ga0157371_10004169 3300013102 Bacteria 12739
190 Ga0157369_10047291 3300013105 Bacteria 4673
191 Ga0157369_10061202 3300013105 Bacteria 4059
192 Ga0157369_10305560 3300013105 Bacteria 1654
193 Ga0157369_10596541 3300013105 Bacteria 1140
194 Ga0157374_10038676 3300013296 Bacteria 4386
195 Ga0157374_10277070 3300013296 Bacteria 1655
196 Ga0157378_10000108 3300013297 Bacteria 78677
197 Ga0157378_10066550 3300013297 Bacteria 3227
198 Ga0163162_10004606 3300013306 Bacteria 13287
199 Ga0163162_10556145 3300013306 Bacteria 1275
200 Ga0157372_10001881 3300013307 Bacteria 22752
201 Ga0157372_10054604 3300013307 Bacteria 4457
202 Ga0157372_10882769 3300013307 Bacteria 1038
203 Ga0157372_11652468 3300013307 Unclassified 737
204 Ga0157375_10004841 3300013308 Bacteria 11697
205 Ga0157375_10025362 3300013308 Bacteria 5507
206 Ga0157375_10356659 3300013308 Bacteria 1628
207 Ga0157375_10764362 3300013308 Bacteria 1117
208 Ga0163163_10011091 3300014325 Bacteria 8156
209 Ga0163163_10108710 3300014325 Bacteria 2800
210 Ga0157380_10465033 3300014326 Bacteria 1219
211 Ga0182008_10123939 3300014497 Bacteria 1285
212 Ga0157377_10010471 3300014745 Bacteria 4588
213 Ga0157379_10041944 3300014968 Bacteria 4084
214 Ga0157379_10052327 3300014968 Bacteria 3648
215 Ga0157376_10004223 3300014969 Bacteria 9965
216 Ga0157376_10077604 3300014969 Bacteria 2841
217 Ga0157376_10142727 3300014969 Bacteria 2150
218 Ga0157376_10282062 3300014969 Bacteria 1565
219 Ga0157376_10295773 3300014969 Bacteria 1530
220 Ga0157376_10767538 3300014969 Bacteria 974
221 Ga0163161_10098394 3300017792 Bacteria 2174
222 Ga0206349_1358819 3300020075 Bacteria 1817
223 Ga0206352_10378737 3300020078 Bacteria 1544
224 Ga0207697_10001908 3300025315 Bacteria 11098
225 Ga0207656_10079487 3300025321 Bacteria 1471
226 Ga0207713_1146827 3300025735 Bacteria 765
227 Ga0207682_10000241 3300025893 Bacteria 24805
228 Ga0207682_10007095 3300025893 Bacteria 4487
229 Ga0207642_10060867 3300025899 Bacteria 1753
230 Ga0207710_10031637 3300025900 Bacteria 2315
231 Ga0207688_10000008 3300025901 Bacteria 62580
232 Ga0207688_10371256 3300025901 Unclassified 884
233 Ga0207680_10018209 3300025903 Bacteria 3728
234 Ga0207647_10001167 3300025904 Bacteria 20250
235 Ga0207647_10009387 3300025904 Bacteria 6953
236 Ga0207685_10016710 3300025905 Bacteria 2354
237 Ga0207699_10054631 3300025906 Bacteria 2373
238 Ga0207699_10170952 3300025906 Unclassified 1454
239 Ga0207699_10363847 3300025906 Bacteria 1023
240 Ga0207699_10387063 3300025906 Bacteria 993
241 Ga0207645_10000916 3300025907 Bacteria 24507
242 Ga0207645_10021747 3300025907 Bacteria 4179
243 Ga0207643_10000008 3300025908 Bacteria 163521
244 Ga0207705_10186709 3300025909 Bacteria 1566
245 Ga0207705_10415816 3300025909 Bacteria 1041
246 Ga0207654_10174371 3300025911 Bacteria 1399
247 Ga0207707_10212327 3300025912 Bacteria 1686
248 Ga0207695_10017830 3300025913 Bacteria 8231
249 Ga0207695_10111922 3300025913 Bacteria 2709
250 Ga0207671_10000632 3300025914 Bacteria 46249
251 Ga0207671_10305283 3300025914 Bacteria 1258
252 Ga0207671_10366155 3300025914 Bacteria 1144
253 Ga0207693_10001005 3300025915 Bacteria 25358
254 Ga0207693_10331138 3300025915 Bacteria 1192
255 Ga0207663_10074949 3300025916 Bacteria 2194
256 Ga0207662_10000012 3300025918 Bacteria 90502
257 Ga0207657_10000094 3300025919 Bacteria 85112
