F451580

General Info

Members Datasets Scaffolds Average Seq Length
476 240 429 162

Family's Representative Sequence

Representative Sequence 3300046674|Ga0495588_0003646|Ga0495588_0003646_1625_2200
Length 191
Sequence MLKSGHRRIRPGVPVTVNRLLQQGSRSMTTTDTARKYLARSIELATANVSNSGGPFGAVLVTADGQAFDGVNRVTATNDPTAHAEVTAIRRACSELGTFDLSGATLYASCEPCPMCLASALWARVARVVFAADRHDAASAGFDDAVFYGYFENDQREALMPVGRLELTGPEALAVLDPFNAWNSLESRTKY

Samples

Sample ID Description Type Environment
1 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
2 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
3 2643221553 Microbacterium sp. Root553 Isolate Unclassified
4 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
5 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
6 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
7 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
8 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
9 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
10 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
11 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
12 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
13 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
14 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
15 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
16 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
17 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
18 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
19 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
20 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
21 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
22 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
23 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
24 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
25 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
26 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
27 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
28 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
29 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
30 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
31 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
32 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
33 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
34 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
35 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
36 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
37 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
38 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
39 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
40 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
41 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
42 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
43 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
44 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
45 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
46 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
47 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
48 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
49 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
50 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
51 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
115 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
130 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
131 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
138 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
139 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
140 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
141 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
142 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
143 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
144 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
145 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
146 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
147 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
148 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
149 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
150 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
151 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
152 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
153 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
154 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
155 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
156 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
157 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
158 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
159 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
162 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
167 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
177 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
178 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
179 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
193 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
194 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
197 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
232 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
233 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
234 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
235 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
236 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
237 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
239 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
240 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.71
Metatranscriptomes 0.42
Isolates 9.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.41
Nodule 0
Rhizoplane 8.4
Rhizosphere 80.04
Stem 0
Stem Tuber 0
Unclassified 7.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1004894 3300002773 Bacteria 4075
2 JGI25151J46595_10034332 3300003187 Bacteria 1941
3 rootH1_10015298 3300003316 Bacteria 1174
4 rootL2_10084868 3300003322 Bacteria 5210
5 Ga0065714_10012310 3300005288 Bacteria 2467
6 Ga0065714_10096423 3300005288 Bacteria 1760
7 Ga0065712_10188633 3300005290 Bacteria 1158
8 Ga0070676_10879451 3300005328 Bacteria 666
9 Ga0070677_10004518 3300005333 Bacteria 4543
10 Ga0070677_10186426 3300005333 Bacteria 992
11 Ga0070682_100500807 3300005337 Bacteria 941
12 Ga0070682_100788533 3300005337 Bacteria 771
13 Ga0068868_100129263 3300005338 Bacteria 2066
14 Ga0070668_100006848 3300005347 Bacteria 8450
15 Ga0070669_100069372 3300005353 Bacteria 2603
16 Ga0070675_100202388 3300005354 Bacteria 1723
17 Ga0070675_101287268 3300005354 Bacteria 674
18 Ga0070674_100048955 3300005356 Bacteria 2903
19 Ga0070667_100396887 3300005367 Bacteria 1255
20 Ga0070700_101134466 3300005441 Bacteria 650
21 Ga0070663_100000835 3300005455 Bacteria 16664
22 Ga0070678_100004892 3300005456 Bacteria 7660
23 Ga0068853_101214566 3300005539 Bacteria 728
24 Ga0070665_101068280 3300005548 Bacteria 819
25 Ga0068855_100657256 3300005563 Bacteria 1125
26 Ga0068859_100606750 3300005617 Bacteria 1187
27 Ga0068861_100863866 3300005719 Bacteria 854
28 Ga0068862_101165491 3300005844 Bacteria 768
29 Ga0075365_10009723 3300006038 Bacteria 5551
30 Ga0075365_10191658 3300006038 Bacteria 1431
31 Ga0075364_10038917 3300006051 Bacteria 3082
32 Ga0075432_10031350 3300006058 Bacteria 1840
33 Ga0075432_10221795 3300006058 Bacteria 756
34 Ga0075369_10028192 3300006186 Bacteria 2352
35 Ga0075370_10349775 3300006353 Bacteria 883
36 Ga0097620_100606826 3300006931 Bacteria 1187
37 Ga0105251_10011240 3300009011 Bacteria 5124
38 Ga0105244_10007668 3300009036 Bacteria 6839
39 Ga0105244_10014738 3300009036 Bacteria 4512
40 Ga0105244_10018145 3300009036 Bacteria 3957
41 Ga0105244_10061488 3300009036 Bacteria 1890
42 Ga0105245_10129018 3300009098 Bacteria 2370
43 Ga0105247_10062955 3300009101 Bacteria 2302
44 Ga0105243_10015314 3300009148 Bacteria 5801
45 Ga0105243_10279375 3300009148 Bacteria 1503
46 Ga0105243_10688684 3300009148 Bacteria 995
47 Ga0105242_10120854 3300009176 Bacteria 2247
48 Ga0105246_10007355 3300011119 Bacteria 6748
49 Ga0105246_10022167 3300011119 Bacteria 4097
50 Ga0105246_10046688 3300011119 Bacteria 2955
51 Ga0105246_10051465 3300011119 Bacteria 2828
52 Ga0105246_10121028 3300011119 Bacteria 1939
53 Ga0157371_10247980 3300013102 Bacteria 1282
54 Ga0157371_10373093 3300013102 Bacteria 1041
55 Ga0157370_10006769 3300013104 Bacteria 12572
56 Ga0157369_10131742 3300013105 Bacteria 2649
57 Ga0157369_10168798 3300013105 Bacteria 2306
58 Ga0157369_10402572 3300013105 Bacteria 1420
59 Ga0163162_10268570 3300013306 Bacteria 1837
