F451618

General Info

Members Datasets Scaffolds Average Seq Length
476 310 952 380

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2870721527|2870724251
Length 411
Sequence QDLVLTAPRPRTPTPHPDQHRTPTSEERTALKITAVETFLVPPRWLFCRVSTDEGVTGWGEPVVEGRAETVRTAVAELSDLLVGADPGRIEDLWQLMTKSAFYRGGPVLSSAAAGIDQALWDILGKSLGVPVHQLLGGAVRDRVRVYGWIGGDEPAEVADAAAAQVAAGLTAVKVNASGRMSPVPTRAETAAVVDRVAAVREVIGDDRDVAVDFHGRFTTAAALRVLPELAPLHPLFVEEPVLPEHRERLADVVRASPVPIACGERLYSRADFLPALRAGVAVVQPDLSHAGGISEVRRIASLAEVHDALLAPHCPLGPIALAASLQVAFATPNFLIQEQSIGIHYNTGTELLDYVLDRAPFTFHDGAVRRWDAPGLGIEVDEDAVRRADAVGHRWRPPVWRHADGSFAEW

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
67 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
68 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
69 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
70 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
71 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
74 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
75 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
76 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
77 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
84 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
87 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
97 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
98 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
105 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
106 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
107 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
108 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
109 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
110 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
145 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
146 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
150 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
158 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
162 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
205 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
209 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
210 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
211 2558860280 Kutzneria sp. 744 Isolate Unclassified
212 2582580736 Prauserella sp. Am3 Isolate Unclassified
213 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
214 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
215 2643221679 Angustibacter sp. Root456 Isolate Unclassified
216 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
217 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
218 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
219 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
220 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
221 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
222 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
223 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
224 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
225 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
226 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
227 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
228 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
229 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
230 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
231 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
232 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
233 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
234 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
235 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
236 2858868258 Micromonospora sp. MH33 Isolate Unclassified
237 2858882152 Micromonospora noduli MED15 Isolate Nodule
238 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
239 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
240 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
241 2862574272 Streptomyces sp. AcE210 Isolate Nodule
242 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
243 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
244 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
245 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
246 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
247 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
248 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
249 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
250 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
251 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
252 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
253 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
254 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
255 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
256 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
257 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
258 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
259 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
260 2902582711 Micromonospora sp. AP08 Isolate Unclassified
261 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
262 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
263 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
264 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
265 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
266 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
267 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
268 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
269 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
270 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
271 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