258 Ga0207649_10034851 3300025920 Bacteria 3019
259 Ga0207649_10152363 3300025920 Bacteria 1594
260 Ga0207652_10183431 3300025921 Bacteria 1881
261 Ga0207652_10193728 3300025921 Bacteria 1828
262 Ga0207646_10153518 3300025922 Bacteria 2076
263 Ga0207681_10071530 3300025923 Bacteria 2420
264 Ga0207681_10162361 3300025923 Bacteria 1685
265 Ga0207694_10020282 3300025924 Bacteria 5026
266 Ga0207694_10106768 3300025924 Bacteria 2224
267 Ga0207650_10000222 3300025925 Bacteria 64400
268 Ga0207659_10003839 3300025926 Bacteria 9058
269 Ga0207687_10013124 3300025927 Bacteria 5414
270 Ga0207687_10051198 3300025927 Bacteria 2878
271 Ga0207700_10144482 3300025928 Bacteria 1959
272 Ga0207700_10291934 3300025928 Unclassified 1405
273 Ga0207700_10331625 3300025928 Bacteria 1321
274 Ga0207664_10012297 3300025929 Bacteria 6114
275 Ga0207664_10294241 3300025929 Bacteria 1427
276 Ga0207664_10547811 3300025929 Bacteria 1038
277 Ga0207644_10329791 3300025931 Bacteria 1235
278 Ga0207706_10000118 3300025933 Bacteria 84834
279 Ga0207686_10004622 3300025934 Bacteria 7375
280 Ga0207709_10008983 3300025935 Bacteria 5511
281 Ga0207670_10000003 3300025936 Bacteria 760449
282 Ga0207670_10174254 3300025936 Bacteria 1615
283 Ga0207670_10528820 3300025936 Bacteria 961
284 Ga0207669_10048449 3300025937 Bacteria 2524
285 Ga0207669_10267773 3300025937 Bacteria 1281
286 Ga0207704_10340401 3300025938 Bacteria 1164
287 Ga0207704_10545713 3300025938 Bacteria 941
288 Ga0207665_10068933 3300025939 Bacteria 2411
289 Ga0207665_10282824 3300025939 Bacteria 1235
290 Ga0207691_10000074 3300025940 Bacteria 83272
291 Ga0207691_10448607 3300025940 Bacteria 1098
292 Ga0207711_10002004 3300025941 Bacteria 18410
293 Ga0207711_10011937 3300025941 Bacteria 7221
294 Ga0207711_10126630 3300025941 Bacteria 2285
295 Ga0207711_10755000 3300025941 Bacteria 907
296 Ga0207689_10000093 3300025942 Bacteria 72709
297 Ga0207689_10006188 3300025942 Bacteria 10598
298 Ga0207661_10072782 3300025944 Bacteria 2813
299 Ga0207661_10715085 3300025944 Bacteria 921
300 Ga0207661_10940967 3300025944 Bacteria 796
301 Ga0207679_10020918 3300025945 Bacteria 4425
302 Ga0207667_10066370 3300025949 Bacteria 3761
303 Ga0207667_10182828 3300025949 Bacteria 2152
304 Ga0207667_10356540 3300025949 Bacteria 1491
305 Ga0207651_10002906 3300025960 Bacteria 8274
306 Ga0207712_10156759 3300025961 Bacteria 1765
307 Ga0207668_10015211 3300025972 Bacteria 4775
308 Ga0207668_10029682 3300025972 Bacteria 3586
309 Ga0207640_10141082 3300025981 Bacteria 1756
310 Ga0207640_10268719 3300025981 Bacteria 1333
311 Ga0207658_10214437 3300025986 Bacteria 1615
312 Ga0207677_10026474 3300026023 Bacteria 3638
313 Ga0207677_10065721 3300026023 Bacteria 2532
314 Ga0207703_10000718 3300026035 Bacteria 32659
315 Ga0207703_10009729 3300026035 Bacteria 7545
316 Ga0207639_10063217 3300026041 Bacteria 2865
317 Ga0207639_10462733 3300026041 Bacteria 1153
318 Ga0207678_10015357 3300026067 Bacteria 6736
319 Ga0207678_10091733 3300026067 Bacteria 2597
320 Ga0207708_10004395 3300026075 Bacteria 10386
321 Ga0207702_10306553 3300026078 Bacteria 1508
322 Ga0207641_10020602 3300026088 Bacteria 5418
323 Ga0207641_10371527 3300026088 Bacteria 1367
324 Ga0207641_10526311 3300026088 Bacteria 1150
325 Ga0207641_10607873 3300026088 Bacteria 1071
326 Ga0207648_10002147 3300026089 Bacteria 21437
