F451432

General Info

Members Datasets Scaffolds Average Seq Length
475 210 950 209

Family's Representative Sequence

Representative Sequence 3300049741|Ga0501079_0073058|Ga0501079_0073058_42_743
Length 233
Sequence MSLASGVTVPVSIGTKRTPATRPVAGAFGDSIFVIDQSRCIGCKACVQACEECGTHRGQSLIHLDEIDRSLTTQTAPMVCMHCEDPTCAEVCPADAIKQNEDGVVQSSLKPRCIGCSNCVLACPFGVPKYEVARDQMMKCDMCYDRTSVGLKPMCASVCPSEALWFGTLEEFEANRTGTLVNEWRFGNQDVATKVRAVVDEDGPIDVLAGAGTRAWQDDPFGLEEMGAPDDRP

Samples

Sample ID Description Type Environment
1 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
120 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
121 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
124 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
131 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
140 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
141 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
142 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
143 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
193 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
196 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
199 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
209 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
210 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.11
Nodule 0
Rhizoplane 2.95
Rhizosphere 90.53
Stem 0
Stem Tuber 0
Unclassified 1.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501079_0073058 3300049741 Bacteria 2651
2 Ga0065715_10048438 3300005293 Bacteria 1019
3 Ga0070658_10001719 3300005327 Bacteria 18491
4 Ga0070658_10099958 3300005327 Bacteria 2397
5 Ga0070690_100072624 3300005330 Bacteria 2238
6 Ga0070670_100037504 3300005331 Bacteria 4171
7 Ga0068869_100150000 3300005334 Bacteria 1807
8 Ga0070666_10015454 3300005335 Bacteria 4871
9 Ga0070680_100088968 3300005336 Bacteria 2555
10 Ga0068868_100048690 3300005338 Bacteria 3325
11 Ga0070660_100002231 3300005339 Bacteria 13353
12 Ga0070660_100170630 3300005339 Bacteria 1757
13 Ga0070689_100001271 3300005340 Bacteria 16041
14 Ga0070689_100093113 3300005340 Bacteria 2378
15 Ga0070691_10157013 3300005341 Bacteria 1170
16 Ga0070687_100032903 3300005343 Bacteria 2555
17 Ga0070661_100299594 3300005344 Bacteria 1251
18 Ga0070668_100021949 3300005347 Bacteria 4823
19 Ga0070669_100101067 3300005353 Bacteria 2175
20 Ga0070675_100000151 3300005354 Bacteria 41859
21 Ga0070675_100005714 3300005354 Bacteria 9516
22 Ga0070675_100007909 3300005354 Bacteria 8240
23 Ga0070671_100010645 3300005355 Bacteria 7382
24 Ga0070673_100581329 3300005364 Bacteria 1020
25 Ga0070688_100003678 3300005365 Bacteria 7921
26 Ga0070714_100019831 3300005435 Bacteria 5485
27 Ga0070713_100015132 3300005436 Bacteria 5752
28 Ga0070713_100471284 3300005436 Bacteria 1182
29 Ga0070708_100297828 3300005445 Bacteria 1519
30 Ga0070685_10007662 3300005466 Bacteria 5526
31 Ga0070685_10095383 3300005466 Bacteria 1808
32 Ga0070706_100341998 3300005467 Bacteria 1395
33 Ga0070707_100000836 3300005468 Bacteria 30471
34 Ga0070679_100047437 3300005530 Bacteria 4282
35 Ga0070679_100185361 3300005530 Bacteria 2052
36 Ga0070684_100014304 3300005535 Bacteria 6425
37 Ga0068853_100172226 3300005539 Bacteria 1959
38 Ga0070672_100017779 3300005543 Bacteria 5124
39 Ga0070686_100065723 3300005544 Bacteria 2357
40 Ga0070693_100190869 3300005547 Bacteria 1325
41 Ga0070693_100589860 3300005547 Bacteria 801
42 Ga0070665_100251483 3300005548 Bacteria 1768
43 Ga0068855_100499179 3300005563 Bacteria 1322
44 Ga0070664_100010650 3300005564 Bacteria 7451
45 Ga0068857_100003649 3300005577 Bacteria 12904
46 Ga0068856_100002322 3300005614 Bacteria 19591
47 Ga0068856_100671436 3300005614 Bacteria 1057
48 Ga0068856_100901743 3300005614 Bacteria 903
49 Ga0068859_100000708 3300005617 Bacteria 33524
50 Ga0068859_100011949 3300005617 Bacteria 8721
51 Ga0068864_100029564 3300005618 Bacteria 4642
52 Ga0068864_100087654 3300005618 Bacteria 2740
53 Ga0068861_100003174 3300005719 Bacteria 10874
54 Ga0068851_10177872 3300005834 Bacteria 1177
55 Ga0068863_100001158 3300005841 Bacteria 26343
56 Ga0068858_100217453 3300005842 Bacteria 1809
57 Ga0068860_100003617 3300005843 Bacteria 15891
58 Ga0068860_100167427 3300005843 Bacteria 2122
59 Ga0068860_100283495 3300005843 Bacteria 1620
60 Ga0068862_100044889 3300005844 Bacteria 3770
61 Ga0081455_10001526 3300005937 Bacteria 28538
62 Ga0081455_10023110 3300005937 Bacteria 5791