272 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
273 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
274 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
275 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
276 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
277 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
278 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
279 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
280 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
281 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
282 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
283 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
284 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
285 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
286 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
287 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
288 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
289 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
290 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
291 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
292 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
293 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
294 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
295 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
296 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
297 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
298 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
299 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
300 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
301 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
302 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
303 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
304 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
305 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
306 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
307 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
308 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
309 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
310 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.48
Metatranscriptomes 0.21
Isolates 27.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 2.52
Rhizoplane 1.47
Rhizosphere 70.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1001876 3300000549 Bacteria 3049
2 JGI24739J22299_10001818 3300001989 Bacteria 8134
3 JGI24737J22298_10003224 3300001990 Bacteria 5791
4 JGI24737J22298_10018014 3300001990 Bacteria 2270
5 JGI24735J21928_10000175 3300002067 Bacteria 22763
6 JGI24735J21928_10027089 3300002067 Bacteria 1719
7 JGI25156J39149_1002569 3300002705 Bacteria 6431
8 JGI25162J39368_1000734 3300002737 Bacteria 22511
9 JGI25406J46586_10005865 3300003203 Bacteria 5683
10 JGI25406J46586_10009143 3300003203 Bacteria 4445
11 rootH2_10121278 3300003320 Bacteria 9181
12 Ga0070668_100058083 3300005347 Bacteria 2992
13 Ga0070659_100065866 3300005366 Bacteria 2870
14 Ga0070714_100000014 3300005435 Bacteria 210194
15 Ga0070714_100000344 3300005435 Bacteria 34967
16 Ga0070714_100001573 3300005435 Bacteria 16605
17 Ga0070713_100004590 3300005436 Bacteria 9304
18 Ga0070705_100106311 3300005440 Bacteria 1783
19 Ga0070706_100023182 3300005467 Bacteria 5717
20 Ga0070698_100027782 3300005471 Bacteria 5880
21 Ga0070698_100151920 3300005471 Bacteria 2263
22 Ga0070698_100239141 3300005471 Bacteria 1749
23 Ga0068853_100002376 3300005539 Bacteria 14067
24 Ga0070696_100009959 3300005546 Bacteria 6359
25 Ga0070665_100024610 3300005548 Bacteria 6067
26 Ga0070665_100107636 3300005548 Bacteria 2790
27 Ga0068855_100015466 3300005563 Bacteria 9187
28 Ga0068857_100029894 3300005577 Bacteria 4808
29 Ga0068854_100002779 3300005578 Bacteria 10868
30 Ga0070702_100016360 3300005615 Bacteria 3804
31 Ga0068852_100039345 3300005616 Bacteria 3981
32 Ga0068863_100334166 3300005841 Bacteria 1473
33 Ga0081455_10001247 3300005937 Bacteria 31823
34 Ga0081455_10033728 3300005937 Bacteria 4596
35 Ga0081540_1002813 3300005983 Bacteria 14088
36 Ga0081539_10000692 3300005985 Bacteria 67584
37 Ga0081539_10002101 3300005985 Bacteria 29682
38 Ga0070712_100053074 3300006175 Bacteria 2829
39 Ga0075428_100000121 3300006844 Bacteria 67666
40 Ga0075428_100002336 3300006844 Bacteria 20584
41 Ga0075430_100273694 3300006846 Bacteria 1397
42 Ga0075431_100077182 3300006847 Bacteria 3438
43 Ga0075429_100009716 3300006880 Bacteria 8339
44 Ga0068865_100262706 3300006881 Bacteria 1367
45 Ga0068865_100288897 3300006881 Bacteria 1308
46 Ga0105240_10274701 3300009093 Bacteria 1939
47 Ga0114129_10000915 3300009147 Bacteria 38462
48 Ga0114129_10181602 3300009147 Bacteria 2862
49 Ga0105243_10011362 3300009148 Bacteria 6739
50 Ga0105241_10051604 3300009174 Bacteria 3137
51 Ga0105237_10086767 3300009545 Bacteria 3120
52 Ga0105238_10113599 3300009551 Bacteria 2688
53 Ga0105249_10028747 3300009553 Bacteria 5018
54 Ga0105246_10069139 3300011119 Bacteria 2479
55 Ga0157369_10022309 3300013105 Bacteria 7067
56 Ga0157369_10074047 3300013105 Bacteria 3652
57 Ga0157369_10152811 3300013105 Bacteria 2440
58 Ga0157369_10269329 3300013105 Bacteria 1775
59 Ga0157375_10028635 3300013308 Bacteria 5226
60 Ga0157375_10579469 3300013308 Bacteria 1282
61 Ga0206353_11929097 3300020082 Bacteria 2853
62 Ga0213875_10028821 3300021388 Bacteria 2634
63 Ga0209148_1002618 3300025254 Bacteria 5878
64 Ga0207426_1019843 3300025302 Bacteria 2344
65 Ga0207647_10005481 3300025904 Bacteria 9289
66 Ga0207647_10009404 3300025904 Bacteria 6945
67 Ga0207684_10058390 3300025910 Bacteria 3274
68 Ga0207654_10005285 3300025911 Bacteria 6519