60 Ga0157375_10006053 3300013308 Bacteria 10550
61 Ga0157375_10050348 3300013308 Bacteria 4086
62 Ga0157375_10791910 3300013308 Bacteria 1097
63 Ga0157375_11066733 3300013308 Bacteria 945
64 Ga0157377_10244546 3300014745 Bacteria 1160
65 Ga0163161_10275008 3300017792 Bacteria 1319
66 Ga0163161_10383730 3300017792 Bacteria 1123
67 Ga0207425_1014061 3300025245 Bacteria 1828
68 Ga0209129_1000079 3300025258 Bacteria 187308
69 Ga0209025_1000458 3300025294 Bacteria 79809
70 Ga0209051_1003699 3300025303 Bacteria 9876
71 Ga0207697_10001798 3300025315 Bacteria 11484
72 Ga0207697_10005897 3300025315 Bacteria 5626
73 Ga0207655_1008593 3300025728 Bacteria 6460
74 Ga0207655_1009944 3300025728 Bacteria 5840
75 Ga0207655_1054606 3300025728 Bacteria 1587
76 Ga0207655_1054642 3300025728 Bacteria 1586
77 Ga0207713_1027839 3300025735 Bacteria 2559
78 Ga0207682_10000910 3300025893 Bacteria 13708
79 Ga0207710_10412604 3300025900 Bacteria 694
80 Ga0207680_10653111 3300025903 Bacteria 753
81 Ga0207645_10000494 3300025907 Bacteria 32513
82 Ga0207645_10647217 3300025907 Bacteria 718
83 Ga0207650_10118366 3300025925 Bacteria 2059
84 Ga0207650_10208412 3300025925 Bacteria 1569
85 Ga0207664_10340246 3300025929 Bacteria 1326
86 Ga0207709_10230401 3300025935 Bacteria 1342
87 Ga0207669_10338107 3300025937 Bacteria 1158
88 Ga0207691_10002730 3300025940 Bacteria 17235
89 Ga0207711_10638028 3300025941 Bacteria 994
90 Ga0207668_10104088 3300025972 Bacteria 2115
91 Ga0207658_10047165 3300025986 Bacteria 3152
92 Ga0207677_10087358 3300026023 Bacteria 2257
93 Ga0207639_11114138 3300026041 Bacteria 740
94 Ga0207678_10006715 3300026067 Bacteria 10206
95 Ga0207708_10224103 3300026075 Bacteria 1507
96 Ga0207683_10004822 3300026121 Bacteria 11614
97 Ga0268266_10134227 3300028379 Bacteria 2216
98 Ga0268265_10817176 3300028380 Bacteria 910
99 Ga0307515_10077217 3300028794 Bacteria 4402
100 Ga0307515_10350518 3300028794 Bacteria 1123
101 Ga0307515_10636417 3300028794 Bacteria 679
102 Ga0307509_10206526 3300031507 Bacteria 1794
103 Ga0307408_100003961 3300031548 Bacteria 10085
104 Ga0307408_100018297 3300031548 Bacteria 4702
105 Ga0307408_100023546 3300031548 Bacteria 4196
106 Ga0307408_100043638 3300031548 Bacteria 3191
107 Ga0307408_100044093 3300031548 Bacteria 3177
108 Ga0307408_100211364 3300031548 Bacteria 1577
109 Ga0307408_100273917 3300031548 Bacteria 1402
110 Ga0307408_100377747 3300031548 Bacteria 1210
111 Ga0307408_100750584 3300031548 Bacteria 881
112 Ga0307408_101014518 3300031548 Bacteria 765
113 Ga0307408_101249788 3300031548 Bacteria 694
114 Ga0307405_10035015 3300031731 Bacteria 2994
115 Ga0307405_10039876 3300031731 Bacteria 2841
116 Ga0307405_10053872 3300031731 Bacteria 2508
117 Ga0307405_10062229 3300031731 Bacteria 2362
118 Ga0307405_10069682 3300031731 Bacteria 2255
119 Ga0307405_10078877 3300031731 Bacteria 2144
120 Ga0307405_10167487 3300031731 Bacteria 1563
121 Ga0307405_10215222 3300031731 Bacteria 1406
122 Ga0307405_10479670 3300031731 Bacteria 992
123 Ga0307413_10014528 3300031824 Bacteria 4003
124 Ga0307413_10019624 3300031824 Bacteria 3577
125 Ga0307413_10026345 3300031824 Bacteria 3202
126 Ga0307413_10036167 3300031824 Bacteria 2841
127 Ga0307413_10064497 3300031824 Bacteria 2276
128 Ga0307413_10117127 3300031824 Bacteria 1796
129 Ga0307413_10199459 3300031824 Bacteria 1444
130 Ga0307413_10581478 3300031824 Bacteria 914
131 Ga0307413_10797261 3300031824 Bacteria 793
132 Ga0307413_11291642 3300031824 Bacteria 638
133 Ga0307518_10000753 3300031838 Bacteria 24372
134 Ga0307410_10013763 3300031852 Bacteria 4734
135 Ga0307410_10021180 3300031852 Bacteria 3994
136 Ga0307410_10036633 3300031852 Bacteria 3196
137 Ga0307410_10104697 3300031852 Bacteria 2035
138 Ga0307410_10105788 3300031852 Bacteria 2026
139 Ga0307410_10184057 3300031852 Bacteria 1584
140 Ga0307410_10202465 3300031852 Bacteria 1516
141 Ga0307410_10207201 3300031852 Bacteria 1500
142 Ga0307410_10232118 3300031852 Bacteria 1425
143 Ga0307410_10266152 3300031852 Bacteria 1339
144 Ga0307410_10313220 3300031852 Bacteria 1242
145 Ga0307410_10447725 3300031852 Bacteria 1053
146 Ga0307410_11158514 3300031852 Bacteria 672
147 Ga0307406_10021747 3300031901 Bacteria 3798
148 Ga0307406_10062147 3300031901 Bacteria 2415
149 Ga0307406_10111412 3300031901 Bacteria 1885
150 Ga0307406_10171176 3300031901 Bacteria 1572
151 Ga0307406_10171333 3300031901 Bacteria 1571
152 Ga0307406_10273842 3300031901 Bacteria 1284
153 Ga0307406_10437222 3300031901 Bacteria 1046
154 Ga0307406_10520069 3300031901 Bacteria 968
155 Ga0307406_10681751 3300031901 Bacteria 856
156 Ga0307406_10699295 3300031901 Bacteria 846
157 Ga0307406_10785788 3300031901 Bacteria 802
158 Ga0307406_11465968 3300031901 Bacteria 600
159 Ga0307407_10002491 3300031903 Bacteria 7226
160 Ga0307407_10012522 3300031903 Bacteria 4080
161 Ga0307407_10066624 3300031903 Bacteria 2125
162 Ga0307407_10074046 3300031903 Bacteria 2036
163 Ga0307407_10100935 3300031903 Bacteria 1791
164 Ga0307407_10151697 3300031903 Bacteria 1506
165 Ga0307407_10399982 3300031903 Bacteria 985
166 Ga0307407_10525238 3300031903 Bacteria 871
167 Ga0307412_10001241 3300031911 Bacteria 14421
168 Ga0307412_10027410 3300031911 Bacteria 3551
169 Ga0307412_10032052 3300031911 Bacteria 3325
170 Ga0307412_10036741 3300031911 Bacteria 3141
171 Ga0307412_10063525 3300031911 Bacteria 2491
172 Ga0307412_10096873 3300031911 Bacteria 2077
173 Ga0307412_10132232 3300031911 Bacteria 1814
174 Ga0307412_10160685 3300031911 Bacteria 1668
175 Ga0307412_10245046 3300031911 Bacteria 1389
176 Ga0307412_10520717 3300031911 Bacteria 993
177 Ga0307412_10680427 3300031911 Bacteria 881
178 Ga0307409_100007243 3300031995 Bacteria 6615
179 Ga0307409_100030048 3300031995 Bacteria 3898
180 Ga0307409_100077985 3300031995 Bacteria 2663
181 Ga0307409_100134589 3300031995 Bacteria 2118
182 Ga0307409_100251053 3300031995 Bacteria 1617
183 Ga0307409_100299482 3300031995 Bacteria 1495
184 Ga0307409_100363786 3300031995 Bacteria 1369
185 Ga0307409_100597083 3300031995 Bacteria 1090
186 Ga0307409_100723997 3300031995 Bacteria 996
187 Ga0307409_100748178 3300031995 Bacteria 981
188 Ga0307409_100805363 3300031995 Bacteria 947
189 Ga0307409_100961289 3300031995 Bacteria 870
190 Ga0307409_101027621 3300031995 Bacteria 843
191 Ga0307409_102255939 3300031995 Bacteria 574
192 Ga0307416_100015787 3300032002 Bacteria 5227
193 Ga0307416_100035295 3300032002 Bacteria 3817
194 Ga0307416_100051409 3300032002 Bacteria 3291
195 Ga0307416_100083575 3300032002 Bacteria 2709
196 Ga0307416_100089607 3300032002 Bacteria 2634
197 Ga0307416_100101922 3300032002 Bacteria 2501
198 Ga0307416_100239834 3300032002 Bacteria 1756
199 Ga0307416_100344049 3300032002 Bacteria 1506
200 Ga0307416_100430283 3300032002 Bacteria 1367
201 Ga0307416_100701025 3300032002 Bacteria 1101
202 Ga0307416_101216591 3300032002 Bacteria 859
203 Ga0307416_101441187 3300032002 Bacteria 794
204 Ga0307414_10052057 3300032004 Bacteria 2847
205 Ga0307414_10136190 3300032004 Bacteria 1915
206 Ga0307414_10259447 3300032004 Bacteria 1449
207 Ga0307414_10390264 3300032004 Bacteria 1206
208 Ga0307414_10675284 3300032004 Bacteria 933
209 Ga0307414_10803655 3300032004 Bacteria 858
210 Ga0307411_10038243 3300032005 Bacteria 3024
211 Ga0307411_10173344 3300032005 Bacteria 1629
212 Ga0307411_10458221 3300032005 Bacteria 1068
213 Ga0307411_10473740 3300032005 Bacteria 1053
214 Ga0307415_100582990 3300032126 Bacteria 992
215 Ga0307415_101257572 3300032126 Bacteria 699
216 Ga0307507_10113513 3300033179 Bacteria 2201
217 Ga0307510_10167224 3300033180 Bacteria 1784
218 Ga0316584_0747786 3300036712 Bacteria 667
219 Ga0395899_0008628 3300037312 Bacteria 7840
220 Ga0395899_0078645 3300037312 Bacteria 2403
221 Ga0395899_0315064 3300037312 Bacteria 1055
222 Ga0395899_0374578 3300037312 Bacteria 947
223 Ga0395900_0012818 3300037418 Bacteria 8567
224 Ga0395900_0027879 3300037418 Bacteria 5785
225 Ga0395900_0041855 3300037418 Bacteria 4721
226 Ga0395900_0107543 3300037418 Bacteria 2865
227 Ga0395900_0244875 3300037418 Bacteria 1797
228 Ga0395900_0399346 3300037418 Bacteria 1339
229 Ga0395900_0722712 3300037418 Bacteria 928
230 Ga0395900_1149405 3300037418 Bacteria 693
231 Ga0395898_0007954 3300037466 Bacteria 11243
232 Ga0395898_0023298 3300037466 Bacteria 6257
233 Ga0395898_0047116 3300037466 Bacteria 4231
234 Ga0395898_0128799 3300037466 Bacteria 2424
235 Ga0395898_0183118 3300037466 Bacteria 2002
236 Ga0395898_0380173 3300037466 Bacteria 1347
237 Ga0395898_0556350 3300037466 Bacteria 1089
238 Ga0395898_0556421 3300037466 Bacteria 1089
239 Ga0395898_0826139 3300037466 Bacteria 866
240 Ga0395905_0051265 3300037471 Bacteria 3865
241 Ga0395905_0842894 3300037471 Bacteria 820
242 Ga0395901_0018062 3300038443 Bacteria 7199
243 Ga0395901_0018782 3300038443 Bacteria 7064