327 Ga0207676_10513626 3300026095 Bacteria 1139
328 Ga0207676_10897396 3300026095 Bacteria 869
329 Ga0207674_10003577 3300026116 Bacteria 18950
330 Ga0207674_10094570 3300026116 Bacteria 2975
331 Ga0207675_100000008 3300026118 Bacteria 182355
332 Ga0207683_10000629 3300026121 Bacteria 32310
333 Ga0207698_10705619 3300026142 Bacteria 1004
334 Ga0207698_10717180 3300026142 Bacteria 996
335 Ga0207698_10802380 3300026142 Bacteria 943
336 Ga0207428_10104997 3300027907 Bacteria 2179
337 Ga0207428_10508917 3300027907 Bacteria 874
338 Ga0268266_10002198 3300028379 Bacteria 21333
339 Ga0268266_10011322 3300028379 Bacteria 7762
340 Ga0268266_10421327 3300028379 Bacteria 1265
341 Ga0268265_10000207 3300028380 Bacteria 68399
342 Ga0268265_11343510 3300028380 Bacteria 716
343 Ga0268264_10105672 3300028381 Bacteria 2456
344 Ga0268264_10188747 3300028381 Bacteria 1877
345 Ga0268264_10509034 3300028381 Bacteria 1175
346 Ga0265314_10014462 3300031711 Bacteria 6313
347 Ga0307516_10052096 3300031730 Bacteria 4009
348 Ga0307416_100807514 3300032002 Bacteria 1034
349 Ga0373950_0000009 3300034818 Bacteria 379994
350 Ga0373926_0004992 3300035083 Bacteria 4359
351 Ga0373949_0027964 3300035090 Unclassified 1329
352 Ga0373953_0034263 3300035117 Bacteria 1990
353 Ga0373956_0255630 3300035119 Bacteria 833
354 Ga0373943_0068378 3300035170 Bacteria 1793
355 Ga0373955_0005515 3300035172 Bacteria 5688
356 Ga0373955_0035695 3300035172 Bacteria 2634
357 Ga0373962_0205096 3300035242 Bacteria 669
358 Ga0373927_0011220 3300035695 Bacteria 5968
359 Ga0373933_0005053 3300035724 Bacteria 7198
360 Ga0373947_0019601 3300035725 Bacteria 3901
361 Ga0373937_0009778 3300036401 Bacteria 8360
362 Ga0373937_0061666 3300036401 Bacteria 3447
363 Ga0373937_0465890 3300036401 Unclassified 1200
364 Ga0373925_0000115 3300037068 Bacteria 85776
365 Ga0395898_0342462 3300037466 Bacteria 1426
366 Ga0436365_0976712 3300039437 Bacteria 978
367 Ga0451853_2458034 3300041512 Bacteria 846
368 Ga0439448_0031814 3300042005 Bacteria 1677
369 Ga0439464_0187677 3300042439 Unclassified 656
370 Ga0466972_0046779 3300044658 Bacteria 2094
371 Ga0453684_0021955 3300044712 Bacteria 9499
372 Ga0466960_0149125 3300044901 Unclassified 1248
373 Ga0451576_0114396 3300045051 Bacteria 2809
374 Ga0451576_0122385 3300045051 Bacteria 2709
375 Ga0451576_0230653 3300045051 Bacteria 1934
376 Ga0451576_0489787 3300045051 Bacteria 1292
377 Ga0495592_0088677 3300046454 Bacteria 2223
378 Ga0495651_0382441 3300046462 Unclassified 923
379 Ga0495580_0000892 3300046472 Bacteria 25948
380 Ga0495580_0049636 3300046472 Bacteria 2969
381 Ga0495580_0116131 3300046472 Bacteria 1859
382 Ga0495580_0168574 3300046472 Bacteria 1514
383 Ga0495582_0056175 3300046473 Bacteria 2170
384 Ga0495639_0061925 3300046475 Bacteria 1716
385 Ga0495662_0003187 3300046476 Bacteria 8285
386 Ga0495664_0368467 3300046477 Unclassified 864
387 Ga0495594_0169839 3300046499 Bacteria 1241
388 Ga0495628_0413668 3300046516 Bacteria 983
389 Ga0495630_0000001 3300046517 Bacteria 1687293
390 Ga0495630_0188075 3300046517 Bacteria 1575
391 Ga0495666_0071017 3300046526 Bacteria 1655
392 Ga0495652_0046466 3300046529 Bacteria 3728
393 Ga0495665_0376174 3300046531 Bacteria 722
394 Ga0495587_0008908 3300046536 Bacteria 6439
395 Ga0495587_0070936 3300046536 Bacteria 2027
