F451298

General Info

Members Datasets Scaffolds Average Seq Length
475 276 475 117

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100050986|Ga0070689_1000509863
Length 132
Sequence MSRRLGAGLARRGSEAPVRQLHLRVAPPRDALDRFEAAWNRVAEGGRQVELRVLTLRDLPLLVATLSPARWALLRDLGGAGPTSIYGLAKRLGRDYKNVHTDVTQLARLGLIERRGDGVAVAWRIVRAELSL

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
137 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
138 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
142 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
143 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
144 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
145 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
146 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
147 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
148 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
149 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
150 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
151 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
153 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
154 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
174 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
177 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
178 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
179 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
180 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
181 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
182 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
183 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
184 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
185 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
186 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
187 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
188 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
189 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
190 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
191 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
204 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
217 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
218 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
222 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
238 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
254 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
255 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
276 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 0.84
Rhizosphere 98.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10610795 3300005293 Bacteria 701
2 Ga0070683_100191085 3300005329 Bacteria 1944
3 Ga0070690_101288534 3300005330 Unclassified 585
4 Ga0068869_100001790 3300005334 Bacteria 12887
5 Ga0070680_100009580 3300005336 Bacteria 7444
6 Ga0070682_100067321 3300005337 Bacteria 2281
7 Ga0068868_100015142 3300005338 Bacteria 5698
8 Ga0068868_101176093 3300005338 Bacteria 708
9 Ga0070689_100000354 3300005340 Bacteria 26944
10 Ga0070689_100050986 3300005340 Bacteria 3197
11 Ga0070689_100179743 3300005340 Bacteria 1718
12 Ga0070689_100207302 3300005340 Bacteria 1603
13 Ga0070689_101577004 3300005340 Bacteria 596
14 Ga0070691_10001025 3300005341 Bacteria 11482