244 Ga0395901_0058932 3300038443 Bacteria 3994
245 Ga0395901_0101413 3300038443 Bacteria 3020
246 Ga0395901_0226352 3300038443 Bacteria 1953
247 Ga0395901_0330239 3300038443 Bacteria 1577
248 Ga0395901_0356896 3300038443 Bacteria 1508
249 Ga0439436_0011572 3300041404 Bacteria 2680
250 Ga0439436_0014283 3300041404 Bacteria 2398
251 Ga0439436_0015142 3300041404 Bacteria 2320
252 Ga0439438_009818 3300041405 Bacteria 3074
253 Ga0439438_117811 3300041405 Bacteria 639
254 Ga0439439_0003660 3300041406 Bacteria 3408
255 Ga0439439_0017696 3300041406 Bacteria 1755
256 Ga0439439_0078103 3300041406 Bacteria 892
257 Ga0439447_064422 3300041407 Bacteria 858
258 Ga0439466_0006600 3300041411 Bacteria 4405
259 Ga0439466_0009028 3300041411 Bacteria 3743
260 Ga0451793_0547684 3300041452 Unclassified 573
261 Ga0451797_0770215 3300041453 Bacteria 939
262 Ga0439433_0001601 3300041999 Bacteria 4703
263 Ga0439433_0005499 3300041999 Bacteria 2720
264 Ga0439433_0005525 3300041999 Bacteria 2712
265 Ga0439442_000732 3300042002 Bacteria 6885
266 Ga0439442_048046 3300042002 Bacteria 899
267 Ga0439442_058172 3300042002 Bacteria 818
268 Ga0439432_019975 3300042006 Bacteria 2229
269 Ga0439432_071304 3300042006 Bacteria 1059
270 Ga0439449_0000105 3300042007 Bacteria 27271
271 Ga0439449_0001120 3300042007 Bacteria 10531
272 Ga0439449_0016550 3300042007 Bacteria 2770
273 Ga0439449_0027693 3300042007 Bacteria 2114
274 Ga0439449_0035124 3300042007 Bacteria 1866
275 Ga0439449_0154304 3300042007 Bacteria 857
276 Ga0439449_0192410 3300042007 Bacteria 763
277 Ga0439449_0345598 3300042007 Bacteria 563
278 Ga0439452_020761 3300042010 Bacteria 1719
279 Ga0439457_001785 3300042014 Bacteria 6361
280 Ga0439457_002249 3300042014 Bacteria 5586
281 Ga0450919_001337 3300042121 Bacteria 3218
282 Ga0450920_000681 3300042122 Bacteria 5455
283 Ga0450920_003806 3300042122 Bacteria 2629
284 Ga0450920_018642 3300042122 Bacteria 1329
285 Ga0450920_022372 3300042122 Bacteria 1224
286 Ga0450920_035709 3300042122 Bacteria 985
287 Ga0450920_049060 3300042122 Bacteria 845
288 Ga0450900_010334 3300042136 Bacteria 1195
289 Ga0450907_004815 3300042146 Bacteria 2308
290 Ga0450907_007115 3300042146 Bacteria 1867
291 Ga0450910_036369 3300042147 Bacteria 787
292 Ga0439446_0238121 3300042156 Bacteria 624
293 Ga0450908_001885 3300042184 Bacteria 4105
294 Ga0450909_004223 3300042185 Bacteria 2048
295 Ga0439434_0000215 3300042435 Bacteria 16048
296 Ga0439434_0002182 3300042435 Bacteria 5679
297 Ga0439434_0008053 3300042435 Bacteria 3089
298 Ga0450918_001724 3300042531 Bacteria 4257
299 Ga0450918_003497 3300042531 Bacteria 2915
300 Ga0451577_0017441 3300042876 Bacteria 6634
301 Ga0466969_0024826 3300044656 Bacteria 3082
302 Ga0466972_0019875 3300044658 Bacteria 3357
303 Ga0466966_0100312 3300044684 Bacteria 1791
304 Ga0466961_0036732 3300044693 Bacteria 3144
305 Ga0453684_0000333 3300044712 Bacteria 196669
306 Ga0453684_0830214 3300044712 Bacteria 995
307 Ga0466968_0054511 3300044735 Bacteria 1714
308 Ga0466970_0328306 3300044765 Bacteria 866
309 Ga0466960_0052103 3300044901 Bacteria 1979
310 Ga0466960_0391545 3300044901 Bacteria 799
311 Ga0451576_0065924 3300045051 Bacteria 3770
312 Ga0495638_0325453 3300046460 Bacteria 820
313 Ga0495650_0097020 3300046471 Bacteria 1112
314 Ga0495580_0050579 3300046472 Bacteria 2938
315 Ga0495582_0038867 3300046473 Bacteria 2619
316 Ga0495639_0002194 3300046475 Bacteria 8592
317 Ga0495594_0105337 3300046499 Bacteria 1588
318 Ga0495631_0021245 3300046518 Bacteria 3024
319 Ga0495643_0200612 3300046522 Bacteria 958
320 Ga0495642_0159346 3300046528 Bacteria 978
321 Ga0495654_0087981 3300046530 Bacteria 1445
322 Ga0495586_0044854 3300046535 Bacteria 2382
323 Ga0495586_0059373 3300046535 Bacteria 2078
324 Ga0495586_0064478 3300046535 Bacteria 1996
325 Ga0495586_0123803 3300046535 Bacteria 1445
326 Ga0495633_0184733 3300046558 Bacteria 959
327 Ga0495633_0317570 3300046558 Bacteria 707
328 Ga0495667_0167936 3300046559 Bacteria 1410
329 Ga0495656_0002415 3300046615 Bacteria 6194
330 Ga0495656_0023535 3300046615 Bacteria 2425
331 Ga0495668_0018065 3300046616 Bacteria 4081
332 Ga0495588_0001124 3300046674 Bacteria 11531
333 Ga0495588_0003646 3300046674 Bacteria 6737
334 Ga0495588_0053269 3300046674 Bacteria 2086
335 Ga0495588_0084547 3300046674 Bacteria 1658
336 Ga0495670_0000694 3300046691 Bacteria 16032
337 Ga0495670_0167203 3300046691 Bacteria 1157
338 Ga0495670_0272573 3300046691 Bacteria 904
339 Ga0495600_0161941 3300046809 Bacteria 1446
340 Ga0495600_0258542 3300046809 Bacteria 1106
341 Ga0495581_0078405 3300047315 Bacteria 1911
342 Ga0495581_0625005 3300047315 Bacteria 623
343 Ga0495636_0033410 3300047318 Bacteria 2113
344 Ga0495636_0402471 3300047318 Bacteria 652
345 Ga0495672_0022621 3300047320 Bacteria 4083
346 Ga0495675_0050616 3300047444 Bacteria 2640
347 Ga0495675_0254396 3300047444 Bacteria 1054
348 Ga0495677_0054120 3300047445 Bacteria 1480
349 Ga0495677_0058425 3300047445 Bacteria 1427
350 Ga0495677_0208917 3300047445 Bacteria 759
351 Ga0495685_059418 3300047447 Bacteria 1290
352 Ga0495681_0080065 3300047470 Bacteria 1460
353 Ga0495686_0437123 3300047472 Bacteria 697
354 Ga0495593_0046517 3300047673 Bacteria 2312
355 Ga0495615_0100227 3300048090 Bacteria 817
356 Ga0495615_0125273 3300048090 Bacteria 747
357 Ga0496100_0018690 3300048903 Bacteria 4117
358 Ga0496100_0025935 3300048903 Bacteria 3588
359 Ga0496101_0094689 3300048904 Bacteria 2226
360 Ga0496101_0998853 3300048904 Bacteria 658
361 Ga0496102_0108526 3300048905 Bacteria 2585
362 Ga0496102_0128956 3300048905 Bacteria 2366
363 Ga0496102_0380935 3300048905 Bacteria 1327
364 Ga0496102_0591436 3300048905 Bacteria 1032
365 Ga0496102_0652365 3300048905 Bacteria 975
366 Ga0496102_0785242 3300048905 Bacteria 875
367 Ga0496103_0044445 3300048906 Bacteria 2737
368 Ga0496103_0152688 3300048906 Bacteria 1479
369 Ga0496103_0215236 3300048906 Bacteria 1235
370 Ga0496103_0251379 3300048906 Bacteria 1137
371 Ga0496103_0365410 3300048906 Bacteria 927
372 Ga0496104_0045519 3300048907 Bacteria 4127
373 Ga0496104_0402301 3300048907 Bacteria 1281
374 Ga0496105_0119537 3300048908 Bacteria 2173
375 Ga0496106_0015947 3300048909 Bacteria 5556
376 Ga0496106_0074863 3300048909 Bacteria 2592
377 Ga0496106_0221073 3300048909 Bacteria 1510
378 Ga0496106_0872135 3300048909 Bacteria 712
379 Ga0496107_0019804 3300048910 Bacteria 4750
380 Ga0496107_0085795 3300048910 Bacteria 2297
381 Ga0496107_0261665 3300048910 Bacteria 1287
382 Ga0496108_0030459 3300048911 Bacteria 4472
383 Ga0496109_0042178 3300048912 Bacteria 4132
384 Ga0496109_0084898 3300048912 Bacteria 2921
385 Ga0496110_0005519 3300048913 Bacteria 9927
386 Ga0496110_0129121 3300048913 Bacteria 2281
387 Ga0496112_0005404 3300048915 Bacteria 11046
388 Ga0496112_0249300 3300048915 Bacteria 1727
389 Ga0496113_0301907 3300048916 Bacteria 1282
390 Ga0496113_0439810 3300048916 Bacteria 1047
391 Ga0496113_0485811 3300048916 Bacteria 992
392 Ga0496113_0565625 3300048916 Bacteria 911
393 Ga0496114_0166836 3300048917 Bacteria 1917
394 Ga0496114_0460014 3300048917 Bacteria 1126
395 Ga0496121_0373475 3300048924 Bacteria 943
396 Ga0496124_0261501 3300048927 Bacteria 1273
397 Ga0496125_0034154 3300048928 Bacteria 4487
398 Ga0496126_0688533 3300048929 Bacteria 796
399 Ga0501323_023908 3300049539 Bacteria 823
400 Ga0501032_0000360 3300049569 Bacteria 37966
401 Ga0501032_0249438 3300049569 Bacteria 1152
402 Ga0501034_0000015 3300049571 Bacteria 296163
403 Ga0501034_0168095 3300049571 Bacteria 2161
404 Ga0501036_0094575 3300049572 Bacteria 2526
405 Ga0501037_0040992 3300049573 Bacteria 3406
406 Ga0501037_0230574 3300049573 Bacteria 1300
407 Ga0501037_0448392 3300049573 Bacteria 880
408 Ga0501038_0034917 3300049574 Bacteria 4419
409 Ga0501038_0363525 3300049574 Bacteria 1125
410 Ga0501038_0397742 3300049574 Bacteria 1066
411 Ga0501038_0711234 3300049574 Bacteria 752
412 Ga0501043_0051276 3300049579 Bacteria 3242
413 Ga0501070_0012258 3300049586 Bacteria 7235
414 Ga0501073_0000015 3300049589 Bacteria 157300
415 Ga0501080_0282960 3300049742 Bacteria 1507
416 Ga0501279_037766 3300049775 Bacteria 733
417 Ga0501044_0450568 3300049823 Bacteria 1194
418 nmdc:mga00v17_17367_c1 3300050491 Bacteria 4072
419 nmdc:mga00v17_46224_c1 3300050491 Bacteria 2633
420 nmdc:mga0yw44_20878_c1 3300050492 Bacteria 3644
421 nmdc:mga07m45_376013_c1 3300050496 Bacteria 825
422 nmdc:mga0sz30_10981_c1 3300050516 Bacteria 3484
423 nmdc:mga0sz30_372624_c1 3300050516 Bacteria 639
424 Ga0495655_0004540 3300053083 Bacteria 2380
425 Ga0500556_0002062 3300053104 Bacteria 6943
426 Ga0500593_073355 3300053117 Bacteria 1481
427 Ga0500559_0000083 3300053136 Bacteria 74324
428 Ga0500616_0263768 3300053153 Bacteria 730
429 Ga0587101_058572 3300059623 Bacteria 682