396 Ga0495645_0000477 3300046543 Bacteria 27714
397 Ga0495645_0199419 3300046543 Bacteria 1359
398 Ga0495667_0002140 3300046559 Bacteria 13164
399 Ga0495635_0070774 3300046663 Bacteria 2391
400 Ga0495659_0037739 3300046664 Bacteria 1713
401 Ga0495658_0529159 3300046683 Unclassified 755
402 Ga0495669_0007715 3300046684 Bacteria 4516
403 Ga0495669_0090952 3300046684 Bacteria 1409
404 Ga0495669_0153403 3300046684 Bacteria 1091
405 Ga0495624_0055942 3300046690 Bacteria 2484
406 Ga0495600_0085124 3300046809 Bacteria 2063
407 Ga0495581_0159648 3300047315 Bacteria 1318
408 Ga0495604_0155374 3300047317 Bacteria 1621
409 Ga0495636_0066619 3300047318 Bacteria 1531
410 Ga0495674_0001925 3300047319 Bacteria 20491
411 Ga0495675_0013237 3300047444 Bacteria 5206
412 Ga0495684_0304710 3300047471 Bacteria 1143
413 Ga0495686_0003457 3300047472 Bacteria 13688
414 Ga0495602_0132144 3300048088 Bacteria 1989
415 Ga0495602_0261341 3300048088 Bacteria 1284
416 Ga0495614_0072734 3300048089 Bacteria 1484
417 Ga0496101_0213136 3300048904 Bacteria 1497
418 Ga0496102_0194034 3300048905 Bacteria 1914
419 Ga0496102_0213434 3300048905 Bacteria 1819
420 Ga0496102_0283437 3300048905 Bacteria 1562
421 Ga0496106_0152456 3300048909 Bacteria 1824
422 Ga0496107_0296745 3300048910 Bacteria 1203
423 Ga0496109_0090370 3300048912 Bacteria 2832
424 Ga0496109_0647309 3300048912 Bacteria 994
425 Ga0496111_0296862 3300048914 Bacteria 1198
426 Ga0496112_0020533 3300048915 Bacteria 6263
427 Ga0496112_0063372 3300048915 Bacteria 3646
428 Ga0496112_0378588 3300048915 Bacteria 1356
429 Ga0496112_0479714 3300048915 Bacteria 1180
430 Ga0496113_0174362 3300048916 Bacteria 1704
431 Ga0496113_0209260 3300048916 Bacteria 1552
432 Ga0496114_0099005 3300048917 Bacteria 2487
433 Ga0496115_0417113 3300048918 Bacteria 1088
434 Ga0496115_0913796 3300048918 Bacteria 676
435 Ga0501047_0087717 3300049581 Bacteria 2989
436 Ga0501067_0000001 3300049583 Bacteria 194431
437 Ga0501073_0005854 3300049589 Bacteria 9173
438 Ga0501083_0005842 3300049744 Bacteria 8711
439 nmdc:mga00v17_160883_c1 3300050491 Bacteria 1445
440 nmdc:mga05p37_105660_c1 3300050507 Bacteria 3463
441 nmdc:mga05p37_366953_c1 3300050507 Bacteria 1691
442 nmdc:mga05p37_42616_c1 3300050507 Bacteria 5578
443 nmdc:mga05p37_555781_c1 3300050507 Bacteria 1305
444 nmdc:mga05p37_81_c1 3300050507 Bacteria 84634
445 nmdc:mga0qj67_505399_c1 3300050509 Bacteria 971
446 nmdc:mga06r32_618514_c1 3300050510 Bacteria 1053
447 nmdc:mga08y16_5007_c1 3300050511 Bacteria 13858
448 nmdc:mga0n895_1001897_c1 3300050512 Unclassified 817
449 nmdc:mga0n895_52924_c1 3300050512 Bacteria 3987
450 nmdc:mga0n895_60660_c1 3300050512 Unclassified 3732
451 nmdc:mga0n895_87740_c1 3300050512 Bacteria 3109
452 nmdc:mga0rr50_179799_c1 3300050513 Bacteria 1728
453 nmdc:mga0rr50_378638_c1 3300050513 Bacteria 1193
454 nmdc:mga0rr50_433827_c1 3300050513 Bacteria 1112
455 nmdc:mga0rr50_55090_c1 3300050513 Unclassified 2965
456 nmdc:mga0rr50_61848_c1 3300050513 Bacteria 2822
457 nmdc:mga08x19_19725_c1 3300050514 Bacteria 4142
458 nmdc:mga08x19_435475_c1 3300050514 Bacteria 922
459 nmdc:mga08x19_660101_c1 3300050514 Bacteria 742
460 nmdc:mga08x19_7293_c1 3300050514 Bacteria 6565
461 nmdc:mga0a205_139138_c1 3300050515 Unclassified 2328
462 nmdc:mga0a205_264283_c1 3300050515 Bacteria 1598
463 nmdc:mga0a205_291801_c1 3300050515 Bacteria 1505