69 Ga0207695_10023783 3300025913 Bacteria 6915
70 Ga0207671_10000557 3300025914 Bacteria 50180
71 Ga0207693_10042585 3300025915 Bacteria 3574
72 Ga0207663_10156664 3300025916 Bacteria 1603
73 Ga0207694_10011483 3300025924 Bacteria 6685
74 Ga0207694_10033845 3300025924 Bacteria 3916
75 Ga0207700_10020952 3300025928 Bacteria 4453
76 Ga0207700_10052537 3300025928 Bacteria 3047
77 Ga0207664_10000001 3300025929 Bacteria 724213
78 Ga0207664_10003655 3300025929 Bacteria 10302
79 Ga0207664_10005369 3300025929 Bacteria 8757
80 Ga0207709_10024941 3300025935 Bacteria 3420
81 Ga0207704_10127113 3300025938 Bacteria 1757
82 Ga0207667_10088535 3300025949 Bacteria 3201
83 Ga0207668_10006760 3300025972 Bacteria 6787
84 Ga0207640_10022455 3300025981 Bacteria 3777
85 Ga0207640_10048160 3300025981 Bacteria 2754
86 Ga0207674_10072788 3300026116 Bacteria 3451
87 Ga0207698_10107917 3300026142 Bacteria 2325
88 Ga0268266_10013973 3300028379 Bacteria 6913
89 Ga0268266_10051427 3300028379 Bacteria 3537
90 Ga0265337_1001219 3300028556 Bacteria 13053
91 Ga0265326_10002612 3300028558 Bacteria 6042
92 Ga0265319_1001863 3300028563 Bacteria 12012
93 Ga0265334_10000584 3300028573 Bacteria 18572
94 Ga0265323_10014126 3300028653 Bacteria 3169
95 Ga0307515_10000025 3300028794 Bacteria 390205
96 Ga0307515_10000038 3300028794 Bacteria 331376
97 Ga0307515_10014026 3300028794 Bacteria 14909
98 Ga0307515_10019990 3300028794 Bacteria 11992
99 Ga0307515_10094132 3300028794 Bacteria 3704
100 Ga0265338_10001059 3300028800 Bacteria 45752
101 Ga0265324_10015416 3300029957 Bacteria 2811
102 Ga0307511_10000318 3300030521 Bacteria 51352
103 Ga0307511_10003892 3300030521 Bacteria 15247
104 Ga0307511_10082573 3300030521 Bacteria 2246
105 Ga0307512_10004326 3300030522 Bacteria 15668
106 Ga0307512_10020661 3300030522 Bacteria 5950
107 Ga0307512_10034030 3300030522 Bacteria 4368
108 Ga0314311_1193819 3300030733 Bacteria 4423
109 Ga0265325_10069864 3300031241 Bacteria 1765
110 Ga0265340_10003782 3300031247 Bacteria 8524
111 Ga0265316_10051353 3300031344 Bacteria 3239
112 Ga0307513_10001429 3300031456 Bacteria 34323
113 Ga0307513_10014515 3300031456 Bacteria 9606
114 Ga0307513_10032246 3300031456 Bacteria 5911
115 Ga0307513_10117273 3300031456 Bacteria 2640
116 Ga0307509_10001655 3300031507 Bacteria 37324
117 Ga0307509_10008109 3300031507 Bacteria 13479
118 Ga0307509_10012771 3300031507 Bacteria 10003
119 Ga0307509_10022006 3300031507 Bacteria 7197
120 Ga0307509_10031060 3300031507 Bacteria 5902
121 Ga0307509_10066513 3300031507 Bacteria 3781
122 Ga0307408_100023659 3300031548 Bacteria 4188
123 Ga0307508_10023193 3300031616 Bacteria 5637
124 Ga0307508_10024244 3300031616 Bacteria 5505
125 Ga0307508_10030845 3300031616 Bacteria 4844
126 Ga0307514_10001752 3300031649 Bacteria 24778
127 Ga0307514_10123517 3300031649 Bacteria 1799
128 Ga0265342_10006457 3300031712 Bacteria 8731
129 Ga0316576_10124774 3300031727 Bacteria 1934
130 Ga0307516_10001112 3300031730 Bacteria 37452
131 Ga0307516_10004936 3300031730 Bacteria 16220
132 Ga0307516_10025913 3300031730 Bacteria 5962
133 Ga0307516_10080691 3300031730 Bacteria 3097
134 Ga0307516_10084690 3300031730 Bacteria 3009
135 Ga0307516_10163947 3300031730 Bacteria 1970
136 Ga0307516_10172164 3300031730 Bacteria 1905
137 Ga0307516_10182599 3300031730 Bacteria 1830
138 Ga0307405_10040252 3300031731 Bacteria 2829
139 Ga0307405_10100811 3300031731 Bacteria 1936
140 Ga0307405_10144371 3300031731 Bacteria 1664
141 Ga0307410_10006840 3300031852 Bacteria 6195
142 Ga0307410_10041130 3300031852 Bacteria 3046
143 Ga0307406_10095366 3300031901 Bacteria 2013
144 Ga0307407_10043670 3300031903 Bacteria 2521
145 Ga0307407_10082092 3300031903 Bacteria 1952
146 Ga0307412_10025825 3300031911 Bacteria 3643
147 Ga0307412_10141751 3300031911 Bacteria 1761
148 Ga0307409_100010061 3300031995 Bacteria 5852
149 Ga0307409_100090061 3300031995 Bacteria 2510
150 Ga0307409_100118478 3300031995 Bacteria 2236
151 Ga0307409_100221346 3300031995 Bacteria 1709
152 Ga0307416_100084297 3300032002 Bacteria 2700
153 Ga0307416_100280473 3300032002 Bacteria 1642
154 Ga0307411_10224830 3300032005 Bacteria 1459
155 Ga0307507_10025503 3300033179 Bacteria 6411
156 Ga0307507_10040862 3300033179 Bacteria 4651
157 Ga0307507_10044417 3300033179 Bacteria 4393
158 Ga0307507_10103348 3300033179 Bacteria 2371
159 Ga0307510_10022010 3300033180 Bacteria 7412
160 Ga0307510_10058582 3300033180 Bacteria 3986
161 Ga0307510_10121589 3300033180 Bacteria 2314
162 Ga0307510_10126296 3300033180 Bacteria 2246
163 Ga0307510_10158752 3300033180 Bacteria 1863
164 Ga0316584_0097212 3300036712 Bacteria 2204
165 Ga0395899_0022028 3300037312 Bacteria 4832
166 Ga0395899_0047648 3300037312 Bacteria 3190
167 Ga0395900_0005080 3300037418 Bacteria 13808
168 Ga0395898_0008948 3300037466 Bacteria 10543
169 Ga0395898_0048499 3300037466 Bacteria 4164
170 Ga0436364_0354007 3300037853 Bacteria 10903
171 Ga0395901_0049212 3300038443 Bacteria 4379
172 Ga0395901_0103128 3300038443 Bacteria 2993
173 Ga0395901_0159278 3300038443 Bacteria 2370
174 Ga0395901_0159302 3300038443 Bacteria 2370
175 Ga0439439_0000242 3300041406 Bacteria 8551
176 Ga0439466_0011200 3300041411 Bacteria 3320
177 Ga0439449_0006125 3300042007 Bacteria 4595
178 Ga0439457_005174 3300042014 Bacteria 3311
179 Ga0450903_000740 3300042138 Bacteria 6452
180 Ga0466982_0000044 3300044672 Bacteria 38923
181 Ga0466965_0083442 3300044683 Bacteria 1617
182 Ga0466966_0002676 3300044684 Bacteria 11672
183 Ga0466966_0011906 3300044684 Bacteria 5764
184 Ga0466966_0074173 3300044684 Bacteria 2127
185 Ga0466961_0006463 3300044693 Bacteria 7444
186 Ga0466961_0078559 3300044693 Bacteria 2090
187 Ga0466963_0291400 3300044694 Bacteria 1147
188 Ga0466964_0022707 3300044706 Bacteria 2436