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0017441 Ga0451577_0017441_333_803 148
2 3300044712 Ga0453684_0000333 Ga0453684_0000333_112604_113074 148
3 3300044712 Ga0453684_0830214 Ga0453684_0830214_470_940 148
4 3300045051 Ga0451576_0065924 Ga0451576_0065924_1359_1829 148
5 iso_pu_bacteria 2795385472 2795792831 148
6 3300037418 Ga0395900_0012818 Ga0395900_0012818_7852_8319 150
7 iso_pu_bacteria 2946024296 2946027007 150
8 3300005539 Ga0068853_101214566 Ga0068853_1012145661 151
9 3300017792 Ga0163161_10275008 Ga0163161_102750082 151
10 3300026041 Ga0207639_11114138 Ga0207639_111141381 151
11 3300036712 Ga0316584_0747786 Ga0316584_0747786_94_570 151
12 3300041453 Ga0451797_0770215 Ga0451797_0770215_344_826 151
13 3300048904 Ga0496101_0998853 Ga0496101_0998853_88_564 151
14 3300053083 Ga0495655_0004540 Ga0495655_0004540_1725_2201 151
15 iso_pu_bacteria 2795385470 2795783130 151
16 iso_pu_bacteria 2891326441 2891329530 151
17 iso_pu_bacteria 8003314358 8003321506 151
18 3300005719 Ga0068861_100863866 Ga0068861_1008638662 152
19 3300005844 Ga0068862_101165491 Ga0068862_1011654912 152
20 3300028380 Ga0268265_10817176 Ga0268265_108171762 152
21 3300031901 Ga0307406_11465968 Ga0307406_114659681 152
22 3300047320 Ga0495672_0022621 Ga0495672_0022621_2421_2897 152
23 iso_pu_bacteria 2554235227 2555230995 152
24 iso_pu_bacteria 2643221553 2643783723 152
25 iso_pu_bacteria 2654587600 2655033887 152
26 iso_pu_bacteria 2808606370 2808894929 152
27 iso_pu_bacteria 2932431166 2932432377 152
28 iso_pu_bacteria 2939598168 2939601494 152
29 iso_pu_bacteria 2945920336 2945924450 152
30 iso_pu_bacteria 2946037020 2946039783 152
31 iso_pu_bacteria 2953998280 2954001006 152
32 3300037312 Ga0395899_0008628 Ga0395899_0008628_3877_4350 153
33 3300037418 Ga0395900_0027879 Ga0395900_0027879_4881_5354 153
34 3300037418 Ga0395900_0722712 Ga0395900_0722712_312_794 153
35 3300037418 Ga0395900_1149405 Ga0395900_1149405_16_489 153
36 3300037466 Ga0395898_0007954 Ga0395898_0007954_7246_7719 153
37 3300037466 Ga0395898_0047116 Ga0395898_0047116_2519_3001 153
38 3300037466 Ga0395898_0183118 Ga0395898_0183118_1425_1907 153
39 3300038443 Ga0395901_0018062 Ga0395901_0018062_2102_2575 153
40 3300038443 Ga0395901_0356896 Ga0395901_0356896_776_1258 153
41 3300044684 Ga0466966_0100312 Ga0466966_0100312_580_1062 153
42 3300044693 Ga0466961_0036732 Ga0466961_0036732_1009_1491 153
43 3300044901 Ga0466960_0391545 Ga0466960_0391545_115_597 153
44 iso_pu_bacteria 2690315906 2691513424 153
45 iso_pu_bacteria 2775506735 2775656207 153
46 iso_pu_bacteria 2808606357 2808830676 153
47 iso_pu_bacteria 2808606360 2808851863 153
48 iso_pu_bacteria 2808606366 2808879820 153
49 iso_pu_bacteria 2808606371 2808895885 153
50 iso_pu_bacteria 2811994871 2812321768 153
51 iso_pu_bacteria 2866612099 2866617785 153
52 iso_pu_bacteria 2919391150 2919392357 153
53 iso_pu_bacteria 2945916053 2945919641 153
54 iso_pu_bacteria 2945941187 2945943821 153
55 iso_pu_bacteria 2945956166 2945957994 153
56 iso_pu_bacteria 2946059875 2946063365 153
57 iso_pu_bacteria 2974302888 2974303284 153
58 iso_pu_bacteria 8056207758 8056212891 153
59 3300003322 rootL2_10084868 rootL2_100848682 154
60 3300037418 Ga0395900_0399346 Ga0395900_0399346_600_1085 154
61 3300037466 Ga0395898_0023298 Ga0395898_0023298_4739_5224 154
62 3300037471 Ga0395905_0051265 Ga0395905_0051265_3152_3637 154
63 3300038443 Ga0395901_0018782 Ga0395901_0018782_3209_3694 154
64 iso_pu_bacteria 2844849076 2844852231 154
65 iso_pu_bacteria 2857740372 2857743725 154
66 iso_pu_bacteria 2904497146 2904499628 154
67 iso_pu_bacteria 2904776348 2904780284 154
68 iso_pu_bacteria 2910809715 2910814388 154
69 iso_pu_bacteria 2919034639 2919036078 154
70 iso_pu_bacteria 2919059106 2919060794 154
71 iso_pu_bacteria 2919538618 2919538708 154
72 iso_pu_bacteria 2932426870 2932431026 154
73 iso_pu_bacteria 2939647034 2939647947 154
74 iso_pu_bacteria 2939674588 2939678472 154
75 3300005338 Ga0068868_100129263 Ga0068868_1001292632 155
76 3300005347 Ga0070668_100006848 Ga0070668_1000068482 155
77 3300005441 Ga0070700_101134466 Ga0070700_1011344661 155
78 3300005455 Ga0070663_100000835 Ga0070663_1000008356 155
79 3300005617 Ga0068859_100606750 Ga0068859_1006067502 155
80 3300006931 Ga0097620_100606826 Ga0097620_1006068261 155
81 3300025929 Ga0207664_10340246 Ga0207664_103402462 155
82 3300026023 Ga0207677_10087358 Ga0207677_100873582 155
83 3300026067 Ga0207678_10006715 Ga0207678_100067155 155
84 3300026075 Ga0207708_10224103 Ga0207708_102241032 155
85 3300028794 Ga0307515_10077217 Ga0307515_100772175 155
86 3300031507 Ga0307509_10206526 Ga0307509_102065262 155
87 3300031824 Ga0307413_11291642 Ga0307413_112916421 155
88 3300031838 Ga0307518_10000753 Ga0307518_1000075321 155
89 3300031852 Ga0307410_10232118 Ga0307410_102321182 155
90 3300031995 Ga0307409_100251053 Ga0307409_1002510532 155
91 3300031995 Ga0307409_101027621 Ga0307409_1010276212 155
92 3300032002 Ga0307416_100344049 Ga0307416_1003440492 155
93 3300033179 Ga0307507_10113513 Ga0307507_101135132 155
94 3300033180 Ga0307510_10167224 Ga0307510_101672242 155
95 3300041404 Ga0439436_0014283 Ga0439436_0014283_938_1420 155
96 3300041404 Ga0439436_0015142 Ga0439436_0015142_1307_1789 155
97 3300041405 Ga0439438_009818 Ga0439438_009818_322_804 155
98 3300041406 Ga0439439_0003660 Ga0439439_0003660_441_923 155
99 3300041407 Ga0439447_064422 Ga0439447_064422_301_783 155
100 3300041411 Ga0439466_0009028 Ga0439466_0009028_1823_2305 155
101 3300041999 Ga0439433_0005499 Ga0439433_0005499_532_1014 155
102 3300042002 Ga0439442_058172 Ga0439442_058172_177_659 155
103 3300042006 Ga0439432_019975 Ga0439432_019975_1354_1836 155
104 3300042007 Ga0439449_0016550 Ga0439449_0016550_1670_2152 155
105 3300042007 Ga0439449_0035124 Ga0439449_0035124_1056_1538 155
106 3300042010 Ga0439452_020761 Ga0439452_020761_305_787 155
107 3300042014 Ga0439457_002249 Ga0439457_002249_4849_5331 155
108 3300042121 Ga0450919_001337 Ga0450919_001337_321_803 155
109 3300042122 Ga0450920_003806 Ga0450920_003806_36_518 155
110 3300042122 Ga0450920_049060 Ga0450920_049060_348_830 155
111 3300042146 Ga0450907_007115 Ga0450907_007115_1363_1845 155
112 3300042156 Ga0439446_0238121 Ga0439446_0238121_26_508 155
113 3300042184 Ga0450908_001885 Ga0450908_001885_3580_4062 155
114 3300042185 Ga0450909_004223 Ga0450909_004223_345_827 155
115 3300042435 Ga0439434_0002182 Ga0439434_0002182_4849_5331 155
116 3300042531 Ga0450918_003497 Ga0450918_003497_2111_2593 155
117 3300044656 Ga0466969_0024826 Ga0466969_0024826_541_1023 155
118 3300044658 Ga0466972_0019875 Ga0466972_0019875_857_1339 155
119 3300044735 Ga0466968_0054511 Ga0466968_0054511_1043_1525 155
120 3300044765 Ga0466970_0328306 Ga0466970_0328306_279_761 155
121 3300044901 Ga0466960_0052103 Ga0466960_0052103_407_889 155
122 3300049574 Ga0501038_0711234 Ga0501038_0711234_53_535 155
123 iso_pu_bacteria 2585427649 2586059272 155
124 iso_pu_bacteria 2808606522 2809591968 155
125 iso_pu_bacteria 2915768154 2915773994 155
126 iso_pu_bacteria 2939598168 2939599988 155
127 3300005288 Ga0065714_10012310 Ga0065714_100123102 156