464 nmdc:mga0a205_73762_c1 3300050515 Bacteria 3297
465 Ga0495601_0373599 3300053077 Bacteria 926
466 Ga0495619_0195064 3300053085 Bacteria 1402
467 Ga0495619_0217154 3300053085 Bacteria 1324
468 Ga0500555_017942 3300053103 Bacteria 2039
469 Ga0500652_076717 3300053131 Bacteria 1389
470 Ga0500616_0000023 3300053153 Bacteria 456171
471 Ga0500599_001005 3300053736 Bacteria 3166
472 Ga0501084_0089191 3300054114 Bacteria 2589
473 Ga0587082_028350 3300059504 Bacteria 960
474 Ga0587083_0035049 3300059505 Bacteria 1022
475 Ga0587091_005025 3300059511 Bacteria 1776
476 Ga0587128_024189 3300059630 Bacteria 958
477 Ga0587071_042780 3300060344 Bacteria 913
478 Ga0070666_10188642
479 MBSR1b_contig_1299246
480 JGI24743J22301_10057851
481 JGI24744J21845_10036775
482 JGI24751J29686_10054229
483 Ga0058863_10030263
484 Ga0065712_10174373
485 Ga0065715_10105294
486 Ga0065715_10153491
487 Ga0065715_10162419
488 Ga0070658_10018756
489 Ga0070658_10127637
490 Ga0070676_10015445
491 Ga0070676_10505667
492 Ga0070683_100012103
493 Ga0070683_100036189
494 Ga0070683_100043778
495 Ga0070690_100019173
496 Ga0070670_100119388
497 Ga0070670_100689333
498 Ga0070677_10000134
499 Ga0070677_10012674
500 Ga0068869_100017471
501 Ga0068869_100037532
502 Ga0070666_10022300
503 Ga0068868_100018789
504 Ga0068868_100371743
505 Ga0068868_100461011
506 Ga0070660_100072613
507 Ga0070660_100182660
508 Ga0070689_100000014
509 Ga0070689_100006232
510 Ga0070687_100000021
511 Ga0070661_100020661
512 Ga0070661_100194984
513 Ga0070692_10005748
514 Ga0070668_100000879
515 Ga0070669_100131513
516 Ga0070675_100805865
517 Ga0070671_100040296
518 Ga0070674_100001013
519 Ga0070674_100017114
520 Ga0070673_100011305
521 Ga0070688_100037685
522 Ga0070688_100798778
523 Ga0070659_100000146
524 Ga0070667_100044764
525 Ga0070667_100353066
526 Ga0070667_100594578
527 Ga0070709_10128335
528 Ga0070714_100463188
529 Ga0070714_100543060
530 Ga0070713_100031064
531 Ga0070713_100052776
532 Ga0070713_100643861
533 Ga0070711_100002517
534 Ga0070705_100267718
535 Ga0070700_100049693
536 Ga0070663_100008874
537 Ga0070663_100020491
538 Ga0070678_100006771
539 Ga0070678_100437283
540 Ga0070678_100454639
541 Ga0070678_100464813
542 Ga0070662_100005962
543 Ga0070662_100293266
544 Ga0070681_10029603
545 Ga0068867_100011112
546 Ga0070685_10011504
547 Ga0070685_10013134
548 Ga0070707_100164279
549 Ga0070698_100374702
550 Ga0070699_100082356
551 Ga0070699_100104546
552 Ga0070679_100329014
553 Ga0070684_100009454
554 Ga0070684_100077388
555 Ga0070684_100254396
556 Ga0068853_100005291
557 Ga0068853_100286655
558 Ga0070672_100113916
559 Ga0070686_100000971
560 Ga0070695_100178016
561 Ga0070696_100102137
562 Ga0070693_100010383
563 Ga0070693_100092740
564 Ga0070665_100000430
565 Ga0070665_100073677
566 Ga0070704_100150316
567 Ga0068855_100003710
568 Ga0068855_100187408
569 Ga0068855_100498793
570 Ga0068855_100808247
571 Ga0070664_100043728
572 Ga0068857_100010017
573 Ga0068854_100014804
574 Ga0068854_100228693
575 Ga0068856_100028570
576 Ga0068856_100041812
577 Ga0070702_100293666
578 Ga0068852_100015974
579 Ga0068852_100201443
580 Ga0068852_100232297
581 Ga0068859_100061371
582 Ga0068859_100411683
583 Ga0068859_100435260
584 Ga0068864_100135709
585 Ga0068866_10014471
586 Ga0068861_100236589
587 Ga0068851_10009407
588 Ga0068870_10309502