15 Ga0070691_10362200 3300005341 Bacteria 808
16 Ga0070691_10532147 3300005341 Bacteria 684
17 Ga0070687_100000710 3300005343 Bacteria 11087
18 Ga0070687_100044548 3300005343 Bacteria 2260
19 Ga0070687_101290335 3300005343 Bacteria 542
20 Ga0070692_10216317 3300005345 Bacteria 1130
21 Ga0070692_10279581 3300005345 Bacteria 1011
22 Ga0070675_100798998 3300005354 Bacteria 862
23 Ga0070674_100276893 3300005356 Bacteria 1328
24 Ga0070673_100304511 3300005364 Bacteria 1404
25 Ga0070688_100166888 3300005365 Bacteria 1516
26 Ga0070703_10006186 3300005406 Bacteria 3350
27 Ga0070710_10553129 3300005437 Bacteria 795
28 Ga0070701_10000907 3300005438 Bacteria 10713
29 Ga0070701_10439694 3300005438 Bacteria 835
30 Ga0070705_100000902 3300005440 Bacteria 16577
31 Ga0070705_100018068 3300005440 Bacteria 3690
32 Ga0070700_100015380 3300005441 Bacteria 4337
33 Ga0070700_100756537 3300005441 Bacteria 778
34 Ga0070700_101223150 3300005441 Bacteria 628
35 Ga0070694_100001920 3300005444 Bacteria 12300
36 Ga0070694_100097732 3300005444 Bacteria 2072
37 Ga0070694_100099062 3300005444 Bacteria 2059
38 Ga0070694_100115709 3300005444 Bacteria 1917
39 Ga0070708_100176550 3300005445 Bacteria 1996
40 Ga0070681_10109171 3300005458 Bacteria 2707
41 Ga0070681_10676740 3300005458 Bacteria 947
42 Ga0068867_100000656 3300005459 Bacteria 22876
43 Ga0070685_11037130 3300005466 Bacteria 617
44 Ga0070706_100032346 3300005467 Bacteria 4825
45 Ga0070707_101153497 3300005468 Unclassified 741
46 Ga0070699_100008087 3300005518 Bacteria 9130
47 Ga0070699_100022732 3300005518 Bacteria 5405
48 Ga0070699_100298934 3300005518 Bacteria 1444
49 Ga0070699_102227877 3300005518 Unclassified 500
50 Ga0070684_100728932 3300005535 Bacteria 925
51 Ga0070684_100932422 3300005535 Bacteria 814
52 Ga0070697_100005347 3300005536 Bacteria 9873
53 Ga0070697_100021112 3300005536 Bacteria 5157
54 Ga0070697_100577440 3300005536 Bacteria 987
55 Ga0070697_100889286 3300005536 Bacteria 790
56 Ga0068853_101071231 3300005539 Bacteria 777
57 Ga0070686_100000107 3300005544 Bacteria 57801
58 Ga0070686_100241382 3300005544 Bacteria 1316
59 Ga0070695_100001550 3300005545 Bacteria 12825
60 Ga0070695_100047842 3300005545 Bacteria 2733
61 Ga0070695_100050036 3300005545 Bacteria 2677
62 Ga0070695_100145042 3300005545 Bacteria 1651
63 Ga0070695_100189347 3300005545 Bacteria 1463
64 Ga0070696_100002104 3300005546 Bacteria 13090
65 Ga0070696_100025195 3300005546 Bacteria 4043
66 Ga0070696_100052874 3300005546 Bacteria 2826
67 Ga0070693_100000606 3300005547 Bacteria 15861
68 Ga0070693_101326684 3300005547 Bacteria 557
69 Ga0070704_100000347 3300005549 Bacteria 21003
70 Ga0070704_100409528 3300005549 Bacteria 1159
71 Ga0068855_100004392 3300005563 Bacteria 17233
72 Ga0068855_100373055 3300005563 Bacteria 1568
73 Ga0070664_100704044 3300005564 Bacteria 941
74 Ga0068854_100037770 3300005578 Bacteria 3391
75 Ga0068854_100258513 3300005578 Bacteria 1393
76 Ga0068856_100019751 3300005614 Bacteria 6538
77 Ga0068856_100093411 3300005614 Bacteria 2994
78 Ga0068856_100115404 3300005614 Bacteria 2685
79 Ga0070702_100000219 3300005615 Bacteria 19216
80 Ga0070702_100100019 3300005615 Bacteria 1777
81 Ga0070702_100497998 3300005615 Unclassified 894
82 Ga0070702_100528924 3300005615 Unclassified 871
83 Ga0068852_100141209 3300005616 Bacteria 2229