63 Ga0081455_10035475 3300005937 Bacteria 4456
64 Ga0081539_10000959 3300005985 Bacteria 54051
65 Ga0075365_10004530 3300006038 Bacteria 7377
66 Ga0075365_10184569 3300006038 Bacteria 1459
67 Ga0075368_10016599 3300006042 Bacteria 2745
68 Ga0075368_10102309 3300006042 Bacteria 1177
69 Ga0075363_100021101 3300006048 Bacteria 3276
70 Ga0075363_100038240 3300006048 Bacteria 2523
71 Ga0075364_10310402 3300006051 Bacteria 1074
72 Ga0075367_10004303 3300006178 Bacteria 6922
73 Ga0075367_10098082 3300006178 Bacteria 1789
74 Ga0075366_10008466 3300006195 Bacteria 5721
75 Ga0097621_100052958 3300006237 Bacteria 3307
76 Ga0097621_100226858 3300006237 Bacteria 1630
77 Ga0075370_10022439 3300006353 Bacteria 3466
78 Ga0068871_100021771 3300006358 Bacteria 4934
79 Ga0075428_100074252 3300006844 Bacteria 3714
80 Ga0075430_100043854 3300006846 Bacteria 3782
81 Ga0075430_100121806 3300006846 Bacteria 2174
82 Ga0075431_100064399 3300006847 Bacteria 3785
83 Ga0075431_100538805 3300006847 Bacteria 1155
84 Ga0075429_100062285 3300006880 Bacteria 3250
85 Ga0075436_100004233 3300006914 Bacteria 9846
86 Ga0097620_100000708 3300006931 Bacteria 33524
87 Ga0097620_100011949 3300006931 Bacteria 8721
88 Ga0105240_10002963 3300009093 Bacteria 26739
89 Ga0105240_10004376 3300009093 Bacteria 21563
90 Ga0111539_10000551 3300009094 Bacteria 47894
91 Ga0111539_10003833 3300009094 Bacteria 19804
92 Ga0111539_10067918 3300009094 Bacteria 4208
93 Ga0111539_10073970 3300009094 Bacteria 4016
94 Ga0111539_10220274 3300009094 Bacteria 2210
95 Ga0105245_10016760 3300009098 Bacteria 6398
96 Ga0105245_10029115 3300009098 Bacteria 4877
97 Ga0114129_10072902 3300009147 Bacteria 4785
98 Ga0114129_10243502 3300009147 Bacteria 2417
99 Ga0105243_10281795 3300009148 Bacteria 1497
100 Ga0105243_10641167 3300009148 Bacteria 1028
101 Ga0105241_10113697 3300009174 Bacteria 2170
102 Ga0105242_10358718 3300009176 Bacteria 1349
103 Ga0105248_10000277 3300009177 Bacteria 60423
104 Ga0105249_10030324 3300009553 Bacteria 4889
105 Ga0105030_105923 3300009987 Bacteria 1035
106 Ga0105239_10047073 3300010375 Bacteria 4726
107 Ga0105239_10377029 3300010375 Bacteria 1604
108 Ga0105239_11441120 3300010375 Bacteria 795
109 Ga0105246_10227712 3300011119 Bacteria 1466
110 Ga0157369_10000034 3300013105 Bacteria 200710
111 Ga0157374_10000229 3300013296 Bacteria 51865
112 Ga0157378_10002918 3300013297 Bacteria 15212
113 Ga0163162_10002022 3300013306 Bacteria 19074
114 Ga0163162_11855360 3300013306 Bacteria 690
115 Ga0157372_10000059 3300013307 Bacteria 124697
116 Ga0157372_10286979 3300013307 Bacteria 1914
117 Ga0157372_10738343 3300013307 Bacteria 1145
118 Ga0157375_10000648 3300013308 Bacteria 30834
119 Ga0157375_10579216 3300013308 Bacteria 1283
120 Ga0163163_11503946 3300014325 Bacteria 735
121 Ga0157377_10018925 3300014745 Bacteria 3590
122 Ga0157377_10314196 3300014745 Bacteria 1039
123 Ga0157379_10000432 3300014968 Bacteria 33895
124 Ga0163161_10114195 3300017792 Bacteria 2022
125 Ga0207656_10137879 3300025321 Bacteria 1148
126 Ga0207707_10003752 3300025912 Bacteria 13464
127 Ga0207707_10126087 3300025912 Bacteria 2239
128 Ga0207695_10391287 3300025913 Bacteria 1275
129 Ga0207657_10005472 3300025919 Bacteria 13256
130 Ga0207657_10166180 3300025919 Bacteria 1789
131 Ga0207652_10188139 3300025921 Bacteria 1857
132 Ga0207652_10303947 3300025921 Bacteria 1440
133 Ga0207646_10110288 3300025922 Bacteria 2469
134 Ga0207681_10084879 3300025923 Bacteria 2246
135 Ga0207694_10067287 3300025924 Bacteria 2796
136 Ga0207650_10007475 3300025925 Bacteria 7446
137 Ga0207659_10008354 3300025926 Bacteria 6423
138 Ga0207687_10000890 3300025927 Bacteria 20281
139 Ga0207687_10656179 3300025927 Bacteria 888
140 Ga0207700_10024861 3300025928 Bacteria 4151
141 Ga0207664_10075361 3300025929 Bacteria 2728
142 Ga0207690_10383877 3300025932 Bacteria 1117
143 Ga0207706_10072915 3300025933 Bacteria 3019
144 Ga0207686_10225604 3300025934 Bacteria 1355
145 Ga0207670_10035922 3300025936 Bacteria 3219
146 Ga0207704_10119003 3300025938 Bacteria 1803
147 Ga0207711_10102391 3300025941 Bacteria 2535
148 Ga0207689_10227157 3300025942 Bacteria 1543
149 Ga0207689_10343205 3300025942 Bacteria 1241
150 Ga0207667_10002168 3300025949 Bacteria 24599
151 Ga0207667_10013294 3300025949 Bacteria 9428
152 Ga0207712_10021201 3300025961 Bacteria 4263
153 Ga0207668_10011294 3300025972 Bacteria 5421
154 Ga0207703_10904235 3300026035 Bacteria 845