589 Ga0068863_100006060
590 Ga0068863_100040002
591 Ga0068863_100058241
592 Ga0068863_100331365
593 Ga0068858_100006749
594 Ga0068858_100066450
595 Ga0068858_100577112
596 Ga0068860_100006592
597 Ga0068860_100157383
598 Ga0068860_100278045
599 Ga0068862_100065800
600 Ga0070717_10528694
601 Ga0070715_10026732
602 Ga0070716_100028659
603 Ga0070712_100000192
604 Ga0070712_100583007
605 Ga0097621_100001121
606 Ga0097621_100026492
607 Ga0097621_100417419
608 Ga0068871_100000554
609 Ga0068871_100138076
610 Ga0068871_100497234
611 Ga0068871_101092210
612 Ga0075428_100179306
613 Ga0075430_101066349
614 Ga0075433_10243101
615 Ga0075433_10251937
616 Ga0075434_100009621
617 Ga0075434_100033935
618 Ga0075434_100088113
619 Ga0075434_100127831
620 Ga0075434_100140092
621 Ga0075434_100634777
622 Ga0075429_100111929
623 Ga0068865_100015533
624 Ga0075436_100057628
625 Ga0075436_100087342
626 Ga0075436_100103664
627 Ga0097620_100061376
628 Ga0097620_100411719
629 Ga0097620_100435264
630 Ga0075435_100064273
631 Ga0099795_10101317
632 Ga0105250_10068954
633 Ga0105240_10002245
634 Ga0105240_10080962
635 Ga0111539_10012439
636 Ga0105245_10012430
637 Ga0105245_10036304
638 Ga0105247_10077130
639 Ga0114129_10000420
640 Ga0114129_10006204
641 Ga0114129_10338559
642 Ga0105243_10119844
643 Ga0105243_10822241
644 Ga0105241_10029887
645 Ga0105241_10270588
646 Ga0105241_10433111
647 Ga0105242_10155369
648 Ga0105242_10958896
649 Ga0105248_10019515
650 Ga0105248_10257750
651 Ga0105248_10697352
652 Ga0105248_10764225
653 Ga0105237_10000705
654 Ga0105237_10068511
655 Ga0105237_10221662
656 Ga0105237_10240230
657 Ga0105237_10256127
658 Ga0105238_10000349
659 Ga0105238_10035513
660 Ga0105249_10101348
661 Ga0105239_10063197
662 Ga0105239_10204879
663 Ga0105239_10256666
664 Ga0105246_10092326
665 Ga0157373_10001682
666 Ga0157371_10004169
667 Ga0157369_10047291
668 Ga0157369_10061202
669 Ga0157369_10305560
670 Ga0157369_10596541
671 Ga0157374_10038676
672 Ga0157374_10277070
673 Ga0157378_10000108
674 Ga0157378_10066550
675 Ga0163162_10004606
676 Ga0163162_10556145
677 Ga0157372_10001881
678 Ga0157372_10054604
679 Ga0157372_10882769
680 Ga0157372_11652468
681 Ga0157375_10004841
682 Ga0157375_10025362
683 Ga0157375_10356659
684 Ga0157375_10764362
685 Ga0163163_10011091
686 Ga0163163_10108710
687 Ga0157380_10465033
688 Ga0182008_10123939
689 Ga0157377_10010471
690 Ga0157379_10041944
691 Ga0157379_10052327
692 Ga0157376_10004223
693 Ga0157376_10077604
694 Ga0157376_10142727
695 Ga0157376_10282062
696 Ga0157376_10295773
697 Ga0157376_10767538
698 Ga0163161_10098394
699 Ga0206349_1358819
700 Ga0206352_10378737
701 Ga0207697_10001908
702 Ga0207656_10079487
703 Ga0207713_1146827
704 Ga0207682_10000241
705 Ga0207682_10007095
706 Ga0207642_10060867
707 Ga0207710_10031637
708 Ga0207688_10000008
709 Ga0207688_10371256
710 Ga0207680_10018209
711 Ga0207647_10001167
712 Ga0207647_10009387
713 Ga0207685_10016710
714 Ga0207699_10054631
715 Ga0207699_10170952
716 Ga0207699_10363847
717 Ga0207699_10387063
718 Ga0207645_10000916
719 Ga0207645_10021747
720 Ga0207643_10000008
721 Ga0207705_10186709
722 Ga0207705_10415816
723 Ga0207654_10174371
724 Ga0207707_10212327
725 Ga0207695_10017830
726 Ga0207695_10111922
727 Ga0207671_10000632
728 Ga0207671_10305283
729 Ga0207671_10366155
730 Ga0207693_10001005