189 Ga0466971_0011239 3300044719 Bacteria 3922
190 Ga0466968_0008215 3300044735 Bacteria 3992
191 Ga0466970_0019986 3300044765 Bacteria 3476
192 Ga0466970_0022274 3300044765 Bacteria 3307
193 Ga0466970_0032388 3300044765 Bacteria 2762
194 Ga0466970_0152004 3300044765 Bacteria 1278
195 Ga0466960_0051378 3300044901 Bacteria 1991
196 Ga0466959_0000777 3300045049 Bacteria 18701
197 Ga0466967_0000584 3300045976 Bacteria 18008
198 Ga0466967_0004326 3300045976 Bacteria 9551
199 Ga0466967_0148115 3300045976 Bacteria 2191
200 Ga0495592_0042597 3300046454 Bacteria 3399
201 Ga0495603_0014562 3300046455 Bacteria 4757
202 Ga0495629_0004590 3300046459 Bacteria 10335
203 Ga0495629_0023473 3300046459 Bacteria 4395
204 Ga0495629_0084634 3300046459 Bacteria 2213
205 Ga0495651_0000294 3300046462 Bacteria 38829
206 Ga0495651_0009436 3300046462 Bacteria 7494
207 Ga0495580_0012786 3300046472 Bacteria 6433
208 Ga0495582_0012684 3300046473 Bacteria 4645
209 Ga0495582_0014781 3300046473 Bacteria 4288
210 Ga0495662_0009119 3300046476 Bacteria 4868
211 Ga0495662_0085224 3300046476 Bacteria 1538
212 Ga0495664_0049455 3300046477 Bacteria 2496
213 Ga0495585_0036371 3300046492 Bacteria 2777
214 Ga0495594_0004476 3300046499 Bacteria 7183
215 Ga0495594_0011457 3300046499 Bacteria 4609
216 Ga0495583_0023834 3300046506 Bacteria 3087
217 Ga0495606_0000951 3300046507 Bacteria 42598
218 Ga0495618_0115152 3300046514 Bacteria 1721
219 Ga0495628_0004514 3300046516 Bacteria 12333
220 Ga0495628_0037183 3300046516 Bacteria 3904
221 Ga0495652_0001934 3300046529 Bacteria 22030
222 Ga0495652_0108516 3300046529 Bacteria 2237
223 Ga0495640_0002386 3300046533 Bacteria 15082
224 Ga0495586_0020652 3300046535 Bacteria 3508
225 Ga0495586_0022759 3300046535 Bacteria 3344
226 Ga0495586_0079484 3300046535 Bacteria 1800
227 Ga0495587_0113436 3300046536 Bacteria 1555
228 Ga0495667_0063569 3300046559 Bacteria 2415
229 Ga0495668_0000382 3300046616 Bacteria 58410
230 Ga0495634_0003397 3300046642 Bacteria 12782
231 Ga0495634_0020616 3300046642 Bacteria 4672
232 Ga0495625_0050857 3300046660 Bacteria 2972
233 Ga0495625_0130453 3300046660 Bacteria 1703
234 Ga0495635_0000842 3300046663 Bacteria 20072
235 Ga0495635_0000865 3300046663 Bacteria 19865
236 Ga0495657_0017111 3300046675 Bacteria 5269
237 Ga0495657_0032406 3300046675 Bacteria 3646
238 Ga0495623_0031389 3300046679 Bacteria 3416
239 Ga0495646_0012443 3300046680 Bacteria 5410
240 Ga0495613_0000816 3300046689 Bacteria 24137
241 Ga0495613_0006869 3300046689 Bacteria 8497
242 Ga0495670_0056580 3300046691 Bacteria 1968
243 Ga0495671_0055789 3300046692 Bacteria 1957
244 Ga0495589_0013840 3300046794 Bacteria 4160
245 Ga0495589_0026683 3300046794 Bacteria 2925
246 Ga0495600_0029275 3300046809 Bacteria 3565
247 Ga0495600_0030796 3300046809 Bacteria 3475
248 Ga0495604_0088365 3300047317 Bacteria 2305
249 Ga0495636_0014068 3300047318 Bacteria 3180
250 Ga0495676_0004497 3300047321 Bacteria 12744
251 Ga0495676_0020472 3300047321 Bacteria 5802
252 Ga0495676_0045978 3300047321 Bacteria 3548
253 Ga0495676_0050322 3300047321 Bacteria 3342
254 Ga0495676_0051613 3300047321 Bacteria 3288
255 Ga0495687_002104 3300047443 Bacteria 16693
256 Ga0495687_002760 3300047443 Bacteria 13605
257 Ga0495675_0072496 3300047444 Bacteria 2172
258 Ga0495685_002166 3300047447 Bacteria 6100
259 Ga0495685_003507 3300047447 Bacteria 5007
260 Ga0495681_0011494 3300047470 Bacteria 5268
261 Ga0495593_0012630 3300047673 Bacteria 4824
262 Ga0495602_0054986 3300048088 Bacteria 3509
263 Ga0495614_0003573 3300048089 Bacteria 6966
264 Ga0495626_0000069 3300048091 Bacteria 139104
265 Ga0496103_0039931 3300048906 Bacteria 2884
266 Ga0496106_0047315 3300048909 Bacteria 3237
267 Ga0496108_0221947 3300048911 Bacteria 1642
268 Ga0496109_0100768 3300048912 Bacteria 2680
269 Ga0496113_0107701 3300048916 Bacteria 2166
270 Ga0496126_0003046 3300048929 Bacteria 21722
271 Ga0501031_0009053 3300049568 Bacteria 6475
272 Ga0501031_0028498 3300049568 Bacteria 3640
273 Ga0501031_0041873 3300049568 Bacteria 2990
274 Ga0501031_0098217 3300049568 Bacteria 1911
275 Ga0501032_0009925 3300049569 Bacteria 6875
276 Ga0501032_0016676 3300049569 Bacteria 5162
277 Ga0501032_0023687 3300049569 Bacteria 4239
278 Ga0501032_0033401 3300049569 Bacteria 3525
279 Ga0501032_0033634 3300049569 Bacteria 3512
280 Ga0501033_0009778 3300049570 Bacteria 7366
281 Ga0501033_0043983 3300049570 Bacteria 3324
282 Ga0501034_0007992 3300049571 Bacteria 11228
283 Ga0501034_0061408 3300049571 Bacteria 3773
284 Ga0501034_0086079 3300049571 Bacteria 3144
285 Ga0501034_0129923 3300049571 Bacteria 2503
286 Ga0501036_0005256 3300049572 Bacteria 10474
287 Ga0501036_0007395 3300049572 Bacteria 8948
288 Ga0501036_0155360 3300049572 Bacteria 1929
289 Ga0501037_0003898 3300049573 Bacteria 10826
290 Ga0501037_0041602 3300049573 Bacteria 3379
291 Ga0501038_0014032 3300049574 Bacteria 7301
292 Ga0501038_0034495 3300049574 Bacteria 4448
293 Ga0501038_0041467 3300049574 Bacteria 4014
294 Ga0501038_0069044 3300049574 Bacteria 3003
295 Ga0501038_0141691 3300049574 Bacteria 1966
296 Ga0501039_0004422 3300049575 Bacteria 10609
297 Ga0501039_0024537 3300049575 Bacteria 4632
298 Ga0501041_0008433 3300049577 Bacteria 6062
299 Ga0501041_0025728 3300049577 Bacteria 3537
300 Ga0501042_0029071 3300049578 Bacteria 3898
301 Ga0501043_0013274 3300049579 Bacteria 6440
302 Ga0501043_0038230 3300049579 Bacteria 3773
303 Ga0501046_0020117 3300049580 Bacteria 5525
304 Ga0501046_0057885 3300049580 Bacteria 3040
305 Ga0501046_0196326 3300049580 Bacteria 1503
306 Ga0501047_0005724 3300049581 Bacteria 11696
307 Ga0501047_0137032 3300049581 Bacteria 2328
308 Ga0501048_0010789 3300049582 Bacteria 6811
309 Ga0501048_0041602 3300049582 Bacteria 3290