84 Ga0068859_100004135 3300005617 Bacteria 14814
85 Ga0068859_100277592 3300005617 Bacteria 1768
86 Ga0068864_100359865 3300005618 Bacteria 1375
87 Ga0068864_101146724 3300005618 Unclassified 775
88 Ga0068866_10000328 3300005718 Bacteria 22471
89 Ga0068861_100032569 3300005719 Bacteria 3838
90 Ga0068870_10157723 3300005840 Bacteria 1343
91 Ga0068863_100131990 3300005841 Bacteria 2385
92 Ga0068863_100858432 3300005841 Bacteria 907
93 Ga0068858_100000324 3300005842 Bacteria 50505
94 Ga0068858_100236612 3300005842 Bacteria 1732
95 Ga0068860_100000836 3300005843 Bacteria 34455
96 Ga0068860_101012935 3300005843 Bacteria 849
97 Ga0068862_100025993 3300005844 Bacteria 4919
98 Ga0068862_100932720 3300005844 Bacteria 855
99 Ga0068862_100995430 3300005844 Unclassified 829
100 Ga0081539_10000188 3300005985 Bacteria 143987
101 Ga0070715_10021589 3300006163 Bacteria 2499
102 Ga0070712_100718625 3300006175 Bacteria 853
103 Ga0075362_10147041 3300006177 Bacteria 1129
104 Ga0097621_100004271 3300006237 Bacteria 9924
105 Ga0097621_100029516 3300006237 Bacteria 4332
106 Ga0097621_100700006 3300006237 Bacteria 933
107 Ga0068871_100012982 3300006358 Bacteria 6169
108 Ga0068871_100042805 3300006358 Bacteria 3637
109 Ga0075428_100035134 3300006844 Bacteria 5525
110 Ga0075428_101011566 3300006844 Bacteria 880
111 Ga0075430_100098829 3300006846 Bacteria 2438
112 Ga0075430_100598232 3300006846 Unclassified 910
113 Ga0075430_101117479 3300006846 Unclassified 649
114 Ga0075433_10000496 3300006852 Bacteria 25626
115 Ga0075433_10065177 3300006852 Bacteria 3195
116 Ga0075433_10967463 3300006852 Bacteria 742
117 Ga0075434_100007441 3300006871 Bacteria 10129
118 Ga0075434_100022419 3300006871 Bacteria 6151
119 Ga0075434_100152138 3300006871 Bacteria 2334
120 Ga0075434_100540066 3300006871 Bacteria 1186
121 Ga0075429_100000121 3300006880 Bacteria 45679
122 Ga0075429_100500343 3300006880 Bacteria 1065
123 Ga0068865_100001679 3300006881 Bacteria 12960
124 Ga0075436_100004877 3300006914 Bacteria 9222
125 Ga0075436_100007640 3300006914 Bacteria 7386
126 Ga0075436_100019372 3300006914 Bacteria 4663
127 Ga0075436_100019533 3300006914 Bacteria 4643
128 Ga0075436_100270189 3300006914 Bacteria 1214
129 Ga0097620_100004135 3300006931 Bacteria 14814
130 Ga0097620_100277597 3300006931 Bacteria 1768
131 Ga0075435_100000808 3300007076 Bacteria 19486
132 Ga0075435_100035448 3300007076 Bacteria 3960
133 Ga0075435_101027696 3300007076 Bacteria 720
134 Ga0099794_10228060 3300007265 Bacteria 958
135 Ga0105250_10294990 3300009092 Bacteria 700
136 Ga0111539_10011015 3300009094 Bacteria 11383
137 Ga0111539_10021238 3300009094 Bacteria 7993
138 Ga0111539_10129258 3300009094 Bacteria 2958
139 Ga0105245_10006327 3300009098 Bacteria 10418
140 Ga0105245_10888703 3300009098 Bacteria 932
141 Ga0114129_10000140 3300009147 Bacteria 75593
142 Ga0114129_10057107 3300009147 Bacteria 5464
143 Ga0114129_10203742 3300009147 Bacteria 2678
144 Ga0114129_11452947 3300009147 Unclassified 844
145 Ga0105243_10001708 3300009148 Bacteria 18921
146 Ga0105241_10584155 3300009174 Bacteria 1007
147 Ga0105242_10000703 3300009176 Bacteria 26168
148 Ga0105242_10227952 3300009176 Bacteria 1668
149 Ga0105248_10083010 3300009177 Bacteria 3604
150 Ga0105248_10893060 3300009177 Unclassified 1003