731 Ga0207693_10331138
732 Ga0207663_10074949
733 Ga0207662_10000012
734 Ga0207657_10000094
735 Ga0207649_10034851
736 Ga0207649_10152363
737 Ga0207652_10183431
738 Ga0207652_10193728
739 Ga0207646_10153518
740 Ga0207681_10071530
741 Ga0207681_10162361
742 Ga0207694_10020282
743 Ga0207694_10106768
744 Ga0207650_10000222
745 Ga0207659_10003839
746 Ga0207687_10013124
747 Ga0207687_10051198
748 Ga0207700_10144482
749 Ga0207700_10291934
750 Ga0207700_10331625
751 Ga0207664_10012297
752 Ga0207664_10294241
753 Ga0207664_10547811
754 Ga0207644_10329791
755 Ga0207706_10000118
756 Ga0207686_10004622
757 Ga0207709_10008983
758 Ga0207670_10000003
759 Ga0207670_10174254
760 Ga0207670_10528820
761 Ga0207669_10048449
762 Ga0207669_10267773
763 Ga0207704_10340401
764 Ga0207704_10545713
765 Ga0207665_10068933
766 Ga0207665_10282824
767 Ga0207691_10000074
768 Ga0207691_10448607
769 Ga0207711_10002004
770 Ga0207711_10011937
771 Ga0207711_10126630
772 Ga0207711_10755000
773 Ga0207689_10000093
774 Ga0207689_10006188
775 Ga0207661_10072782
776 Ga0207661_10715085
777 Ga0207661_10940967
778 Ga0207679_10020918
779 Ga0207667_10066370
780 Ga0207667_10182828
781 Ga0207667_10356540
782 Ga0207651_10002906
783 Ga0207712_10156759
784 Ga0207668_10015211
785 Ga0207668_10029682
786 Ga0207640_10141082
787 Ga0207640_10268719
788 Ga0207658_10214437
789 Ga0207677_10026474
790 Ga0207677_10065721
791 Ga0207703_10000718
792 Ga0207703_10009729
793 Ga0207639_10063217
794 Ga0207639_10462733
795 Ga0207678_10015357
796 Ga0207678_10091733
797 Ga0207708_10004395
798 Ga0207702_10306553
799 Ga0207641_10020602
800 Ga0207641_10371527
801 Ga0207641_10526311
802 Ga0207641_10607873
803 Ga0207648_10002147
804 Ga0207676_10513626
805 Ga0207676_10897396
806 Ga0207674_10003577
807 Ga0207674_10094570
808 Ga0207675_100000008
809 Ga0207683_10000629
810 Ga0207698_10705619
811 Ga0207698_10717180
812 Ga0207698_10802380
813 Ga0207428_10104997
814 Ga0207428_10508917
815 Ga0268266_10002198
816 Ga0268266_10011322
817 Ga0268266_10421327
818 Ga0268265_10000207
819 Ga0268265_11343510
820 Ga0268264_10105672
821 Ga0268264_10188747
822 Ga0268264_10509034
823 Ga0265314_10014462
824 Ga0307516_10052096
825 Ga0307416_100807514
826 Ga0373950_0000009
827 Ga0373926_0004992
828 Ga0373949_0027964
829 Ga0373953_0034263
830 Ga0373956_0255630
831 Ga0373943_0068378
832 Ga0373955_0005515
833 Ga0373955_0035695
834 Ga0373962_0205096
835 Ga0373927_0011220
836 Ga0373933_0005053
837 Ga0373947_0019601
838 Ga0373937_0009778
839 Ga0373937_0061666
840 Ga0373937_0465890
841 Ga0373925_0000115
842 Ga0395898_0342462
843 Ga0436365_0976712
844 Ga0451853_2458034
845 Ga0439448_0031814
846 Ga0439464_0187677
847 Ga0466972_0046779
848 Ga0453684_0021955
849 Ga0466960_0149125
850 Ga0451576_0114396
851 Ga0451576_0122385
852 Ga0451576_0230653
853 Ga0451576_0489787
854 Ga0495592_0088677
855 Ga0495651_0382441
856 Ga0495580_0000892
857 Ga0495580_0049636
858 Ga0495580_0116131
859 Ga0495580_0168574
860 Ga0495582_0056175
861 Ga0495639_0061925
862 Ga0495662_0003187
863 Ga0495664_0368467
864 Ga0495594_0169839
865 Ga0495628_0413668
866 Ga0495630_0000001
867 Ga0495630_0188075
868 Ga0495666_0071017
869 Ga0495652_0046466
870 Ga0495665_0376174
871 Ga0495587_0008908
872 Ga0495587_0070936
873 Ga0495645_0000477
874 Ga0495645_0199419
875 Ga0495667_0002140
876 Ga0495635_0070774
877 Ga0495659_0037739