310 Ga0501048_0137775 3300049582 Bacteria 1725
311 Ga0501067_0042137 3300049583 Bacteria 2534
312 Ga0501068_0003852 3300049584 Bacteria 8143
313 Ga0501068_0197306 3300049584 Bacteria 1276
314 Ga0501070_0024287 3300049586 Bacteria 5083
315 Ga0501070_0208005 3300049586 Bacteria 1607
316 Ga0501071_0004809 3300049587 Bacteria 8599
317 Ga0501074_0047675 3300049590 Bacteria 3096
318 Ga0501075_0023105 3300049591 Bacteria 4550
319 Ga0501076_0003171 3300049592 Bacteria 11468
320 Ga0501076_0005835 3300049592 Bacteria 8881
321 Ga0501077_0013209 3300049593 Bacteria 5175
322 Ga0501079_0056051 3300049741 Bacteria 3041
323 Ga0501081_0077680 3300049743 Bacteria 2320
324 Ga0501083_0005106 3300049744 Bacteria 9295
325 Ga0501035_0006021 3300049822 Bacteria 11418
326 Ga0501035_0010142 3300049822 Bacteria 8742
327 Ga0501044_0002140 3300049823 Bacteria 22629
328 Ga0501044_0002152 3300049823 Bacteria 22602
329 Ga0501044_0002645 3300049823 Bacteria 20386
330 Ga0501044_0067265 3300049823 Bacteria 3651
331 Ga0501044_0141696 3300049823 Bacteria 2392
332 Ga0501044_0223306 3300049823 Bacteria 1834
333 Ga0501045_0009164 3300049824 Bacteria 6916
334 Ga0501045_0191054 3300049824 Bacteria 1526
335 nmdc:mga05p37_25136_c1 3300050507 Bacteria 7243
336 nmdc:mga09592_44339_c1 3300050508 Bacteria 3744
337 nmdc:mga0qj67_8649_c1 3300050509 Bacteria 7553
338 nmdc:mga06r32_75862_c1 3300050510 Bacteria 3264
339 Ga0495601_0001936 3300053077 Bacteria 11584
340 Ga0495601_0059536 3300053077 Bacteria 2422
341 Ga0495612_0004987 3300053078 Bacteria 5495
342 Ga0495619_0024016 3300053085 Bacteria 3910
343 Ga0500559_0001603 3300053136 Bacteria 12591
344 Ga0500577_0020412 3300053142 Bacteria 2166
345 Ga0501084_0007435 3300054114 Bacteria 9031
346 Ga0501082_0003076 3300060353 Bacteria 14555
347 2870724251 2870721527 Bacteria 9689237
348 2547405855 2547132111 Bacteria 8013147
349 2558905998 2558860112 Bacteria 9931328
350 2559423788 2558860280 Bacteria 11429938
351 2583150039 2582580736 Bacteria 5325865
352 2623586887 2622736626 Bacteria 7181580
353 2623589147 2622736626 Bacteria 7181580
354 2644182745 2643221632 Bacteria 3406696
355 2644444768 2643221679 Bacteria 3839507
356 2676480917 2675903059 Bacteria 8644972
357 2676495328 2675903060 Bacteria 10051191
358 2691512361 2690315906 Bacteria 4517044
359 2775657821 2775506735 Bacteria 4556596
360 2776373756 2775506925 Bacteria 7237746
361 2793979319 2791355406 Bacteria 11364898
362 2795782259 2795385470 Bacteria 8317180
363 2808829586 2808606357 Bacteria 4466944
364 2808850757 2808606360 Bacteria 4404006
365 2808876712 2808606366 Bacteria 4415912
366 2808893575 2808606370 Bacteria 4942454
367 2808898224 2808606371 Bacteria 4251511
368 2812318716 2811994871 Bacteria 4497550
369 2816426901 2816332119 Bacteria 8120218
370 2819699154 2818991463 Bacteria 7948711
371 2831936177 2831935698 Bacteria 5963223
372 2855670977 2855670206 Bacteria 7120389
373 2855672112 2855670206 Bacteria 7120389
374 2855681206 2855676851 Bacteria 7063653
375 2855682842 2855676851 Bacteria 7063653
376 2857294054 2857288857 Bacteria 7189066
377 2857294695 2857288857 Bacteria 7189066
378 2858851786 2858848962 Bacteria 6963058
379 2858854361 2858848962 Bacteria 6963058
380 2858869556 2858868258 Bacteria 7683772
381 2858882717 2858882152 Bacteria 7230291
382 2858888419 2858882152 Bacteria 7230291
383 2858891723 2858888857 Bacteria 7060307
384 2858894890 2858888857 Bacteria 7060307
385 2858899182 2858895516 Bacteria 7378898
386 2858899895 2858895516 Bacteria 7378898
387 2862292803 2862290372 Bacteria 7471434
388 2862582627 2862574272 Bacteria 10567477
389 2862709324 2862705112 Bacteria 6563286
390 2863074654 2863067949 Bacteria 8541735
391 2867302547 2867302475 Bacteria 7087181
392 2867302649 2867302475 Bacteria 7087181
393 2867314445 2867312974 Bacteria 7058875
394 2867314550 2867312974 Bacteria 7058875
395 2867323273 2867319477 Bacteria 7069771
396 2867323376 2867319477 Bacteria 7069771
397 2867507517 2867507094 Bacteria 6506033
398 2869048523 2869048445 Bacteria 6875584
399 2869054321 2869048445 Bacteria 6875584
400 2869066295 2869061728 Bacteria 7112407
401 2869066618 2869061728 Bacteria 7112407
402 2869072968 2869068681 Bacteria 7205615
403 2869073123 2869068681 Bacteria 7205615
404 2870783694 2870782633 Bacteria 9624083
405 2880490668 2880489317 Bacteria 7096270
406 2880493896 2880489317 Bacteria 7096270
407 2880498446 2880495981 Bacteria 7340502
408 2880501914 2880495981 Bacteria 7340502
409 2884696931 2884693830 Bacteria 11273186
410 2887482699 2887478801 Bacteria 8972725
411 2891399791 2891395885 Bacteria 9251614
412 2891556352 2891554331 Bacteria 8812224
413 2895428571 2895427314 Bacteria 13147766
414 2895451691 2895442618 Bacteria 11027144
415 2902585941 2902582711 Bacteria 6187705
416 2912764027 2912757875 Bacteria 7940295
417 2915772588 2915768154 Bacteria 8424322
418 2917744046 2917736166 Bacteria 9690793
419 2919052914 2919051321 Bacteria 4210889
420 2919394266 2919391150 Bacteria 4884741
421 2929220479 2929219909 Bacteria 6984360
422 2929224051 2929219909 Bacteria 6984360
423 2929227037 2929226422 Bacteria 7248583
424 2929230433 2929226422 Bacteria 7248583
425 2939601949 2939598168 Bacteria 4687164
426 2939659011 2939657138 Bacteria 3740283
427 2945916470 2945916053 Bacteria 4555517
428 2945923126 2945920336 Bacteria 4501603
429 2946003604 2946003308 Bacteria 3857229
430 2946041154 2946037020 Bacteria 4900426
431 2954002373 2953998280 Bacteria 4812144
432 2954682515 2954682443 Bacteria 9862841
433 2954719614 2954711539 Bacteria 10867210
434 2954729649 2954721474 Bacteria 10456478
435 2954732159 2954731030 Bacteria 10243860
436 2954748553 2954740390 Bacteria 10229294
437 2954751100 2954749733 Bacteria 10366972
438 2954767680 2954759201 Bacteria 9358192