151 Ga0105237_11706497 3300009545 Bacteria 637
152 Ga0105249_10003012 3300009553 Bacteria 14533
153 Ga0105249_12644386 3300009553 Bacteria 574
154 Ga0099796_10220008 3300010159 Bacteria 778
155 Ga0105239_10049925 3300010375 Bacteria 4588
156 Ga0105239_11682078 3300010375 Unclassified 734
157 Ga0105246_10075054 3300011119 Bacteria 2393
158 Ga0157371_10235480 3300013102 Bacteria 1316
159 Ga0157374_10357511 3300013296 Bacteria 1452
160 Ga0157378_10052844 3300013297 Bacteria 3615
161 Ga0163162_10722978 3300013306 Bacteria 1116
162 Ga0157375_10465820 3300013308 Bacteria 1429
163 Ga0157380_11319996 3300014326 Bacteria 769
164 Ga0157377_10375928 3300014745 Bacteria 960
165 Ga0157376_10013539 3300014969 Bacteria 6091
166 Ga0157376_10154862 3300014969 Bacteria 2071
167 Ga0157376_13002049 3300014969 Unclassified 511
168 Ga0213871_10090604 3300021441 Unclassified 886
169 Ga0207653_10018040 3300025885 Bacteria 2223
170 Ga0207642_10001059 3300025899 Bacteria 8533
171 Ga0207688_10368256 3300025901 Bacteria 887
172 Ga0207685_10213814 3300025905 Bacteria 913
173 Ga0207685_10367736 3300025905 Unclassified 729
174 Ga0207643_10133767 3300025908 Bacteria 1477
175 Ga0207684_10074098 3300025910 Bacteria 2892
176 Ga0207654_11222759 3300025911 Bacteria 548
177 Ga0207707_10083467 3300025912 Bacteria 2790
178 Ga0207707_10631688 3300025912 Bacteria 904
179 Ga0207693_10510386 3300025915 Bacteria 938
180 Ga0207660_10020295 3300025917 Bacteria 4456
181 Ga0207662_10000993 3300025918 Bacteria 13238
182 Ga0207662_10020347 3300025918 Bacteria 3786
183 Ga0207662_11000531 3300025918 Unclassified 593
184 Ga0207646_10396651 3300025922 Bacteria 1246
185 Ga0207646_11565605 3300025922 Unclassified 569
186 Ga0207687_10204975 3300025927 Bacteria 1544
187 Ga0207700_10428002 3300025928 Bacteria 1164
188 Ga0207686_10007801 3300025934 Bacteria 5770
189 Ga0207686_10332571 3300025934 Bacteria 1138
190 Ga0207709_10001744 3300025935 Bacteria 14631
191 Ga0207709_11097817 3300025935 Bacteria 653
192 Ga0207670_10002341 3300025936 Bacteria 9929
193 Ga0207670_10075047 3300025936 Bacteria 2349
194 Ga0207670_10172017 3300025936 Bacteria 1625
195 Ga0207670_10225645 3300025936 Bacteria 1436
196 Ga0207669_10494705 3300025937 Bacteria 977
197 Ga0207704_10028217 3300025938 Bacteria 3110
198 Ga0207691_11325723 3300025940 Bacteria 594
199 Ga0207711_10068688 3300025941 Bacteria 3070
200 Ga0207689_10002082 3300025942 Bacteria 18876
201 Ga0207661_10215019 3300025944 Bacteria 1696
202 Ga0207667_10118069 3300025949 Bacteria 2734
203 Ga0207667_10823388 3300025949 Bacteria 924
204 Ga0207651_10685168 3300025960 Bacteria 902
205 Ga0207712_10015318 3300025961 Bacteria 4943
206 Ga0207640_10017445 3300025981 Bacteria 4200
207 Ga0207658_12171757 3300025986 Bacteria 504
208 Ga0207677_10063377 3300026023 Bacteria 2569
209 Ga0207677_11747547 3300026023 Bacteria 577
210 Ga0207703_10023007 3300026035 Bacteria 4892
211 Ga0207703_10107973 3300026035 Bacteria 2370
212 Ga0207703_10232947 3300026035 Bacteria 1652
213 Ga0207639_10826144 3300026041 Bacteria 864
214 Ga0207708_10003381 3300026075 Bacteria 11762
215 Ga0207708_10384738 3300026075 Bacteria 1157
216 Ga0207702_10069665 3300026078 Bacteria 3024
217 Ga0207702_10115816 3300026078 Bacteria 2391
218 Ga0207702_10252922 3300026078 Bacteria 1655
219 Ga0207641_10059939 3300026088 Bacteria 3243