155 Ga0207639_10418874 3300026041 Bacteria 1210
156 Ga0207708_10535738 3300026075 Bacteria 986
157 Ga0207702_10004425 3300026078 Bacteria 12490
158 Ga0207641_10184734 3300026088 Bacteria 1912
159 Ga0207676_10087522 3300026095 Bacteria 2548
160 Ga0207674_10013133 3300026116 Bacteria 9218
161 Ga0207674_10729105 3300026116 Unclassified 957
162 Ga0207675_100360513 3300026118 Bacteria 1426
163 Ga0209813_10009493 3300027866 Bacteria 2490
164 Ga0209813_10070949 3300027866 Bacteria 1132
165 Ga0207428_10003912 3300027907 Bacteria 14291
166 Ga0207428_10006777 3300027907 Bacteria 10508
167 Ga0207428_10031906 3300027907 Bacteria 4338
168 Ga0268264_10066736 3300028381 Bacteria 3035
169 Ga0268264_10475719 3300028381 Bacteria 1214
170 Ga0265330_10033832 3300031235 Bacteria 2284
171 Ga0265332_10046081 3300031238 Bacteria 1878
172 Ga0265328_10011349 3300031239 Bacteria 3564
173 Ga0265325_10001368 3300031241 Bacteria 17211
174 Ga0265340_10000524 3300031247 Bacteria 21147
175 Ga0265339_10013616 3300031249 Bacteria 4926
176 Ga0265331_10007406 3300031250 Bacteria 6354
177 Ga0265316_10062438 3300031344 Bacteria 2891
178 Ga0265313_10002468 3300031595 Bacteria 15937
179 Ga0265314_10032020 3300031711 Bacteria 3874
180 Ga0307416_101639483 3300032002 Bacteria 748
181 Ga0373949_0077697 3300035090 Bacteria 880
182 Ga0373956_0151239 3300035119 Bacteria 1092
183 Ga0373943_0140940 3300035170 Bacteria 1299
184 Ga0373935_0006650 3300035692 Bacteria 6907
185 Ga0373933_0009614 3300035724 Bacteria 5282
186 Ga0373933_0164687 3300035724 Bacteria 1409
187 Ga0373947_0038265 3300035725 Bacteria 2849
188 Ga0373937_0000180 3300036401 Bacteria 61995
189 Ga0373937_0022636 3300036401 Bacteria 5651
190 Ga0373937_0093201 3300036401 Bacteria 2792
191 Ga0373937_0815784 3300036401 Viruses 881
192 Ga0373937_0893078 3300036401 Bacteria 837
193 Ga0373925_0028550 3300037068 Bacteria 4088
194 Ga0395901_0428896 3300038443 Bacteria 1355
195 Ga0451797_0903606 3300041453 Bacteria 2120
196 Ga0451837_1422128 3300041494 Bacteria 2994
197 Ga0439443_036898 3300042003 Bacteria 824
198 Ga0439448_0068817 3300042005 Bacteria 1178
199 Ga0439460_0128342 3300042461 Bacteria 834
200 Ga0453684_0963557 3300044712 Bacteria 910
201 Ga0466967_0318208 3300045976 Bacteria 1500
202 Ga0495651_0102182 3300046462 Bacteria 2132
203 Ga0495580_0011537 3300046472 Bacteria 6836
204 Ga0495580_0202825 3300046472 Bacteria 1366
205 Ga0495580_0203580 3300046472 Bacteria 1363
206 Ga0495587_0178082 3300046536 Unclassified 1206
207 Ga0495623_0038613 3300046679 Unclassified 3053
208 Ga0495658_0050073 3300046683 Bacteria 2362
209 Ga0496102_0880489 3300048905 Unclassified 817
210 Ga0496104_0009231 3300048907 Bacteria 8769
211 Ga0496105_0050806 3300048908 Bacteria 3425
212 Ga0496105_0092649 3300048908 Unclassified 2495
213 Ga0496105_0127846 3300048908 Bacteria 2095
214 Ga0496107_0885768 3300048910 Bacteria 651
215 Ga0496110_0147665 3300048913 Bacteria 2128
216 Ga0496110_0188267 3300048913 Unclassified 1874
217 Ga0496111_0008676 3300048914 Bacteria 6742
218 Ga0496112_0000597 3300048915 Bacteria 24857
219 Ga0496112_0063493 3300048915 Bacteria 3643
220 Ga0496113_0010029 3300048916 Bacteria 6247
221 Ga0496115_0147674 3300048918 Bacteria 1941
222 Ga0501031_0005130 3300049568 Bacteria 8531
223 Ga0501031_0051563 3300049568 Bacteria 2680
224 Ga0501031_0091082 3300049568 Bacteria 1989
225 Ga0501032_0005617 3300049569 Bacteria 9290
226 Ga0501032_0138695 3300049569 Bacteria 1602
227 Ga0501032_0183163 3300049569 Bacteria 1371
228 Ga0501033_0000814 3300049570 Bacteria 28538
229 Ga0501033_0005807 3300049570 Bacteria 9712
230 Ga0501033_0015353 3300049570 Bacteria 5811
231 Ga0501034_0003301 3300049571 Bacteria 18425
232 Ga0501034_0016308 3300049571 Bacteria 7627
233 Ga0501034_0026559 3300049571 Bacteria 5896
234 Ga0501034_0059633 3300049571 Bacteria 3833
235 Ga0501034_0061241 3300049571 Bacteria 3779
236 Ga0501034_0074057 3300049571 Bacteria 3414
237 Ga0501034_0203533 3300049571 Bacteria 1937
238 Ga0501034_0667900 3300049571 Bacteria 940
239 Ga0501036_0034624 3300049572 Bacteria 4273
240 Ga0501036_0080874 3300049572 Bacteria 2746
241 Ga0501036_0104846 3300049572 Bacteria 2391
242 Ga0501036_0177962 3300049572 Bacteria 1791
243 Ga0501036_0178248 3300049572 Bacteria 1789
244 Ga0501036_0190981 3300049572 Bacteria 1723
245 Ga0501036_0280882 3300049572 Bacteria 1393
246 Ga0501036_0319114 3300049572 Bacteria 1298