439 2966604749 2966598605 Bacteria 7676064
440 2974304449 2974302888 Bacteria 4369871
441 2990047665 2990044586 Bacteria 6603797
442 2990093235 2990088156 Bacteria 6657676
443 2996222309 2996221748 Bacteria 6799777
444 2996224315 2996221748 Bacteria 6799777
445 2997456330 2997451912 Bacteria 8492419
446 3006394671 3006393351 Bacteria 6615579
447 3006499952 3006493962 Bacteria 8825450
448 8003834105 8003830390 Bacteria 6541657
449 8003871299 8003870546 Bacteria 7396674
450 8003872063 8003870546 Bacteria 7396674
451 8004022659 8004021418 Bacteria 4313954
452 8004028185 8004025490 Bacteria 4327753
453 8008487651 8008485437 Bacteria 7198341
454 8025415254 8025413630 Bacteria 7014048
455 8025526830 8025524527 Bacteria 7197316
456 8025533347 8025530807 Bacteria 8495698
457 8033687526 8033684223 Bacteria 6906479
458 8047719463 8047710418 Bacteria 11023148
459 8047895579 8047893842 Bacteria 11723082
460 8047901794 8047893842 Bacteria 11723082
461 8048133670 8048127548 Bacteria 11053136
462 8048357097 8048356638 Bacteria 11044339
463 8048363376 8048356638 Bacteria 11044339
464 8048372602 8048369669 Bacteria 11666822
465 8048378730 8048369669 Bacteria 11666822
466 8048381536 8048379754 Bacteria 11877923
467 8048387832 8048379754 Bacteria 11877923
468 8054705647 8054704163 Bacteria 7247792
469 8054710151 8054704163 Bacteria 7247792
470 8054731103 8054727385 Bacteria 7558670
471 8054733892 8054727385 Bacteria 7558670
472 8054735239 8054734606 Bacteria 6947278
473 8054735488 8054734606 Bacteria 6947278
474 8055070432 8055066027 Bacteria 9479577
475 8055415580 8055412473 Bacteria 6257500
476 8056057142 8056054917 Bacteria 5736694
477 LJQas_1001876
478 JGI24739J22299_10001818
479 JGI24737J22298_10003224
480 JGI24737J22298_10018014
481 JGI24735J21928_10000175
482 JGI24735J21928_10027089
483 JGI25156J39149_1002569
484 JGI25162J39368_1000734
485 JGI25406J46586_10005865
486 JGI25406J46586_10009143
487 rootH2_10121278
488 Ga0070668_100058083
489 Ga0070659_100065866
490 Ga0070714_100000014
491 Ga0070714_100000344
492 Ga0070714_100001573
493 Ga0070713_100004590
494 Ga0070705_100106311
495 Ga0070706_100023182
496 Ga0070698_100027782
497 Ga0070698_100151920
498 Ga0070698_100239141
499 Ga0068853_100002376
500 Ga0070696_100009959
501 Ga0070665_100024610
502 Ga0070665_100107636
503 Ga0068855_100015466
504 Ga0068857_100029894
505 Ga0068854_100002779
506 Ga0070702_100016360
507 Ga0068852_100039345
508 Ga0068863_100334166
509 Ga0081455_10001247
510 Ga0081455_10033728
511 Ga0081540_1002813
512 Ga0081539_10000692
513 Ga0081539_10002101
514 Ga0070712_100053074
515 Ga0075428_100000121
516 Ga0075428_100002336
517 Ga0075430_100273694
518 Ga0075431_100077182
519 Ga0075429_100009716
520 Ga0068865_100262706
521 Ga0068865_100288897
522 Ga0105240_10274701
523 Ga0114129_10000915
524 Ga0114129_10181602
525 Ga0105243_10011362
526 Ga0105241_10051604
527 Ga0105237_10086767
528 Ga0105238_10113599
529 Ga0105249_10028747
530 Ga0105246_10069139
531 Ga0157369_10022309
532 Ga0157369_10074047
533 Ga0157369_10152811
534 Ga0157369_10269329
535 Ga0157375_10028635
536 Ga0157375_10579469
537 Ga0206353_11929097
538 Ga0213875_10028821
539 Ga0209148_1002618
540 Ga0207426_1019843
541 Ga0207647_10005481
542 Ga0207647_10009404
543 Ga0207684_10058390
544 Ga0207654_10005285
545 Ga0207695_10023783
546 Ga0207671_10000557
547 Ga0207693_10042585
548 Ga0207663_10156664
549 Ga0207694_10011483
550 Ga0207694_10033845
551 Ga0207700_10020952
552 Ga0207700_10052537
553 Ga0207664_10000001
554 Ga0207664_10003655
555 Ga0207664_10005369
556 Ga0207709_10024941
557 Ga0207704_10127113
558 Ga0207667_10088535
559 Ga0207668_10006760
560 Ga0207640_10022455
561 Ga0207640_10048160
562 Ga0207674_10072788
563 Ga0207698_10107917
564 Ga0268266_10013973
565 Ga0268266_10051427
566 Ga0265337_1001219
567 Ga0265326_10002612
568 Ga0265319_1001863
569 Ga0265334_10000584
570 Ga0265323_10014126
571 Ga0307515_10000025
572 Ga0307515_10000038
573 Ga0307515_10014026
574 Ga0307515_10019990
575 Ga0307515_10094132
576 Ga0265338_10001059
577 Ga0265324_10015416
578 Ga0307511_10000318
579 Ga0307511_10003892
580 Ga0307511_10082573
581 Ga0307512_10004326
582 Ga0307512_10020661
583 Ga0307512_10034030
584 Ga0314311_1193819
585 Ga0265325_10069864
586 Ga0265340_10003782
587 Ga0265316_10051353
588 Ga0307513_10001429
589 Ga0307513_10014515
590 Ga0307513_10032246
591 Ga0307513_10117273
592 Ga0307509_10001655
593 Ga0307509_10008109
594 Ga0307509_10012771
595 Ga0307509_10022006
596 Ga0307509_10031060
597 Ga0307509_10066513
598 Ga0307408_100023659
599 Ga0307508_10023193
600 Ga0307508_10024244
601 Ga0307508_10030845
602 Ga0307514_10001752
603 Ga0307514_10123517
604 Ga0265342_10006457
605 Ga0316576_10124774
606 Ga0307516_10001112
607 Ga0307516_10004936
608 Ga0307516_10025913
609 Ga0307516_10080691
610 Ga0307516_10084690
611 Ga0307516_10163947
612 Ga0307516_10172164
613 Ga0307516_10182599
614 Ga0307405_10040252
615 Ga0307405_10100811
616 Ga0307405_10144371
617 Ga0307410_10006840
618 Ga0307410_10041130
619 Ga0307406_10095366
620 Ga0307407_10043670
621 Ga0307407_10082092
622 Ga0307412_10025825
623 Ga0307412_10141751
624 Ga0307409_100010061
625 Ga0307409_100090061
626 Ga0307409_100118478
627 Ga0307409_100221346
628 Ga0307416_100084297
629 Ga0307416_100280473
630 Ga0307411_10224830
631 Ga0307507_10025503
632 Ga0307507_10040862
633 Ga0307507_10044417
634 Ga0307507_10103348
635 Ga0307510_10022010
636 Ga0307510_10058582
637 Ga0307510_10121589
638 Ga0307510_10126296
639 Ga0307510_10158752
640 Ga0316584_0097212
641 Ga0395899_0022028
642 Ga0395899_0047648
643 Ga0395900_0005080
644 Ga0395898_0008948
645 Ga0395898_0048499
646 Ga0436364_0354007
647 Ga0395901_0049212
648 Ga0395901_0103128
649 Ga0395901_0159278
650 Ga0395901_0159302
651 Ga0439439_0000242