220 Ga0207641_10704053 3300026088 Unclassified 995
221 Ga0207648_10000171 3300026089 Bacteria 67246
222 Ga0207675_100000321 3300026118 Bacteria 45579
223 Ga0209967_1001457 3300027364 Bacteria 3033
224 Ga0209981_1006155 3300027378 Bacteria 1603
225 Ga0210000_1000915 3300027462 Bacteria 4112
226 Ga0209971_1057190 3300027682 Bacteria 943
227 Ga0209966_1006295 3300027695 Bacteria 2057
228 Ga0209966_1088827 3300027695 Unclassified 690
229 Ga0209974_10037149 3300027876 Bacteria 1617
230 Ga0207428_10000544 3300027907 Bacteria 44950
231 Ga0207428_10101856 3300027907 Bacteria 2218
232 Ga0207428_10221371 3300027907 Bacteria 1418
233 Ga0268265_10013266 3300028380 Bacteria 5599
234 Ga0268265_10918834 3300028380 Bacteria 860
235 Ga0268265_11424454 3300028380 Bacteria 695
236 Ga0268264_10000745 3300028381 Bacteria 36883
237 Ga0307408_101638996 3300031548 Bacteria 612
238 Ga0316575_10071029 3300031665 Bacteria 1398
239 Ga0316579_10032127 3300031691 Bacteria 2406
240 Ga0316578_10083273 3300031728 Bacteria 1905
241 Ga0307416_100188388 3300032002 Bacteria 1942
242 Ga0307411_10462254 3300032005 Bacteria 1064
243 Ga0316583_10005541 3300032133 Bacteria 4531
244 Ga0373930_0023791 3300034816 Bacteria 1220
245 Ga0373950_0018851 3300034818 Bacteria 1200
246 Ga0373926_0002730 3300035083 Bacteria 5629
247 Ga0373929_0008931 3300035085 Bacteria 1852
248 Ga0373929_0033815 3300035085 Bacteria 1106
249 Ga0373929_0140762 3300035085 Unclassified 640
250 Ga0373934_0003344 3300035086 Bacteria 5877
251 Ga0373940_0011130 3300035088 Bacteria 2130
252 Ga0373944_0003299 3300035089 Bacteria 4155
253 Ga0373949_0002521 3300035090 Bacteria 4666
254 Ga0373952_0012282 3300035092 Bacteria 1682
255 Ga0373923_0116168 3300035111 Bacteria 1192
256 Ga0373932_0017089 3300035112 Bacteria 1858
257 Ga0373939_0266008 3300035114 Bacteria 672
258 Ga0373941_0495387 3300035115 Unclassified 519
259 Ga0373945_0016830 3300035116 Bacteria 2471
260 Ga0373953_0106823 3300035117 Bacteria 1181
261 Ga0373953_0204224 3300035117 Unclassified 855
262 Ga0373953_0499891 3300035117 Bacteria 539
263 Ga0373954_0000001 3300035118 Bacteria 158201
264 Ga0373954_0184972 3300035118 Bacteria 1022
265 Ga0373956_0039456 3300035119 Bacteria 2093
266 Ga0373956_0267852 3300035119 Bacteria 813
267 Ga0373956_0366285 3300035119 Bacteria 687
268 Ga0373957_0024725 3300035120 Bacteria 2159
269 Ga0373957_0550894 3300035120 Unclassified 504
270 Ga0373943_0097393 3300035170 Bacteria 1532
271 Ga0373943_0107759 3300035170 Bacteria 1465
272 Ga0373946_0015100 3300035171 Bacteria 2922
273 Ga0373955_0013563 3300035172 Bacteria 3945
274 Ga0373955_0142567 3300035172 Bacteria 1406
275 Ga0373955_0204507 3300035172 Bacteria 1176
276 Ga0373961_0009693 3300035241 Bacteria 2360
277 Ga0373962_0252629 3300035242 Bacteria 612
278 Ga0316574_0796490 3300035398 Bacteria 575
279 Ga0373924_0009847 3300035410 Bacteria 3513
280 Ga0373924_0050300 3300035410 Bacteria 1726
281 Ga0373931_0000474 3300035691 Bacteria 16364
282 Ga0373931_0020186 3300035691 Bacteria 3331
283 Ga0373931_0077001 3300035691 Bacteria 1833
284 Ga0373931_0599983 3300035691 Bacteria 720
285 Ga0373935_0035605 3300035692 Bacteria 3107
286 Ga0373935_0523545 3300035692 Unclassified 862
287 Ga0373935_1084188 3300035692 Bacteria 596
288 Ga0373927_0013771 3300035695 Bacteria 5367