247 Ga0501036_0603378 3300049572 Bacteria 910
248 Ga0501036_0671697 3300049572 Bacteria 857
249 Ga0501037_0013511 3300049573 Bacteria 6012
250 Ga0501037_0091043 3300049573 Bacteria 2206
251 Ga0501037_0152506 3300049573 Bacteria 1651
252 Ga0501037_0403269 3300049573 Bacteria 938
253 Ga0501038_0012115 3300049574 Bacteria 7877
254 Ga0501038_0027867 3300049574 Bacteria 5020
255 Ga0501038_0090903 3300049574 Bacteria 2558
256 Ga0501038_0347629 3300049574 Bacteria 1155
257 Ga0501038_0656455 3300049574 Bacteria 789
258 Ga0501039_0031413 3300049575 Bacteria 4094
259 Ga0501039_0042841 3300049575 Bacteria 3497
260 Ga0501039_0053495 3300049575 Bacteria 3124
261 Ga0501039_0074101 3300049575 Bacteria 2645
262 Ga0501039_0099914 3300049575 Bacteria 2264
263 Ga0501039_0256332 3300049575 Bacteria 1375
264 Ga0501040_0001403 3300049576 Bacteria 15220
265 Ga0501040_0004865 3300049576 Bacteria 8697
266 Ga0501040_0031844 3300049576 Bacteria 3565
267 Ga0501040_0047578 3300049576 Bacteria 2929
268 Ga0501040_0060871 3300049576 Bacteria 2595
269 Ga0501040_0076251 3300049576 Bacteria 2318
270 Ga0501040_0079095 3300049576 Bacteria 2276
271 Ga0501040_0124087 3300049576 Bacteria 1813
272 Ga0501040_0250609 3300049576 Bacteria 1263
273 Ga0501041_0010301 3300049577 Bacteria 5508
274 Ga0501041_0113549 3300049577 Bacteria 1681
275 Ga0501041_0144540 3300049577 Bacteria 1484
276 Ga0501041_0148382 3300049577 Bacteria 1463
277 Ga0501041_0461030 3300049577 Bacteria 807
278 Ga0501042_0004290 3300049578 Bacteria 9079
279 Ga0501042_0008098 3300049578 Bacteria 6917
280 Ga0501042_0050733 3300049578 Bacteria 2959
281 Ga0501042_0051493 3300049578 Bacteria 2937
282 Ga0501042_0060328 3300049578 Bacteria 2709
283 Ga0501042_0062455 3300049578 Bacteria 2662
284 Ga0501042_0185606 3300049578 Bacteria 1500
285 Ga0501042_0279850 3300049578 Bacteria 1205
286 Ga0501042_0520539 3300049578 Bacteria 864
287 Ga0501043_0004454 3300049579 Bacteria 11383
288 Ga0501043_0010648 3300049579 Bacteria 7204
289 Ga0501043_0021596 3300049579 Bacteria 5048
290 Ga0501043_0074359 3300049579 Bacteria 2669
291 Ga0501046_0018340 3300049580 Bacteria 5825
292 Ga0501046_0020546 3300049580 Bacteria 5459
293 Ga0501046_0065911 3300049580 Bacteria 2824
294 Ga0501046_0077133 3300049580 Bacteria 2580
295 Ga0501046_0303781 3300049580 Bacteria 1165
296 Ga0501046_0498207 3300049580 Bacteria 873
297 Ga0501047_0062098 3300049581 Bacteria 3604
298 Ga0501047_0105390 3300049581 Bacteria 2700
299 Ga0501048_0009270 3300049582 Bacteria 7394
300 Ga0501048_0009345 3300049582 Bacteria 7362
301 Ga0501048_0040052 3300049582 Bacteria 3359
302 Ga0501048_0045112 3300049582 Bacteria 3150
303 Ga0501048_0091566 3300049582 Bacteria 2145
304 Ga0501048_0260552 3300049582 Bacteria 1232
305 Ga0501067_0162604 3300049583 Bacteria 1243
306 Ga0501068_0022647 3300049584 Bacteria 3675
307 Ga0501068_0177919 3300049584 Bacteria 1344
308 Ga0501069_0001135 3300049585 Bacteria 12850
309 Ga0501069_0082489 3300049585 Bacteria 1812
310 Ga0501069_0128560 3300049585 Bacteria 1450
311 Ga0501070_0028995 3300049586 Bacteria 4641
312 Ga0501070_0051763 3300049586 Bacteria 3407
313 Ga0501070_0055726 3300049586 Bacteria 3276
314 Ga0501070_0078660 3300049586 Bacteria 2729
315 Ga0501070_0367604 3300049586 Bacteria 1166
316 Ga0501071_0000470 3300049587 Bacteria 20360
317 Ga0501071_0000564 3300049587 Bacteria 19132
318 Ga0501071_0011856 3300049587 Bacteria 5885
319 Ga0501071_0013640 3300049587 Bacteria 5541
320 Ga0501071_0016998 3300049587 Bacteria 5008
321 Ga0501071_0023920 3300049587 Bacteria 4270
322 Ga0501071_0070639 3300049587 Bacteria 2544
323 Ga0501071_0089914 3300049587 Bacteria 2254
324 Ga0501071_0166012 3300049587 Bacteria 1652
325 Ga0501071_0176216 3300049587 Bacteria 1602
326 Ga0501071_0515748 3300049587 Bacteria 917
327 Ga0501072_0004163 3300049588 Bacteria 10950
328 Ga0501072_0004537 3300049588 Bacteria 10554
329 Ga0501072_0010045 3300049588 Bacteria 7202
330 Ga0501072_0010541 3300049588 Bacteria 7037
331 Ga0501072_0019471 3300049588 Bacteria 5247
332 Ga0501072_0036903 3300049588 Bacteria 3833
333 Ga0501072_0038317 3300049588 Bacteria 3762
334 Ga0501072_0061224 3300049588 Bacteria 2968
335 Ga0501072_0082459 3300049588 Bacteria 2549
336 Ga0501072_0137762 3300049588 Bacteria 1946
337 Ga0501073_0003595 3300049589 Bacteria 11656
338 Ga0501073_0028241 3300049589 Bacteria 4009
339 Ga0501073_0433879 3300049589 Bacteria 908
340 Ga0501073_0697571 3300049589 Bacteria 700