128 3300005288 Ga0065714_10096423 Ga0065714_100964232 156
129 3300005290 Ga0065712_10188633 Ga0065712_101886332 156
130 3300005333 Ga0070677_10004518 Ga0070677_100045184 156
131 3300005333 Ga0070677_10186426 Ga0070677_101864261 156
132 3300005337 Ga0070682_100788533 Ga0070682_1007885331 156
133 3300005353 Ga0070669_100069372 Ga0070669_1000693723 156
134 3300005354 Ga0070675_100202388 Ga0070675_1002023882 156
135 3300005356 Ga0070674_100048955 Ga0070674_1000489552 156
136 3300005367 Ga0070667_100396887 Ga0070667_1003968872 156
137 3300005456 Ga0070678_100004892 Ga0070678_1000048922 156
138 3300005563 Ga0068855_100657256 Ga0068855_1006572562 156
139 3300009011 Ga0105251_10011240 Ga0105251_100112402 156
140 3300009036 Ga0105244_10014738 Ga0105244_100147385 156
141 3300009036 Ga0105244_10018145 Ga0105244_100181452 156
142 3300009098 Ga0105245_10129018 Ga0105245_101290182 156
143 3300009101 Ga0105247_10062955 Ga0105247_100629552 156
144 3300009148 Ga0105243_10279375 Ga0105243_102793751 156
145 3300011119 Ga0105246_10051465 Ga0105246_100514654 156
146 3300013102 Ga0157371_10247980 Ga0157371_102479802 156
147 3300013102 Ga0157371_10373093 Ga0157371_103730931 156
148 3300013104 Ga0157370_10006769 Ga0157370_100067692 156
149 3300013306 Ga0163162_10268570 Ga0163162_102685702 156
150 3300013308 Ga0157375_10006053 Ga0157375_100060532 156
151 3300013308 Ga0157375_10050348 Ga0157375_100503482 156
152 3300013308 Ga0157375_10791910 Ga0157375_107919102 156
153 3300013308 Ga0157375_11066733 Ga0157375_110667331 156
154 3300014745 Ga0157377_10244546 Ga0157377_102445461 156
155 3300017792 Ga0163161_10383730 Ga0163161_103837302 156
156 3300025315 Ga0207697_10001798 Ga0207697_100017982 156
157 3300025728 Ga0207655_1008593 Ga0207655_10085932 156
158 3300025728 Ga0207655_1054642 Ga0207655_10546422 156
159 3300025735 Ga0207713_1027839 Ga0207713_10278391 156
160 3300025893 Ga0207682_10000910 Ga0207682_100009107 156
161 3300025900 Ga0207710_10412604 Ga0207710_104126041 156
162 3300025903 Ga0207680_10653111 Ga0207680_106531112 156
163 3300025907 Ga0207645_10000494 Ga0207645_1000049423 156
164 3300025925 Ga0207650_10118366 Ga0207650_101183662 156
165 3300025935 Ga0207709_10230401 Ga0207709_102304012 156
166 3300025937 Ga0207669_10338107 Ga0207669_103381072 156
167 3300025940 Ga0207691_10002730 Ga0207691_1000273011 156
168 3300025941 Ga0207711_10638028 Ga0207711_106380282 156
169 3300025972 Ga0207668_10104088 Ga0207668_101040882 156
170 3300025986 Ga0207658_10047165 Ga0207658_100471653 156
171 3300026121 Ga0207683_10004822 Ga0207683_100048222 156
172 3300028379 Ga0268266_10134227 Ga0268266_101342272 156
173 3300031548 Ga0307408_100023546 Ga0307408_1000235462 156
174 3300031548 Ga0307408_100377747 Ga0307408_1003777472 156
175 3300031548 Ga0307408_100750584 Ga0307408_1007505842 156
176 3300031731 Ga0307405_10053872 Ga0307405_100538721 156
177 3300031731 Ga0307405_10062229 Ga0307405_100622293 156
178 3300031731 Ga0307405_10078877 Ga0307405_100788772 156
179 3300031824 Ga0307413_10014528 Ga0307413_100145283 156
180 3300031824 Ga0307413_10019624 Ga0307413_100196242 156
181 3300031852 Ga0307410_10036633 Ga0307410_100366333 156
182 3300031852 Ga0307410_10184057 Ga0307410_101840572 156
183 3300031852 Ga0307410_10313220 Ga0307410_103132203 156
184 3300031852 Ga0307410_10447725 Ga0307410_104477252 156
185 3300031901 Ga0307406_10021747 Ga0307406_100217473 156
186 3300031901 Ga0307406_10062147 Ga0307406_100621472 156
187 3300031901 Ga0307406_10681751 Ga0307406_106817511 156
188 3300031903 Ga0307407_10066624 Ga0307407_100666242 156
189 3300031903 Ga0307407_10074046 Ga0307407_100740462 156
190 3300031903 Ga0307407_10151697 Ga0307407_101516972 156
191 3300031911 Ga0307412_10036741 Ga0307412_100367413 156
192 3300031911 Ga0307412_10096873 Ga0307412_100968733 156
193 3300031911 Ga0307412_10160685 Ga0307412_101606853 156
194 3300031995 Ga0307409_100134589 Ga0307409_1001345892 156
195 3300031995 Ga0307409_100597083 Ga0307409_1005970832 156
196 3300031995 Ga0307409_100805363 Ga0307409_1008053631 156
197 3300032002 Ga0307416_100015787 Ga0307416_1000157874 156
198 3300032002 Ga0307416_100051409 Ga0307416_1000514093 156
199 3300032002 Ga0307416_100083575 Ga0307416_1000835753 156
200 3300032004 Ga0307414_10052057 Ga0307414_100520573 156
201 3300032004 Ga0307414_10259447 Ga0307414_102594473 156
202 3300032005 Ga0307411_10038243 Ga0307411_100382434 156
203 3300032005 Ga0307411_10458221 Ga0307411_104582211 156
204 3300042136 Ga0450900_010334 Ga0450900_010334_364_843 156
205 3300046460 Ga0495638_0325453 Ga0495638_0325453_187_681 156
206 3300046473 Ga0495582_0038867 Ga0495582_0038867_1635_2129 156
207 3300046475 Ga0495639_0002194 Ga0495639_0002194_502_996 156
208 3300046499 Ga0495594_0105337 Ga0495594_0105337_861_1355 156
209 3300046518 Ga0495631_0021245 Ga0495631_0021245_2068_2562 156
210 3300046522 Ga0495643_0200612 Ga0495643_0200612_49_543 156
211 3300046528 Ga0495642_0159346 Ga0495642_0159346_439_933 156
212 3300046530 Ga0495654_0087981 Ga0495654_0087981_662_1156 156
213 3300046535 Ga0495586_0044854 Ga0495586_0044854_276_758 156
214 3300046535 Ga0495586_0059373 Ga0495586_0059373_870_1364 156
215 3300046535 Ga0495586_0064478 Ga0495586_0064478_733_1227 156
216 3300046535 Ga0495586_0123803 Ga0495586_0123803_549_1043 156
217 3300046558 Ga0495633_0184733 Ga0495633_0184733_449_943 156
218 3300046558 Ga0495633_0317570 Ga0495633_0317570_80_574 156
219 3300046559 Ga0495667_0167936 Ga0495667_0167936_179_673 156
220 3300046615 Ga0495656_0002415 Ga0495656_0002415_470_964 156
221 3300046615 Ga0495656_0023535 Ga0495656_0023535_1094_1588 156
222 3300046616 Ga0495668_0018065 Ga0495668_0018065_602_1096 156
223 3300046674 Ga0495588_0001124 Ga0495588_0001124_4606_5100 156
224 3300046674 Ga0495588_0003646 Ga0495588_0003646_1625_2200 156
225 3300046674 Ga0495588_0053269 Ga0495588_0053269_1338_1832 156
226 3300046674 Ga0495588_0084547 Ga0495588_0084547_463_957 156
227 3300046691 Ga0495670_0000694 Ga0495670_0000694_8002_8496 156
228 3300046691 Ga0495670_0167203 Ga0495670_0167203_68_562 156
229 3300046691 Ga0495670_0272573 Ga0495670_0272573_333_827 156
230 3300046809 Ga0495600_0161941 Ga0495600_0161941_370_864 156
231 3300046809 Ga0495600_0258542 Ga0495600_0258542_439_933 156
232 3300047315 Ga0495581_0078405 Ga0495581_0078405_1346_1840 156
233 3300047315 Ga0495581_0625005 Ga0495581_0625005_58_552 156
234 3300047318 Ga0495636_0033410 Ga0495636_0033410_24_518 156
235 3300047318 Ga0495636_0402471 Ga0495636_0402471_66_641 156
236 3300047444 Ga0495675_0050616 Ga0495675_0050616_2074_2568 156
237 3300047444 Ga0495675_0254396 Ga0495675_0254396_23_517 156
238 3300047445 Ga0495677_0054120 Ga0495677_0054120_431_925 156
239 3300047445 Ga0495677_0058425 Ga0495677_0058425_690_1184 156
240 3300047445 Ga0495677_0208917 Ga0495677_0208917_53_547 156
241 3300047447 Ga0495685_059418 Ga0495685_059418_436_930 156
242 3300047470 Ga0495681_0080065 Ga0495681_0080065_834_1328 156
243 3300047673 Ga0495593_0046517 Ga0495593_0046517_1060_1554 156
244 3300048090 Ga0495615_0100227 Ga0495615_0100227_117_611 156
245 3300048090 Ga0495615_0125273 Ga0495615_0125273_110_604 156