289 Ga0373927_0271802 3300035695 Bacteria 1114
290 Ga0373933_0002321 3300035724 Bacteria 10800
291 Ga0373933_0005099 3300035724 Bacteria 7165
292 Ga0373933_0166888 3300035724 Bacteria 1400
293 Ga0373933_0662960 3300035724 Bacteria 686
294 Ga0373947_0170075 3300035725 Bacteria 1413
295 Ga0373947_0357527 3300035725 Unclassified 980
296 Ga0373937_0002024 3300036401 Bacteria 16919
297 Ga0373937_0024411 3300036401 Bacteria 5453
298 Ga0373937_0104509 3300036401 Bacteria 2631
299 Ga0373937_0527042 3300036401 Bacteria 1122
300 Ga0316582_0004025 3300036647 Bacteria 7346
301 Ga0316584_0274873 3300036712 Bacteria 1225
302 Ga0373925_0036088 3300037068 Bacteria 3649
303 Ga0373925_0651973 3300037068 Unclassified 867
304 Ga0316581_0032114 3300037588 Bacteria 1583
305 Ga0436360_1181460 3300039438 Bacteria 1976
306 Ga0439436_0099134 3300041404 Bacteria 812
307 Ga0439438_091025 3300041405 Bacteria 743
308 Ga0439453_0021828 3300041408 Bacteria 1157
309 Ga0439461_0000947 3300041410 Bacteria 4347
310 Ga0451807_1260896 3300041486 Bacteria 2152
311 Ga0439441_001825 3300042001 Bacteria 2890
312 Ga0439443_011957 3300042003 Bacteria 1279
313 Ga0439456_138391 3300042013 Unclassified 564
314 Ga0439446_0108465 3300042156 Unclassified 884
315 Ga0439434_0000266 3300042435 Bacteria 14813
316 Ga0439435_0000003 3300042436 Bacteria 29035
317 Ga0439444_0004987 3300042437 Bacteria 1953
318 Ga0439460_0002261 3300042461 Bacteria 4632
319 Ga0450916_059353 3300042530 Unclassified 619
320 Ga0451577_2016617 3300042876 Unclassified 504
321 Ga0466960_0517531 3300044901 Bacteria 701
322 Ga0466960_0893329 3300044901 Bacteria 542
323 Ga0451576_0012118 3300045051 Bacteria 9726
324 Ga0451576_0037187 3300045051 Bacteria 5156
325 Ga0451576_0101679 3300045051 Bacteria 2989
326 Ga0495592_0000274 3300046454 Bacteria 44078
327 Ga0495603_0003125 3300046455 Bacteria 9845
328 Ga0495629_0164917 3300046459 Bacteria 1539
329 Ga0495651_0713272 3300046462 Bacteria 624
330 Ga0495653_0256126 3300046463 Bacteria 1159
331 Ga0495580_0017287 3300046472 Bacteria 5397
332 Ga0495582_0144306 3300046473 Bacteria 1350
333 Ga0495582_0171182 3300046473 Bacteria 1236
334 Ga0495639_0025562 3300046475 Bacteria 2605
335 Ga0495639_0060897 3300046475 Bacteria 1730
336 Ga0495662_0015364 3300046476 Bacteria 3718
337 Ga0495662_0031701 3300046476 Bacteria 2553
338 Ga0495664_0420110 3300046477 Bacteria 802
339 Ga0495608_0013519 3300046511 Bacteria 5661
340 Ga0495608_0477174 3300046511 Unclassified 757
341 Ga0495618_0008843 3300046514 Bacteria 6082
342 Ga0495628_0000155 3300046516 Bacteria 59667
343 Ga0495630_0001341 3300046517 Bacteria 16911
344 Ga0495666_0008802 3300046526 Bacteria 5056
345 Ga0495652_0165973 3300046529 Bacteria 1709
346 Ga0495652_0205117 3300046529 Bacteria 1493
347 Ga0495652_0279301 3300046529 Bacteria 1224
348 Ga0495640_0000470 3300046533 Bacteria 29526
349 Ga0495640_0017100 3300046533 Bacteria 5412
350 Ga0495586_0003028 3300046535 Bacteria 9061
351 Ga0495587_0032560 3300046536 Bacteria 3151
352 Ga0495598_0005928 3300046537 Bacteria 2734
353 Ga0495645_0033726 3300046543 Bacteria 3735
354 Ga0495622_0433134 3300046557 Bacteria 565
355 Ga0495667_0001302 3300046559 Bacteria 16361
356 Ga0495667_0080091 3300046559 Bacteria 2123
357 Ga0495667_0220656 3300046559 Bacteria 1210
358 Ga0495656_0226191 3300046615 Bacteria 937