878 Ga0495658_0529159
879 Ga0495669_0007715
880 Ga0495669_0090952
881 Ga0495669_0153403
882 Ga0495624_0055942
883 Ga0495600_0085124
884 Ga0495581_0159648
885 Ga0495604_0155374
886 Ga0495636_0066619
887 Ga0495674_0001925
888 Ga0495675_0013237
889 Ga0495684_0304710
890 Ga0495686_0003457
891 Ga0495602_0132144
892 Ga0495602_0261341
893 Ga0495614_0072734
894 Ga0496101_0213136
895 Ga0496102_0194034
896 Ga0496102_0213434
897 Ga0496102_0283437
898 Ga0496106_0152456
899 Ga0496107_0296745
900 Ga0496109_0090370
901 Ga0496109_0647309
902 Ga0496111_0296862
903 Ga0496112_0020533
904 Ga0496112_0063372
905 Ga0496112_0378588
906 Ga0496112_0479714
907 Ga0496113_0174362
908 Ga0496113_0209260
909 Ga0496114_0099005
910 Ga0496115_0417113
911 Ga0496115_0913796
912 Ga0501047_0087717
913 Ga0501067_0000001
914 Ga0501073_0005854
915 Ga0501083_0005842
916 nmdc:mga00v17_160883_c1
917 nmdc:mga05p37_105660_c1
918 nmdc:mga05p37_366953_c1
919 nmdc:mga05p37_42616_c1
920 nmdc:mga05p37_555781_c1
921 nmdc:mga05p37_81_c1
922 nmdc:mga0qj67_505399_c1
923 nmdc:mga06r32_618514_c1
924 nmdc:mga08y16_5007_c1
925 nmdc:mga0n895_1001897_c1
926 nmdc:mga0n895_52924_c1
927 nmdc:mga0n895_60660_c1
928 nmdc:mga0n895_87740_c1
929 nmdc:mga0rr50_179799_c1
930 nmdc:mga0rr50_378638_c1
931 nmdc:mga0rr50_433827_c1
932 nmdc:mga0rr50_55090_c1
933 nmdc:mga0rr50_61848_c1
934 nmdc:mga08x19_19725_c1
935 nmdc:mga08x19_435475_c1
936 nmdc:mga08x19_660101_c1
937 nmdc:mga08x19_7293_c1
938 nmdc:mga0a205_139138_c1
939 nmdc:mga0a205_264283_c1
940 nmdc:mga0a205_291801_c1
941 nmdc:mga0a205_73762_c1
942 Ga0495601_0373599
943 Ga0495619_0195064
944 Ga0495619_0217154
945 Ga0500555_017942
946 Ga0500652_076717
947 Ga0500616_0000023
948 Ga0500599_001005
949 Ga0501084_0089191
950 Ga0587082_028350
951 Ga0587083_0035049
952 Ga0587091_005025
953 Ga0587128_024189
954 Ga0587071_042780

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

8

136

0.81

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

33

146

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
8es5-assembly1.cif.gz_B aha1 domain protein from pseudomonas aeruginosa 0.8535 25 146
3neg-assembly2.cif.gz_B pyrabactin-bound pyl1 structure in the open and close forms 0.8045 18 147
3q6a-assembly1.cif.gz_D x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.802 25 154
3ijt-assembly1.cif.gz_A structural characterization of smu.440, a hypothetical protein from streptococcus mutans 0.8012 22 145
3pu2-assembly5.cif.gz_E crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.7989 15 147
ID Description Score Start End Superfamily
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8238 22 147 3.30.530.20
af_A0A1D6HQJ5_8_161_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8172 21 139 3.30.530.20
af_P9WL87_17_165_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.806 25 147 3.30.530.20
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8059 25 145 3.30.530.20
1oysA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain 0.8005 15 36 3.30.230.70
ID Description Score Start End GO Terms
AF-A0A3N5H1A8-F1-model_v4 SRPBCC family protein 0.9858 1 177
AF-A0A3N5H1A8-F1-model_v4 SRPBCC family protein 0.9802 1 177
AF-A0A2N7VIV1-F1-model_v4 Polyketide cyclase 0.9797 1 177
AF-A0A2V9XQP2-F1-model_v4 Polyketide cyclase 0.9757 1 180
AF-A0A7R8GC65-F1-model_v4 deleted 0.9746 1 178

Map