246 3300048903 Ga0496100_0018690 Ga0496100_0018690_2495_2989 156
247 3300048903 Ga0496100_0025935 Ga0496100_0025935_729_1223 156
248 3300048904 Ga0496101_0094689 Ga0496101_0094689_967_1461 156
249 3300048905 Ga0496102_0380935 Ga0496102_0380935_591_1085 156
250 3300048905 Ga0496102_0591436 Ga0496102_0591436_24_518 156
251 3300048905 Ga0496102_0652365 Ga0496102_0652365_242_736 156
252 3300048906 Ga0496103_0152688 Ga0496103_0152688_74_568 156
253 3300048906 Ga0496103_0215236 Ga0496103_0215236_166_660 156
254 3300048906 Ga0496103_0251379 Ga0496103_0251379_257_751 156
255 3300048906 Ga0496103_0365410 Ga0496103_0365410_166_660 156
256 3300048907 Ga0496104_0045519 Ga0496104_0045519_2931_3425 156
257 3300048907 Ga0496104_0402301 Ga0496104_0402301_162_656 156
258 3300048908 Ga0496105_0119537 Ga0496105_0119537_886_1380 156
259 3300048909 Ga0496106_0015947 Ga0496106_0015947_4426_4920 156
260 3300048909 Ga0496106_0074863 Ga0496106_0074863_898_1392 156
261 3300048909 Ga0496106_0221073 Ga0496106_0221073_939_1433 156
262 3300048910 Ga0496107_0019804 Ga0496107_0019804_3290_3784 156
263 3300048910 Ga0496107_0085795 Ga0496107_0085795_1699_2193 156
264 3300048911 Ga0496108_0030459 Ga0496108_0030459_3036_3530 156
265 3300048912 Ga0496109_0042178 Ga0496109_0042178_858_1352 156
266 3300048912 Ga0496109_0084898 Ga0496109_0084898_678_1172 156
267 3300048913 Ga0496110_0005519 Ga0496110_0005519_510_1004 156
268 3300048913 Ga0496110_0129121 Ga0496110_0129121_846_1340 156
269 3300048915 Ga0496112_0249300 Ga0496112_0249300_537_1031 156
270 3300048916 Ga0496113_0439810 Ga0496113_0439810_55_549 156
271 3300048916 Ga0496113_0565625 Ga0496113_0565625_96_590 156
272 3300048917 Ga0496114_0166836 Ga0496114_0166836_800_1294 156
273 3300048917 Ga0496114_0460014 Ga0496114_0460014_559_1053 156
274 3300048924 Ga0496121_0373475 Ga0496121_0373475_86_580 156
275 3300048927 Ga0496124_0261501 Ga0496124_0261501_694_1188 156
276 3300048928 Ga0496125_0034154 Ga0496125_0034154_3418_3912 156
277 3300048929 Ga0496126_0688533 Ga0496126_0688533_84_578 156
278 3300049571 Ga0501034_0168095 Ga0501034_0168095_1185_1664 156
279 3300049775 Ga0501279_037766 Ga0501279_037766_193_675 156
280 iso_pu_bacteria 2802429296 2804843324 156
281 iso_pu_bacteria 8025413630 8025416661 156
282 3300003316 rootH1_10015298 rootH1_100152982 157
283 3300005337 Ga0070682_100500807 Ga0070682_1005008072 157
284 3300005548 Ga0070665_101068280 Ga0070665_1010682802 157
285 3300006058 Ga0075432_10031350 Ga0075432_100313502 157
286 3300006058 Ga0075432_10221795 Ga0075432_102217952 157
287 3300009036 Ga0105244_10061488 Ga0105244_100614882 157
288 3300009176 Ga0105242_10120854 Ga0105242_101208542 157
289 3300011119 Ga0105246_10022167 Ga0105246_100221675 157
290 3300011119 Ga0105246_10046688 Ga0105246_100466883 157
291 3300011119 Ga0105246_10121028 Ga0105246_101210282 157
292 3300013105 Ga0157369_10131742 Ga0157369_101317422 157
293 3300013105 Ga0157369_10168798 Ga0157369_101687982 157
294 3300013105 Ga0157369_10402572 Ga0157369_104025722 157
295 3300025315 Ga0207697_10005897 Ga0207697_100058973 157
296 3300025728 Ga0207655_1054606 Ga0207655_10546062 157
297 3300025925 Ga0207650_10208412 Ga0207650_102084122 157
298 3300031548 Ga0307408_100003961 Ga0307408_10000396110 157
299 3300031548 Ga0307408_100043638 Ga0307408_1000436383 157
300 3300031548 Ga0307408_100211364 Ga0307408_1002113642 157
301 3300031548 Ga0307408_100273917 Ga0307408_1002739172 157
302 3300031548 Ga0307408_101014518 Ga0307408_1010145182 157
303 3300031548 Ga0307408_101249788 Ga0307408_1012497881 157
304 3300031731 Ga0307405_10035015 Ga0307405_100350153 157
305 3300031731 Ga0307405_10039876 Ga0307405_100398762 157
306 3300031731 Ga0307405_10167487 Ga0307405_101674873 157
307 3300031731 Ga0307405_10215222 Ga0307405_102152222 157
308 3300031731 Ga0307405_10479670 Ga0307405_104796701 157
309 3300031824 Ga0307413_10026345 Ga0307413_100263453 157
310 3300031824 Ga0307413_10036167 Ga0307413_100361673 157
311 3300031824 Ga0307413_10064497 Ga0307413_100644972 157
312 3300031824 Ga0307413_10117127 Ga0307413_101171273 157
313 3300031824 Ga0307413_10199459 Ga0307413_101994593 157
314 3300031824 Ga0307413_10581478 Ga0307413_105814782 157
315 3300031824 Ga0307413_10797261 Ga0307413_107972612 157
316 3300031852 Ga0307410_10013763 Ga0307410_100137634 157
317 3300031852 Ga0307410_10021180 Ga0307410_100211804 157
318 3300031852 Ga0307410_10104697 Ga0307410_101046973 157
319 3300031852 Ga0307410_10105788 Ga0307410_101057883 157
320 3300031852 Ga0307410_10202465 Ga0307410_102024651 157
321 3300031852 Ga0307410_10207201 Ga0307410_102072011 157
322 3300031852 Ga0307410_10266152 Ga0307410_102661522 157
323 3300031852 Ga0307410_11158514 Ga0307410_111585141 157
324 3300031901 Ga0307406_10111412 Ga0307406_101114122 157
325 3300031901 Ga0307406_10171176 Ga0307406_101711762 157
326 3300031901 Ga0307406_10171333 Ga0307406_101713332 157
327 3300031901 Ga0307406_10437222 Ga0307406_104372221 157
328 3300031901 Ga0307406_10699295 Ga0307406_106992952 157
329 3300031901 Ga0307406_10785788 Ga0307406_107857881 157
330 3300031903 Ga0307407_10002491 Ga0307407_100024912 157
331 3300031903 Ga0307407_10012522 Ga0307407_100125221 157
332 3300031903 Ga0307407_10100935 Ga0307407_101009353 157
333 3300031903 Ga0307407_10399982 Ga0307407_103999821 157
334 3300031903 Ga0307407_10525238 Ga0307407_105252381 157
335 3300031911 Ga0307412_10001241 Ga0307412_100012413 157
336 3300031911 Ga0307412_10032052 Ga0307412_100320523 157
337 3300031911 Ga0307412_10063525 Ga0307412_100635251 157
338 3300031911 Ga0307412_10132232 Ga0307412_101322323 157
339 3300031911 Ga0307412_10245046 Ga0307412_102450463 157
340 3300031911 Ga0307412_10520717 Ga0307412_105207172 157
341 3300031911 Ga0307412_10680427 Ga0307412_106804271 157
342 3300031995 Ga0307409_100030048 Ga0307409_1000300482 157
343 3300031995 Ga0307409_100077985 Ga0307409_1000779853 157
344 3300031995 Ga0307409_100299482 Ga0307409_1002994822 157
345 3300031995 Ga0307409_100723997 Ga0307409_1007239972 157
346 3300031995 Ga0307409_100748178 Ga0307409_1007481782 157
347 3300031995 Ga0307409_100961289 Ga0307409_1009612892 157
348 3300031995 Ga0307409_102255939 Ga0307409_1022559391 157
349 3300032002 Ga0307416_100035295 Ga0307416_1000352953 157
350 3300032002 Ga0307416_100101922 Ga0307416_1001019222 157
351 3300032002 Ga0307416_100239834 Ga0307416_1002398342 157
352 3300032002 Ga0307416_100430283 Ga0307416_1004302833 157
353 3300032002 Ga0307416_100701025 Ga0307416_1007010251 157
354 3300032002 Ga0307416_101216591 Ga0307416_1012165911 157
355 3300032002 Ga0307416_101441187 Ga0307416_1014411871 157
356 3300032004 Ga0307414_10136190 Ga0307414_101361903 157
357 3300032004 Ga0307414_10390264 Ga0307414_103902642 157
358 3300032004 Ga0307414_10675284 Ga0307414_106752842 157
359 3300032005 Ga0307411_10173344 Ga0307411_101733443 157
360 3300032005 Ga0307411_10473740 Ga0307411_104737401 157
361 3300032126 Ga0307415_100582990 Ga0307415_1005829901 157
362 3300032126 Ga0307415_101257572 Ga0307415_1012575722 157
363 3300037312 Ga0395899_0078645 Ga0395899_0078645_342_827 157