341 Ga0501074_0012673 3300049590 Bacteria 6132
342 Ga0501074_0021271 3300049590 Bacteria 4711
343 Ga0501074_0033699 3300049590 Bacteria 3712
344 Ga0501074_0043901 3300049590 Bacteria 3236
345 Ga0501074_0113298 3300049590 Bacteria 1940
346 Ga0501074_0209624 3300049590 Bacteria 1388
347 Ga0501075_0002305 3300049591 Bacteria 12667
348 Ga0501075_0006263 3300049591 Bacteria 8181
349 Ga0501075_0008270 3300049591 Bacteria 7250
350 Ga0501075_0049455 3300049591 Bacteria 3160
351 Ga0501075_0094360 3300049591 Bacteria 2271
352 Ga0501075_0248507 3300049591 Bacteria 1356
353 Ga0501075_0483050 3300049591 Bacteria 945
354 Ga0501076_0003097 3300049592 Bacteria 11577
355 Ga0501076_0006294 3300049592 Bacteria 8603
356 Ga0501076_0015421 3300049592 Bacteria 5773
357 Ga0501076_0019114 3300049592 Bacteria 5231
358 Ga0501076_0034245 3300049592 Bacteria 3969
359 Ga0501076_0043663 3300049592 Bacteria 3533
360 Ga0501076_0061882 3300049592 Bacteria 2979
361 Ga0501076_0076704 3300049592 Bacteria 2681
362 Ga0501076_0103115 3300049592 Bacteria 2301
363 Ga0501076_0134636 3300049592 Bacteria 2006
364 Ga0501076_0179996 3300049592 Bacteria 1723
365 Ga0501076_0279914 3300049592 Bacteria 1366
366 Ga0501077_0002856 3300049593 Bacteria 10359
367 Ga0501077_0006423 3300049593 Bacteria 7213
368 Ga0501077_0007017 3300049593 Bacteria 6945
369 Ga0501077_0089043 3300049593 Bacteria 1956
370 Ga0501077_0138671 3300049593 Bacteria 1542
371 Ga0501077_0383059 3300049593 Bacteria 898
372 Ga0501079_0017954 3300049741 Bacteria 5401
373 Ga0501079_0018460 3300049741 Bacteria 5330
374 Ga0501079_0037031 3300049741 Bacteria 3758
375 Ga0501079_0072749 3300049741 Bacteria 2657
376 Ga0501079_0117978 3300049741 Bacteria 2063
377 Ga0501079_0126980 3300049741 Bacteria 1984
378 Ga0501079_0184277 3300049741 Bacteria 1630
379 Ga0501080_0033745 3300049742 Bacteria 4777
380 Ga0501080_0053298 3300049742 Bacteria 3765
381 Ga0501080_0058350 3300049742 Bacteria 3593
382 Ga0501080_0067401 3300049742 Bacteria 3329
383 Ga0501080_0227477 3300049742 Bacteria 1705
384 Ga0501080_0262890 3300049742 Bacteria 1572
385 Ga0501080_0283813 3300049742 Bacteria 1505
386 Ga0501081_0006489 3300049743 Bacteria 7597
387 Ga0501081_0009605 3300049743 Bacteria 6307
388 Ga0501081_0014893 3300049743 Bacteria 5130
389 Ga0501081_0015872 3300049743 Bacteria 4972
390 Ga0501081_0026863 3300049743 Bacteria 3885
391 Ga0501081_0053011 3300049743 Bacteria 2800
392 Ga0501081_0073857 3300049743 Bacteria 2379
393 Ga0501081_0074781 3300049743 Bacteria 2364
394 Ga0501081_0198240 3300049743 Bacteria 1456
395 Ga0501081_0217633 3300049743 Bacteria 1388
396 Ga0501081_0221135 3300049743 Bacteria 1377
397 Ga0501083_0007227 3300049744 Bacteria 7884
398 Ga0501083_0142730 3300049744 Bacteria 1568
399 Ga0501083_0255570 3300049744 Bacteria 1140
400 Ga0501083_0333278 3300049744 Bacteria 987
401 Ga0501035_0054060 3300049822 Bacteria 3589
402 Ga0501035_0061702 3300049822 Bacteria 3336
403 Ga0501035_0179634 3300049822 Bacteria 1824
404 Ga0501035_0431420 3300049822 Bacteria 1093
405 Ga0501044_0001495 3300049823 Bacteria 27381
406 Ga0501044_0025983 3300049823 Bacteria 6203
407 Ga0501044_0104901 3300049823 Bacteria 2840
408 Ga0501044_0452840 3300049823 Bacteria 1190
409 Ga0501044_0550946 3300049823 Bacteria 1050
410 Ga0501045_0004721 3300049824 Bacteria 9403
411 Ga0501045_0016125 3300049824 Bacteria 5302
412 Ga0501045_0020487 3300049824 Bacteria 4724
413 Ga0501045_0021253 3300049824 Bacteria 4641
414 Ga0501045_0099654 3300049824 Bacteria 2150
415 Ga0501045_0104378 3300049824 Bacteria 2100
416 Ga0501045_0132979 3300049824 Bacteria 1849
417 Ga0501045_0159318 3300049824 Bacteria 1680
418 Ga0501045_0202908 3300049824 Bacteria 1477
419 Ga0501045_0204175 3300049824 Bacteria 1472
420 Ga0501045_0510041 3300049824 Bacteria 893
421 nmdc:mga03683_250521_c1 3300050489 Bacteria 822
422 nmdc:mga03n38_321937_c1 3300050490 Bacteria 835
423 nmdc:mga03n38_98975_c1 3300050490 Bacteria 1404
424 nmdc:mga00v17_13432_c2 3300050491 Bacteria 3628
425 nmdc:mga00v17_225692_c1 3300050491 Bacteria 1213
426 nmdc:mga00v17_62889_c1 3300050491 Bacteria 2285
427 nmdc:mga0yw44_39795_c1 3300050492 Bacteria 2790
428 nmdc:mga0k408_2158_c1 3300050493 Bacteria 10556
429 nmdc:mga06z11_1207_c1 3300050494 Bacteria 9535
430 nmdc:mga06z11_281135_c1 3300050494 Bacteria 986
431 nmdc:mga06z11_57097_c1 3300050494 Bacteria 2021
432 nmdc:mga06z11_92129_c1 3300050494 Bacteria 1647