359 Ga0495634_0003300 3300046642 Bacteria 13011
360 Ga0495635_0010007 3300046663 Bacteria 6631
361 Ga0495635_0019885 3300046663 Bacteria 4679
362 Ga0495635_0076184 3300046663 Bacteria 2299
363 Ga0495599_0003173 3300046678 Bacteria 9574
364 Ga0495647_0037753 3300046681 Bacteria 1824
365 Ga0495647_0121944 3300046681 Bacteria 1097
366 Ga0495658_0012227 3300046683 Bacteria 4339
367 Ga0495613_0000960 3300046689 Bacteria 22044
368 Ga0495613_0743928 3300046689 Bacteria 643
369 Ga0495624_0025098 3300046690 Bacteria 3917
370 Ga0495600_0015921 3300046809 Bacteria 4764
371 Ga0495604_0001586 3300047317 Bacteria 18731
372 Ga0495604_0158670 3300047317 Bacteria 1600
373 Ga0495604_0874054 3300047317 Unclassified 563
374 Ga0495636_0000352 3300047318 Bacteria 17535
375 Ga0495674_0175309 3300047319 Bacteria 1787
376 Ga0495674_0788972 3300047319 Bacteria 740
377 Ga0495676_0094476 3300047321 Bacteria 2227
378 Ga0495680_0000202 3300047322 Bacteria 64368
379 Ga0495680_0079858 3300047322 Bacteria 2473
380 Ga0495680_0427565 3300047322 Unclassified 910
381 Ga0495684_1023274 3300047471 Unclassified 523
382 Ga0495593_0236526 3300047673 Bacteria 915
383 Ga0495593_0249881 3300047673 Bacteria 888
384 Ga0496106_0632025 3300048909 Bacteria 856
385 Ga0496112_1512049 3300048915 Unclassified 585
386 Ga0496114_0523027 3300048917 Bacteria 1049
387 Ga0501299_203090 3300049522 Unclassified 527
388 Ga0501031_0103606 3300049568 Bacteria 1857
389 Ga0501031_1041512 3300049568 Unclassified 523
390 Ga0501033_0134818 3300049570 Bacteria 1787
391 Ga0501036_0643062 3300049572 Unclassified 878
392 Ga0501036_0848822 3300049572 Bacteria 751
393 Ga0501036_1675428 3300049572 Unclassified 513
394 Ga0501038_0033404 3300049574 Bacteria 4533
395 Ga0501038_0344208 3300049574 Bacteria 1162
396 Ga0501039_0016663 3300049575 Bacteria 5629
397 Ga0501039_0035648 3300049575 Bacteria 3840
398 Ga0501039_0119010 3300049575 Bacteria 2069
399 Ga0501040_0001554 3300049576 Bacteria 14605
400 Ga0501040_0031718 3300049576 Bacteria 3573
401 Ga0501040_0897749 3300049576 Bacteria 642
402 Ga0501041_0007932 3300049577 Bacteria 6242
403 Ga0501041_0047670 3300049577 Bacteria 2608
404 Ga0501041_1094370 3300049577 Unclassified 514
405 Ga0501042_0071446 3300049578 Bacteria 2483
406 Ga0501042_0578817 3300049578 Bacteria 816
407 Ga0501046_0132752 3300049580 Bacteria 1888
408 Ga0501046_0323493 3300049580 Bacteria 1123
409 Ga0501048_0007565 3300049582 Bacteria 8236
410 Ga0501048_0024128 3300049582 Bacteria 4441
411 Ga0501071_0317387 3300049587 Bacteria 1183
412 Ga0501071_1274409 3300049587 Bacteria 568
413 Ga0501072_0020854 3300049588 Bacteria 5080
414 Ga0501072_0039913 3300049588 Bacteria 3685
415 Ga0501072_0251037 3300049588 Bacteria 1409
416 Ga0501074_0031021 3300049590 Bacteria 3873
417 Ga0501074_0070493 3300049590 Bacteria 2513
418 Ga0501075_0006283 3300049591 Bacteria 8164
419 Ga0501075_0159503 3300049591 Bacteria 1720
420 Ga0501076_0056882 3300049592 Bacteria 3104
421 Ga0501076_0128473 3300049592 Bacteria 2054
422 Ga0501077_0004607 3300049593 Bacteria 8371
423 Ga0501216_087676 3300049660 Unclassified 668
424 Ga0501233_151246 3300049668 Unclassified 648
425 Ga0501079_0004381 3300049741 Bacteria 10458
426 Ga0501080_0100154 3300049742 Bacteria 2688
427 Ga0501081_0000975 3300049743 Bacteria 17007