364 3300037312 Ga0395899_0315064 Ga0395899_0315064_458_979 157
365 3300037312 Ga0395899_0374578 Ga0395899_0374578_365_886 157
366 3300037418 Ga0395900_0041855 Ga0395900_0041855_3775_4296 157
367 3300037418 Ga0395900_0107543 Ga0395900_0107543_300_785 157
368 3300037418 Ga0395900_0244875 Ga0395900_0244875_509_1030 157
369 3300037466 Ga0395898_0128799 Ga0395898_0128799_645_1130 157
370 3300037466 Ga0395898_0556421 Ga0395898_0556421_97_618 157
371 3300037466 Ga0395898_0826139 Ga0395898_0826139_37_558 157
372 3300037471 Ga0395905_0842894 Ga0395905_0842894_156_677 157
373 3300038443 Ga0395901_0101413 Ga0395901_0101413_2218_2739 157
374 3300038443 Ga0395901_0226352 Ga0395901_0226352_625_1110 157
375 3300041404 Ga0439436_0011572 Ga0439436_0011572_1634_2185 157
376 3300041405 Ga0439438_117811 Ga0439438_117811_57_608 157
377 3300041406 Ga0439439_0017696 Ga0439439_0017696_352_903 157
378 3300041406 Ga0439439_0078103 Ga0439439_0078103_296_781 157
379 3300041411 Ga0439466_0006600 Ga0439466_0006600_1351_1836 157
380 3300041999 Ga0439433_0001601 Ga0439433_0001601_841_1392 157
381 3300041999 Ga0439433_0005525 Ga0439433_0005525_31_516 157
382 3300042002 Ga0439442_000732 Ga0439442_000732_3735_4220 157
383 3300042002 Ga0439442_048046 Ga0439442_048046_81_632 157
384 3300042006 Ga0439432_071304 Ga0439432_071304_436_921 157
385 3300042007 Ga0439449_0000105 Ga0439449_0000105_23051_23602 157
386 3300042007 Ga0439449_0001120 Ga0439449_0001120_8702_9187 157
387 3300042007 Ga0439449_0027693 Ga0439449_0027693_258_743 157
388 3300042007 Ga0439449_0154304 Ga0439449_0154304_88_573 157
389 3300042007 Ga0439449_0192410 Ga0439449_0192410_111_596 157
390 3300042007 Ga0439449_0345598 Ga0439449_0345598_27_512 157
391 3300042014 Ga0439457_001785 Ga0439457_001785_1446_1997 157
392 3300042122 Ga0450920_000681 Ga0450920_000681_4863_5348 157
393 3300042122 Ga0450920_018642 Ga0450920_018642_14_499 157
394 3300042122 Ga0450920_022372 Ga0450920_022372_698_1183 157
395 3300042122 Ga0450920_035709 Ga0450920_035709_274_759 157
396 3300042146 Ga0450907_004815 Ga0450907_004815_61_546 157
397 3300042147 Ga0450910_036369 Ga0450910_036369_82_567 157
398 3300042435 Ga0439434_0000215 Ga0439434_0000215_8692_9177 157
399 3300042435 Ga0439434_0008053 Ga0439434_0008053_1457_2008 157
400 3300042531 Ga0450918_001724 Ga0450918_001724_3159_3644 157
401 3300046472 Ga0495580_0050579 Ga0495580_0050579_566_1051 157
402 3300048905 Ga0496102_0108526 Ga0496102_0108526_2048_2533 157
403 3300048905 Ga0496102_0128956 Ga0496102_0128956_1051_1536 157
404 3300048905 Ga0496102_0785242 Ga0496102_0785242_189_674 157
405 3300048906 Ga0496103_0044445 Ga0496103_0044445_76_561 157
406 3300048909 Ga0496106_0872135 Ga0496106_0872135_46_531 157
407 3300048910 Ga0496107_0261665 Ga0496107_0261665_21_506 157
408 3300048915 Ga0496112_0005404 Ga0496112_0005404_56_541 157
409 3300048916 Ga0496113_0301907 Ga0496113_0301907_173_658 157
410 3300048916 Ga0496113_0485811 Ga0496113_0485811_346_849 157
411 3300049539 Ga0501323_023908 Ga0501323_023908_241_726 157
412 3300049569 Ga0501032_0249438 Ga0501032_0249438_105_590 157
413 3300049572 Ga0501036_0094575 Ga0501036_0094575_871_1356 157
414 3300049573 Ga0501037_0040992 Ga0501037_0040992_2407_2892 157
415 3300049574 Ga0501038_0034917 Ga0501038_0034917_3633_4118 157
416 3300049574 Ga0501038_0363525 Ga0501038_0363525_353_838 157
417 3300049579 Ga0501043_0051276 Ga0501043_0051276_2392_2877 157
418 3300049823 Ga0501044_0450568 Ga0501044_0450568_583_1068 157
419 3300059623 Ga0587101_058572 Ga0587101_058572_101_586 157
420 3300002773 JGI25152J39213_1004894 JGI25152J39213_10048945 158
421 3300003187 JGI25151J46595_10034332 JGI25151J46595_100343322 158
422 3300005328 Ga0070676_10879451 Ga0070676_108794511 158
423 3300005354 Ga0070675_101287268 Ga0070675_1012872681 158
424 3300006038 Ga0075365_10009723 Ga0075365_100097235 158
425 3300006038 Ga0075365_10191658 Ga0075365_101916582 158
426 3300006051 Ga0075364_10038917 Ga0075364_100389173 158
427 3300006186 Ga0075369_10028192 Ga0075369_100281922 158
428 3300006353 Ga0075370_10349775 Ga0075370_103497752 158
429 3300009036 Ga0105244_10007668 Ga0105244_100076687 158
430 3300009148 Ga0105243_10015314 Ga0105243_100153144 158
431 3300009148 Ga0105243_10688684 Ga0105243_106886842 158
432 3300011119 Ga0105246_10007355 Ga0105246_100073553 158
433 3300025245 Ga0207425_1014061 Ga0207425_10140611 158
434 3300025258 Ga0209129_1000079 Ga0209129_100007984 158
435 3300025294 Ga0209025_1000458 Ga0209025_100045852 158
436 3300025303 Ga0209051_1003699 Ga0209051_10036998 158
437 3300025728 Ga0207655_1009944 Ga0207655_10099443 158
438 3300025907 Ga0207645_10647217 Ga0207645_106472171 158
439 3300028794 Ga0307515_10350518 Ga0307515_103505182 158
440 3300028794 Ga0307515_10636417 Ga0307515_106364171 158
441 3300031548 Ga0307408_100018297 Ga0307408_1000182973 158
442 3300031548 Ga0307408_100044093 Ga0307408_1000440933 158
443 3300031731 Ga0307405_10069682 Ga0307405_100696822 158
444 3300031901 Ga0307406_10273842 Ga0307406_102738422 158
445 3300031901 Ga0307406_10520069 Ga0307406_105200692 158
446 3300031911 Ga0307412_10027410 Ga0307412_100274103 158
447 3300031995 Ga0307409_100007243 Ga0307409_1000072435 158
448 3300031995 Ga0307409_100363786 Ga0307409_1003637862 158
449 3300032002 Ga0307416_100089607 Ga0307416_1000896071 158
450 3300032004 Ga0307414_10803655 Ga0307414_108036551 158
451 3300037466 Ga0395898_0380173 Ga0395898_0380173_193_702 158
452 3300037466 Ga0395898_0556350 Ga0395898_0556350_158_640 158
453 3300038443 Ga0395901_0058932 Ga0395901_0058932_2145_2627 158
454 3300038443 Ga0395901_0330239 Ga0395901_0330239_859_1368 158
455 3300041452 Ga0451793_0547684 Ga0451793_0547684_46_543 158
456 3300046471 Ga0495650_0097020 Ga0495650_0097020_93_590 158
457 3300047472 Ga0495686_0437123 Ga0495686_0437123_99_596 158
458 3300049569 Ga0501032_0000360 Ga0501032_0000360_27899_28381 158
459 3300049571 Ga0501034_0000015 Ga0501034_0000015_76438_76920 158
460 3300049573 Ga0501037_0230574 Ga0501037_0230574_549_1031 158
461 3300049573 Ga0501037_0448392 Ga0501037_0448392_188_670 158
462 3300049574 Ga0501038_0397742 Ga0501038_0397742_21_503 158
463 3300049586 Ga0501070_0012258 Ga0501070_0012258_155_652 158
464 3300049589 Ga0501073_0000015 Ga0501073_0000015_145919_146416 158
465 3300049742 Ga0501080_0282960 Ga0501080_0282960_49_546 158
466 3300050491 nmdc:mga00v17_17367_c1 nmdc:mga00v17_17367_c1_1939_2436 158
467 3300050491 nmdc:mga00v17_46224_c1 nmdc:mga00v17_46224_c1_624_1121 158
468 3300050492 nmdc:mga0yw44_20878_c1 nmdc:mga0yw44_20878_c1_1145_1642 158
469 3300050496 nmdc:mga07m45_376013_c1 nmdc:mga07m45_376013_c1_210_692 158
470 3300050516 nmdc:mga0sz30_10981_c1 nmdc:mga0sz30_10981_c1_2295_2792 158
471 3300050516 nmdc:mga0sz30_372624_c1 nmdc:mga0sz30_372624_c1_90_587 158
472 3300053104 Ga0500556_0002062 Ga0500556_0002062_5467_5964 158
473 3300053117 Ga0500593_073355 Ga0500593_073355_943_1440 158
474 3300053136 Ga0500559_0000083 Ga0500559_0000083_37668_38165 158
475 3300053153 Ga0500616_0263768 Ga0500616_0263768_103_600 158
476 iso_pu_bacteria 2933418574 2933419108 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