433 nmdc:mga04h51_11137_c1 3300050495 Bacteria 2489
434 nmdc:mga04h51_84475_c1 3300050495 Bacteria 1132
435 nmdc:mga07m45_279771_c1 3300050496 Bacteria 970
436 nmdc:mga07m45_4151_c1 3300050496 Bacteria 7073
437 nmdc:mga05p37_76117_c1 3300050507 Bacteria 4132
438 nmdc:mga0qj67_516618_c1 3300050509 Bacteria 959
439 nmdc:mga0qj67_576491_c1 3300050509 Bacteria 901
440 nmdc:mga06r32_166760_c1 3300050510 Bacteria 2186
441 nmdc:mga06r32_41855_c1 3300050510 Bacteria 4354
442 nmdc:mga08y16_1511_c1 3300050511 Bacteria 23387
443 nmdc:mga08y16_2155_c1 3300050511 Bacteria 20196
444 nmdc:mga08y16_244841_c1 3300050511 Bacteria 1853
445 nmdc:mga08y16_28685_c1 3300050511 Bacteria 5866
446 nmdc:mga08y16_384903_c1 3300050511 Bacteria 1437
447 nmdc:mga08x19_1253_c1 3300050514 Bacteria 15750
448 Ga0495601_0018140 3300053077 Bacteria 4280
449 Ga0501084_0012046 3300054114 Bacteria 7162
450 Ga0501084_0024944 3300054114 Bacteria 4989
451 Ga0501084_0033846 3300054114 Bacteria 4274
452 Ga0501084_0044046 3300054114 Bacteria 3735
453 Ga0501084_0057303 3300054114 Bacteria 3260
454 Ga0501084_0077193 3300054114 Bacteria 2793
455 Ga0501084_0119042 3300054114 Bacteria 2220
456 Ga0501084_0135944 3300054114 Bacteria 2069
457 Ga0501084_0152664 3300054114 Bacteria 1947
458 Ga0501084_0291554 3300054114 Bacteria 1378
459 Ga0501084_0445133 3300054114 Bacteria 1095
460 Ga0501082_0005565 3300060353 Bacteria 10938
461 Ga0501082_0032926 3300060353 Bacteria 4470
462 Ga0501082_0107303 3300060353 Bacteria 2416
463 Ga0501082_0139306 3300060353 Bacteria 2106
464 Ga0501082_0162320 3300060353 Bacteria 1942
465 Ga0501082_0355932 3300060353 Bacteria 1277
466 Ga0530510_0004158 3300061734 Bacteria 9986
467 Ga0530510_0007693 3300061734 Bacteria 7503
468 Ga0530510_0010158 3300061734 Bacteria 6598
469 Ga0530510_0015699 3300061734 Bacteria 5352
470 Ga0530510_0016578 3300061734 Bacteria 5216
471 Ga0530510_0078448 3300061734 Bacteria 2401
472 Ga0530510_0106081 3300061734 Bacteria 2056
473 Ga0530510_0192920 3300061734 Bacteria 1512
474 2526063379 2524614857 Bacteria 4146328
475 2740064012 2739367875 Bacteria 4157290
476 Ga0501079_0073058
477 Ga0065715_10048438
478 Ga0070658_10001719
479 Ga0070658_10099958
480 Ga0070690_100072624
481 Ga0070670_100037504
482 Ga0068869_100150000
483 Ga0070666_10015454
484 Ga0070680_100088968
485 Ga0068868_100048690
486 Ga0070660_100002231
487 Ga0070660_100170630
488 Ga0070689_100001271
489 Ga0070689_100093113
490 Ga0070691_10157013
491 Ga0070687_100032903
492 Ga0070661_100299594
493 Ga0070668_100021949
494 Ga0070669_100101067
495 Ga0070675_100000151
496 Ga0070675_100005714
497 Ga0070675_100007909
498 Ga0070671_100010645
499 Ga0070673_100581329
500 Ga0070688_100003678
501 Ga0070714_100019831
502 Ga0070713_100015132
503 Ga0070713_100471284
504 Ga0070708_100297828
505 Ga0070685_10007662
506 Ga0070685_10095383
507 Ga0070706_100341998
508 Ga0070707_100000836
509 Ga0070679_100047437
510 Ga0070679_100185361
511 Ga0070684_100014304
512 Ga0068853_100172226
513 Ga0070672_100017779
514 Ga0070686_100065723
515 Ga0070693_100190869
516 Ga0070693_100589860
517 Ga0070665_100251483
518 Ga0068855_100499179
519 Ga0070664_100010650
520 Ga0068857_100003649
521 Ga0068856_100002322
522 Ga0068856_100671436
523 Ga0068856_100901743
524 Ga0068859_100000708
525 Ga0068859_100011949
526 Ga0068864_100029564
527 Ga0068864_100087654
528 Ga0068861_100003174
529 Ga0068851_10177872
530 Ga0068863_100001158
531 Ga0068858_100217453
532 Ga0068860_100003617
533 Ga0068860_100167427
534 Ga0068860_100283495
535 Ga0068862_100044889
536 Ga0081455_10001526
537 Ga0081455_10023110
538 Ga0081455_10035475
539 Ga0081539_10000959
540 Ga0075365_10004530
541 Ga0075365_10184569
542 Ga0075368_10016599
543 Ga0075368_10102309
544 Ga0075363_100021101
545 Ga0075363_100038240
546 Ga0075364_10310402
547 Ga0075367_10004303
548 Ga0075367_10098082
549 Ga0075366_10008466
550 Ga0097621_100052958
551 Ga0097621_100226858
552 Ga0075370_10022439
553 Ga0068871_100021771
554 Ga0075428_100074252
555 Ga0075430_100043854
556 Ga0075430_100121806
557 Ga0075431_100064399
558 Ga0075431_100538805
559 Ga0075429_100062285
560 Ga0075436_100004233
561 Ga0097620_100000708
562 Ga0097620_100011949
563 Ga0105240_10002963
564 Ga0105240_10004376
565 Ga0111539_10000551
566 Ga0111539_10003833
567 Ga0111539_10067918
568 Ga0111539_10073970
569 Ga0111539_10220274
570 Ga0105245_10016760
571 Ga0105245_10029115
572 Ga0114129_10072902