652 Ga0439466_0011200
653 Ga0439449_0006125
654 Ga0439457_005174
655 Ga0450903_000740
656 Ga0466982_0000044
657 Ga0466965_0083442
658 Ga0466966_0002676
659 Ga0466966_0011906
660 Ga0466966_0074173
661 Ga0466961_0006463
662 Ga0466961_0078559
663 Ga0466963_0291400
664 Ga0466964_0022707
665 Ga0466971_0011239
666 Ga0466968_0008215
667 Ga0466970_0019986
668 Ga0466970_0022274
669 Ga0466970_0032388
670 Ga0466970_0152004
671 Ga0466960_0051378
672 Ga0466959_0000777
673 Ga0466967_0000584
674 Ga0466967_0004326
675 Ga0466967_0148115
676 Ga0495592_0042597
677 Ga0495603_0014562
678 Ga0495629_0004590
679 Ga0495629_0023473
680 Ga0495629_0084634
681 Ga0495651_0000294
682 Ga0495651_0009436
683 Ga0495580_0012786
684 Ga0495582_0012684
685 Ga0495582_0014781
686 Ga0495662_0009119
687 Ga0495662_0085224
688 Ga0495664_0049455
689 Ga0495585_0036371
690 Ga0495594_0004476
691 Ga0495594_0011457
692 Ga0495583_0023834
693 Ga0495606_0000951
694 Ga0495618_0115152
695 Ga0495628_0004514
696 Ga0495628_0037183
697 Ga0495652_0001934
698 Ga0495652_0108516
699 Ga0495640_0002386
700 Ga0495586_0020652
701 Ga0495586_0022759
702 Ga0495586_0079484
703 Ga0495587_0113436
704 Ga0495667_0063569
705 Ga0495668_0000382
706 Ga0495634_0003397
707 Ga0495634_0020616
708 Ga0495625_0050857
709 Ga0495625_0130453
710 Ga0495635_0000842
711 Ga0495635_0000865
712 Ga0495657_0017111
713 Ga0495657_0032406
714 Ga0495623_0031389
715 Ga0495646_0012443
716 Ga0495613_0000816
717 Ga0495613_0006869
718 Ga0495670_0056580
719 Ga0495671_0055789
720 Ga0495589_0013840
721 Ga0495589_0026683
722 Ga0495600_0029275
723 Ga0495600_0030796
724 Ga0495604_0088365
725 Ga0495636_0014068
726 Ga0495676_0004497
727 Ga0495676_0020472
728 Ga0495676_0045978
729 Ga0495676_0050322
730 Ga0495676_0051613
731 Ga0495687_002104
732 Ga0495687_002760
733 Ga0495675_0072496
734 Ga0495685_002166
735 Ga0495685_003507
736 Ga0495681_0011494
737 Ga0495593_0012630
738 Ga0495602_0054986
739 Ga0495614_0003573
740 Ga0495626_0000069
741 Ga0496103_0039931
742 Ga0496106_0047315
743 Ga0496108_0221947
744 Ga0496109_0100768
745 Ga0496113_0107701
746 Ga0496126_0003046
747 Ga0501031_0009053
748 Ga0501031_0028498
749 Ga0501031_0041873
750 Ga0501031_0098217
751 Ga0501032_0009925
752 Ga0501032_0016676
753 Ga0501032_0023687
754 Ga0501032_0033401
755 Ga0501032_0033634
756 Ga0501033_0009778
757 Ga0501033_0043983
758 Ga0501034_0007992
759 Ga0501034_0061408
760 Ga0501034_0086079
761 Ga0501034_0129923
762 Ga0501036_0005256
763 Ga0501036_0007395
764 Ga0501036_0155360
765 Ga0501037_0003898
766 Ga0501037_0041602
767 Ga0501038_0014032
768 Ga0501038_0034495
769 Ga0501038_0041467
770 Ga0501038_0069044
771 Ga0501038_0141691
772 Ga0501039_0004422
773 Ga0501039_0024537
774 Ga0501041_0008433
775 Ga0501041_0025728
776 Ga0501042_0029071
777 Ga0501043_0013274
778 Ga0501043_0038230
779 Ga0501046_0020117
780 Ga0501046_0057885
781 Ga0501046_0196326
782 Ga0501047_0005724
783 Ga0501047_0137032
784 Ga0501048_0010789
785 Ga0501048_0041602
786 Ga0501048_0137775
787 Ga0501067_0042137
788 Ga0501068_0003852
789 Ga0501068_0197306
790 Ga0501070_0024287
791 Ga0501070_0208005
792 Ga0501071_0004809
793 Ga0501074_0047675
794 Ga0501075_0023105
795 Ga0501076_0003171
796 Ga0501076_0005835
797 Ga0501077_0013209
798 Ga0501079_0056051
799 Ga0501081_0077680
800 Ga0501083_0005106
801 Ga0501035_0006021
802 Ga0501035_0010142
803 Ga0501044_0002140
804 Ga0501044_0002152
805 Ga0501044_0002645
806 Ga0501044_0067265
807 Ga0501044_0141696
808 Ga0501044_0223306
809 Ga0501045_0009164
810 Ga0501045_0191054
811 nmdc:mga05p37_25136_c1
812 nmdc:mga09592_44339_c1
813 nmdc:mga0qj67_8649_c1
814 nmdc:mga06r32_75862_c1
815 Ga0495601_0001936
816 Ga0495601_0059536
817 Ga0495612_0004987
818 Ga0495619_0024016
819 Ga0500559_0001603
820 Ga0500577_0020412
821 Ga0501084_0007435
822 Ga0501082_0003076
823 2870724251
824 2547405855
825 2558905998
826 2559423788
827 2583150039
828 2623586887
829 2623589147
830 2644182745
831 2644444768
832 2676480917
833 2676495328
834 2691512361
835 2775657821
836 2776373756
837 2793979319
838 2795782259
839 2808829586
840 2808850757
841 2808876712
842 2808893575
843 2808898224
844 2812318716
845 2816426901
846 2819699154
847 2831936177
848 2855670977
849 2855672112
850 2855681206
851 2855682842
852 2857294054
853 2857294695
854 2858851786
855 2858854361
856 2858869556
857 2858882717
858 2858888419
859 2858891723
860 2858894890
861 2858899182
862 2858899895
863 2862292803
864 2862582627
865 2862709324
866 2863074654
867 2867302547
868 2867302649
869 2867314445
870 2867314550
871 2867323273
872 2867323376
873 2867507517
874 2869048523
875 2869054321
876 2869066295
877 2869066618
878 2869072968
879 2869073123
880 2870783694
881 2880490668
882 2880493896
883 2880498446
884 2880501914
885 2884696931
886 2887482699
887 2891399791
888 2891556352
889 2895428571
890 2895451691
891 2902585941
892 2912764027
893 2915772588
894 2917744046
895 2919052914
896 2919394266
897 2929220479
898 2929224051
899 2929227037
900 2929230433
901 2939601949
902 2939659011
903 2945916470
904 2945923126
905 2946003604
906 2946041154
907 2954002373
908 2954682515
909 2954719614
910 2954729649
911 2954732159
912 2954748553
913 2954751100
914 2954767680
915 2966604749
916 2974304449
917 2990047665
918 2990093235
919 2996222309
920 2996224315
921 2997456330
922 3006394671
923 3006499952
924 8003834105
925 8003871299
926 8003872063
927 8004022659
928 8004028185
929 8008487651
930 8025415254
931 8025526830
932 8025533347
933 8033687526
934 8047719463
935 8047895579
936 8047901794
937 8048133670
938 8048357097
939 8048363376
940 8048372602
941 8048378730
942 8048381536
943 8048387832
944 8054705647
945 8054710151
946 8054731103
947 8054733892
948 8054735239
949 8054735488
950 8055070432
951 8055415580
952 8056057142