31

132

0.94

PF14437

MafB19-deam

MafB19-like deaminase

33

147

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vpc-assembly1.cif.gz_F structure of the spcas9 dna adenine base editor - abe8e 0.956 9 103
3ocq-assembly1.cif.gz_A-2 crystal structure of trna-specific adenosine deaminase from salmonella enterica 0.9494 6 107
2b3j-assembly2.cif.gz_D crystal structure of staphylococcus aureus trna adenosine deaminase, tada, in complex with rna 0.9487 6 106
7cph-assembly1.cif.gz_A crystal structure of trna adenosine deaminase from bacillus subtilis 0.9473 6 109
8e2q-assembly2.cif.gz_C crystal structure of tadac-1.17 in a complex with ssdna 0.9459 10 107
ID Description Score Start End Superfamily
af_A0A1D6PV52_1_75_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9722 47 103 3.40.140.10
af_A0A1D6ELV0_114_227_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9561 8 113 3.40.140.10
1wwrD00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9544 7 106 3.40.140.10
af_K7K815_1119_1301_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9527 7 107 3.40.140.10
2b3jA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9515 9 106 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A175J8Z7-F1-model_v4 deleted 0.9867 18 158
AF-A0A542IBL9-F1-model_v4 Guanine deaminase 0.9855 6 158 GO:0006152
GO:0047974
AF-A0A0S7CVJ2-F1-model_v4 Guanine deaminase 0.9822 61 158 GO:0003824
AF-A0A7T8TUI9-F1-model_v4 deleted 0.9744 1 158
AF-A0A175J8Z7-F1-model_v4 deleted 0.9731 18 158

Feature Viewer

pLDDT pTM Quality
92.18 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map