573 Ga0114129_10243502
574 Ga0105243_10281795
575 Ga0105243_10641167
576 Ga0105241_10113697
577 Ga0105242_10358718
578 Ga0105248_10000277
579 Ga0105249_10030324
580 Ga0105030_105923
581 Ga0105239_10047073
582 Ga0105239_10377029
583 Ga0105239_11441120
584 Ga0105246_10227712
585 Ga0157369_10000034
586 Ga0157374_10000229
587 Ga0157378_10002918
588 Ga0163162_10002022
589 Ga0163162_11855360
590 Ga0157372_10000059
591 Ga0157372_10286979
592 Ga0157372_10738343
593 Ga0157375_10000648
594 Ga0157375_10579216
595 Ga0163163_11503946
596 Ga0157377_10018925
597 Ga0157377_10314196
598 Ga0157379_10000432
599 Ga0163161_10114195
600 Ga0207656_10137879
601 Ga0207707_10003752
602 Ga0207707_10126087
603 Ga0207695_10391287
604 Ga0207657_10005472
605 Ga0207657_10166180
606 Ga0207652_10188139
607 Ga0207652_10303947
608 Ga0207646_10110288
609 Ga0207681_10084879
610 Ga0207694_10067287
611 Ga0207650_10007475
612 Ga0207659_10008354
613 Ga0207687_10000890
614 Ga0207687_10656179
615 Ga0207700_10024861
616 Ga0207664_10075361
617 Ga0207690_10383877
618 Ga0207706_10072915
619 Ga0207686_10225604
620 Ga0207670_10035922
621 Ga0207704_10119003
622 Ga0207711_10102391
623 Ga0207689_10227157
624 Ga0207689_10343205
625 Ga0207667_10002168
626 Ga0207667_10013294
627 Ga0207712_10021201
628 Ga0207668_10011294
629 Ga0207703_10904235
630 Ga0207639_10418874
631 Ga0207708_10535738
632 Ga0207702_10004425
633 Ga0207641_10184734
634 Ga0207676_10087522
635 Ga0207674_10013133
636 Ga0207674_10729105
637 Ga0207675_100360513
638 Ga0209813_10009493
639 Ga0209813_10070949
640 Ga0207428_10003912
641 Ga0207428_10006777
642 Ga0207428_10031906
643 Ga0268264_10066736
644 Ga0268264_10475719
645 Ga0265330_10033832
646 Ga0265332_10046081
647 Ga0265328_10011349
648 Ga0265325_10001368
649 Ga0265340_10000524
650 Ga0265339_10013616
651 Ga0265331_10007406
652 Ga0265316_10062438
653 Ga0265313_10002468
654 Ga0265314_10032020
655 Ga0307416_101639483
656 Ga0373949_0077697
657 Ga0373956_0151239
658 Ga0373943_0140940
659 Ga0373935_0006650
660 Ga0373933_0009614
661 Ga0373933_0164687
662 Ga0373947_0038265
663 Ga0373937_0000180
664 Ga0373937_0022636
665 Ga0373937_0093201
666 Ga0373937_0815784
667 Ga0373937_0893078
668 Ga0373925_0028550
669 Ga0395901_0428896
670 Ga0451797_0903606
671 Ga0451837_1422128
672 Ga0439443_036898
673 Ga0439448_0068817
674 Ga0439460_0128342
675 Ga0453684_0963557
676 Ga0466967_0318208
677 Ga0495651_0102182
678 Ga0495580_0011537
679 Ga0495580_0202825
680 Ga0495580_0203580
681 Ga0495587_0178082
682 Ga0495623_0038613
683 Ga0495658_0050073
684 Ga0496102_0880489
685 Ga0496104_0009231
686 Ga0496105_0050806
687 Ga0496105_0092649
688 Ga0496105_0127846
689 Ga0496107_0885768
690 Ga0496110_0147665
691 Ga0496110_0188267
692 Ga0496111_0008676
693 Ga0496112_0000597
694 Ga0496112_0063493
695 Ga0496113_0010029
696 Ga0496115_0147674
697 Ga0501031_0005130
698 Ga0501031_0051563
699 Ga0501031_0091082
700 Ga0501032_0005617
701 Ga0501032_0138695
702 Ga0501032_0183163
703 Ga0501033_0000814
704 Ga0501033_0005807
705 Ga0501033_0015353
706 Ga0501034_0003301
707 Ga0501034_0016308
708 Ga0501034_0026559
709 Ga0501034_0059633
710 Ga0501034_0061241
711 Ga0501034_0074057
712 Ga0501034_0203533
713 Ga0501034_0667900
714 Ga0501036_0034624
715 Ga0501036_0080874
716 Ga0501036_0104846
717 Ga0501036_0177962
718 Ga0501036_0178248
719 Ga0501036_0190981
720 Ga0501036_0280882
721 Ga0501036_0319114
722 Ga0501036_0603378
723 Ga0501036_0671697
724 Ga0501037_0013511
725 Ga0501037_0091043
726 Ga0501037_0152506
727 Ga0501037_0403269
728 Ga0501038_0012115
729 Ga0501038_0027867
730 Ga0501038_0090903
731 Ga0501038_0347629
732 Ga0501038_0656455
733 Ga0501039_0031413
734 Ga0501039_0042841
735 Ga0501039_0053495
736 Ga0501039_0074101
737 Ga0501039_0099914
738 Ga0501039_0256332
739 Ga0501040_0001403
740 Ga0501040_0004865
741 Ga0501040_0031844
742 Ga0501040_0047578
743 Ga0501040_0060871
744 Ga0501040_0076251
745 Ga0501040_0079095
746 Ga0501040_0124087
747 Ga0501040_0250609
748 Ga0501041_0010301
749 Ga0501041_0113549
750 Ga0501041_0144540
751 Ga0501041_0148382
752 Ga0501041_0461030
753 Ga0501042_0004290
754 Ga0501042_0008098
755 Ga0501042_0050733
756 Ga0501042_0051493
757 Ga0501042_0060328
758 Ga0501042_0062455
759 Ga0501042_0185606
760 Ga0501042_0279850
761 Ga0501042_0520539
762 Ga0501043_0004454
763 Ga0501043_0010648
764 Ga0501043_0021596
765 Ga0501043_0074359
766 Ga0501046_0018340
767 Ga0501046_0020546
768 Ga0501046_0065911