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13378

MR_MLE_C

Enolase C-terminal domain-like

157

385

0.97

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

24

137

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gl5-assembly1.cif.gz_A crystal structure of putative dehydratase from salmonella thyphimurium 0.9314 1 360
2poz-assembly1.cif.gz_G crystal structure of a putative dehydratase from mesorhizobium loti 0.9309 3 360
3rra-assembly1.cif.gz_B crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound 0.9282 1 374
2ox4-assembly1.cif.gz_H crystal structure of putative dehydratase from zymomonas mobilis zm4 0.9265 1 361
3rra-assembly1.cif.gz_B crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j with magnesium bound 0.9258 1 374
ID Description Score Start End Superfamily
af_Q6BF17_1_106_3.30.390.10 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.998 3 106 3.30.390.10
3rraA01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9843 3 99 3.30.390.10
af_Q6BF17_1_106_3.30.390.10 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.97 3 106 3.30.390.10
af_P38104_1_104_3.30.390.10 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9676 3 99 3.30.390.10
3s47B01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9619 2 99 3.30.390.10
ID Description Score Start End GO Terms
AF-A0A3M5DBQ9-F1-model_v4 deleted 0.9845 2 367
AF-J4I8Y8-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme C-terminal domain-containing protein 0.9803 2 346 GO:0008869
GO:0009063
GO:0034194
AF-A0A4Z1P4F4-F1-model_v4 Mandelate racemase/muconate lactonizing protein-like protein 0.9772 1 364 GO:0008869
GO:0009063
GO:0034194
AF-A0A7H8QMT8-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme C-terminal domain-containing protein 0.976 1 367 GO:0008869
GO:0009063
GO:0016491
GO:0034194
AF-A0A7W9J8H9-F1-model_v4 Galactonate dehydratase (EC 4.2.1.6) 0.9757 3 374 GO:0008869
GO:0009063

Map