769 Ga0501046_0077133
770 Ga0501046_0303781
771 Ga0501046_0498207
772 Ga0501047_0062098
773 Ga0501047_0105390
774 Ga0501048_0009270
775 Ga0501048_0009345
776 Ga0501048_0040052
777 Ga0501048_0045112
778 Ga0501048_0091566
779 Ga0501048_0260552
780 Ga0501067_0162604
781 Ga0501068_0022647
782 Ga0501068_0177919
783 Ga0501069_0001135
784 Ga0501069_0082489
785 Ga0501069_0128560
786 Ga0501070_0028995
787 Ga0501070_0051763
788 Ga0501070_0055726
789 Ga0501070_0078660
790 Ga0501070_0367604
791 Ga0501071_0000470
792 Ga0501071_0000564
793 Ga0501071_0011856
794 Ga0501071_0013640
795 Ga0501071_0016998
796 Ga0501071_0023920
797 Ga0501071_0070639
798 Ga0501071_0089914
799 Ga0501071_0166012
800 Ga0501071_0176216
801 Ga0501071_0515748
802 Ga0501072_0004163
803 Ga0501072_0004537
804 Ga0501072_0010045
805 Ga0501072_0010541
806 Ga0501072_0019471
807 Ga0501072_0036903
808 Ga0501072_0038317
809 Ga0501072_0061224
810 Ga0501072_0082459
811 Ga0501072_0137762
812 Ga0501073_0003595
813 Ga0501073_0028241
814 Ga0501073_0433879
815 Ga0501073_0697571
816 Ga0501074_0012673
817 Ga0501074_0021271
818 Ga0501074_0033699
819 Ga0501074_0043901
820 Ga0501074_0113298
821 Ga0501074_0209624
822 Ga0501075_0002305
823 Ga0501075_0006263
824 Ga0501075_0008270
825 Ga0501075_0049455
826 Ga0501075_0094360
827 Ga0501075_0248507
828 Ga0501075_0483050
829 Ga0501076_0003097
830 Ga0501076_0006294
831 Ga0501076_0015421
832 Ga0501076_0019114
833 Ga0501076_0034245
834 Ga0501076_0043663
835 Ga0501076_0061882
836 Ga0501076_0076704
837 Ga0501076_0103115
838 Ga0501076_0134636
839 Ga0501076_0179996
840 Ga0501076_0279914
841 Ga0501077_0002856
842 Ga0501077_0006423
843 Ga0501077_0007017
844 Ga0501077_0089043
845 Ga0501077_0138671
846 Ga0501077_0383059
847 Ga0501079_0017954
848 Ga0501079_0018460
849 Ga0501079_0037031
850 Ga0501079_0072749
851 Ga0501079_0117978
852 Ga0501079_0126980
853 Ga0501079_0184277
854 Ga0501080_0033745
855 Ga0501080_0053298
856 Ga0501080_0058350
857 Ga0501080_0067401
858 Ga0501080_0227477
859 Ga0501080_0262890
860 Ga0501080_0283813
861 Ga0501081_0006489
862 Ga0501081_0009605
863 Ga0501081_0014893
864 Ga0501081_0015872
865 Ga0501081_0026863
866 Ga0501081_0053011
867 Ga0501081_0073857
868 Ga0501081_0074781
869 Ga0501081_0198240
870 Ga0501081_0217633
871 Ga0501081_0221135
872 Ga0501083_0007227
873 Ga0501083_0142730
874 Ga0501083_0255570
875 Ga0501083_0333278
876 Ga0501035_0054060
877 Ga0501035_0061702
878 Ga0501035_0179634
879 Ga0501035_0431420
880 Ga0501044_0001495
881 Ga0501044_0025983
882 Ga0501044_0104901
883 Ga0501044_0452840
884 Ga0501044_0550946
885 Ga0501045_0004721
886 Ga0501045_0016125
887 Ga0501045_0020487
888 Ga0501045_0021253
889 Ga0501045_0099654
890 Ga0501045_0104378
891 Ga0501045_0132979
892 Ga0501045_0159318
893 Ga0501045_0202908
894 Ga0501045_0204175
895 Ga0501045_0510041
896 nmdc:mga03683_250521_c1
897 nmdc:mga03n38_321937_c1
898 nmdc:mga03n38_98975_c1
899 nmdc:mga00v17_13432_c2
900 nmdc:mga00v17_225692_c1
901 nmdc:mga00v17_62889_c1
902 nmdc:mga0yw44_39795_c1
903 nmdc:mga0k408_2158_c1
904 nmdc:mga06z11_1207_c1
905 nmdc:mga06z11_281135_c1
906 nmdc:mga06z11_57097_c1
907 nmdc:mga06z11_92129_c1
908 nmdc:mga04h51_11137_c1
909 nmdc:mga04h51_84475_c1
910 nmdc:mga07m45_279771_c1
911 nmdc:mga07m45_4151_c1
912 nmdc:mga05p37_76117_c1
913 nmdc:mga0qj67_516618_c1
914 nmdc:mga0qj67_576491_c1
915 nmdc:mga06r32_166760_c1
916 nmdc:mga06r32_41855_c1
917 nmdc:mga08y16_1511_c1
918 nmdc:mga08y16_2155_c1
919 nmdc:mga08y16_244841_c1
920 nmdc:mga08y16_28685_c1
921 nmdc:mga08y16_384903_c1
922 nmdc:mga08x19_1253_c1
923 Ga0495601_0018140
924 Ga0501084_0012046
925 Ga0501084_0024944
926 Ga0501084_0033846
927 Ga0501084_0044046
928 Ga0501084_0057303
929 Ga0501084_0077193
930 Ga0501084_0119042
931 Ga0501084_0135944
932 Ga0501084_0152664
933 Ga0501084_0291554
934 Ga0501084_0445133
935 Ga0501082_0005565
936 Ga0501082_0032926
937 Ga0501082_0107303
938 Ga0501082_0139306
939 Ga0501082_0162320
940 Ga0501082_0355932
941 Ga0530510_0004158
942 Ga0530510_0007693
943 Ga0530510_0010158
944 Ga0530510_0015699
945 Ga0530510_0016578
946 Ga0530510_0078448
947 Ga0530510_0106081
948 Ga0530510_0192920
949 2526063379
950 2740064012

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00037

Fer4

4Fe-4S binding domain

33

52

0.94

PF13237

Fer4_10

4Fe-4S dicluster domain

72

124

0.94

PF12797

Fer4_2

4Fe-4S binding domain

31

52

0.93

PF13247

Fer4_11

4Fe-4S dicluster domain

71

169

0.93

Map