428 Ga0501081_0027284 3300049743 Bacteria 3852
429 Ga0501083_0203172 3300049744 Bacteria 1292
430 Ga0501035_0227357 3300049822 Bacteria 1591
431 Ga0501045_0028724 3300049824 Bacteria 4013
432 Ga0501045_0041550 3300049824 Bacteria 3346
433 nmdc:mga03683_439208_c1 3300050489 Bacteria 627
434 nmdc:mga05p37_1258557_c1 3300050507 Unclassified 758
435 nmdc:mga05p37_137_c1 3300050507 Bacteria 67873
436 nmdc:mga05p37_488438_c1 3300050507 Bacteria 1416
437 nmdc:mga05p37_914645_c1 3300050507 Unclassified 944
438 nmdc:mga09592_1371_c1 3300050508 Bacteria 19521
439 nmdc:mga09592_1748505_c1 3300050508 Unclassified 500
440 nmdc:mga09592_198207_c1 3300050508 Bacteria 1739
441 nmdc:mga09592_295617_c1 3300050508 Bacteria 1404
442 nmdc:mga0qj67_363565_c1 3300050509 Unclassified 1169
443 nmdc:mga0qj67_457506_c1 3300050509 Bacteria 1028
444 nmdc:mga0qj67_772269_c1 3300050509 Bacteria 762
445 nmdc:mga06r32_259159_c1 3300050510 Bacteria 1727
446 nmdc:mga06r32_504105_c1 3300050510 Bacteria 1187
447 nmdc:mga08y16_12448_c1 3300050511 Bacteria 8950
448 nmdc:mga08y16_1517_c1 3300050511 Bacteria 23363
449 nmdc:mga08y16_45414_c1 3300050511 Bacteria 4603
450 nmdc:mga0n895_1161146_c1 3300050512 Bacteria 747
451 nmdc:mga0n895_134_c1 3300050512 Bacteria 44336
452 nmdc:mga0n895_15290_c1 3300050512 Bacteria 6992
453 nmdc:mga0n895_178188_c1 3300050512 Bacteria 2156
454 nmdc:mga0n895_225358_c1 3300050512 Bacteria 1903
455 nmdc:mga0n895_313882_c1 3300050512 Bacteria 1589
456 nmdc:mga0rr50_1316109_c1 3300050513 Unclassified 613
457 nmdc:mga0rr50_194086_c1 3300050513 Bacteria 1665
458 nmdc:mga0rr50_291066_c1 3300050513 Bacteria 1365
459 nmdc:mga0rr50_3607_c1 3300050513 Bacteria 8947
460 nmdc:mga08x19_102325_c1 3300050514 Bacteria 1902
461 nmdc:mga08x19_17452_c1 3300050514 Bacteria 4391
462 nmdc:mga08x19_2898_c1 3300050514 Bacteria 10326
463 nmdc:mga08x19_3053_c1 3300050514 Bacteria 10064
464 nmdc:mga08x19_420452_c1 3300050514 Bacteria 939
465 nmdc:mga08x19_91342_c1 3300050514 Bacteria 2010
466 nmdc:mga0a205_223661_c1 3300050515 Bacteria 1767
467 nmdc:mga0a205_8520_c1 3300050515 Bacteria 9325
468 nmdc:mga0a205_876004_c1 3300050515 Bacteria 745
469 Ga0495601_0001838 3300053077 Bacteria 11791
470 Ga0495619_0242041 3300053085 Bacteria 1250
471 Ga0501084_0009678 3300054114 Bacteria 7971
472 Ga0501084_0258175 3300054114 Bacteria 1471
473 Ga0501082_0096017 3300060353 Bacteria 2562
474 Ga0501082_0378842 3300060353 Bacteria 1234
475 Ga0530510_0000264 3300061734 Bacteria 33162

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050508 nmdc:mga09592_1748505_c1 nmdc:mga09592_1748505_c1_36_428 103
2 3300035089 Ga0373944_0003299 Ga0373944_0003299_137_508 104
3 3300035170 Ga0373943_0097393 Ga0373943_0097393_318_689 104
4 3300035171 Ga0373946_0015100 Ga0373946_0015100_2314_2685 104
5 3300035692 Ga0373935_0523545 Ga0373935_0523545_448_819 104
6 3300035695 Ga0373927_0271802 Ga0373927_0271802_710_1081 104
7 3300035725 Ga0373947_0357527 Ga0373947_0357527_451_822 104
8 3300037068 Ga0373925_0651973 Ga0373925_0651973_66_437 104
9 3300050507 nmdc:mga05p37_488438_c1 nmdc:mga05p37_488438_c1_597_938 105
10 3300007076 Ga0075435_101027696 Ga0075435_1010276962 107
11 3300050513 nmdc:mga0rr50_194086_c1 nmdc:mga0rr50_194086_c1_1025_1348 107
12 3300035119 Ga0373956_0267852 Ga0373956_0267852_190_522 108
13 3300035172 Ga0373955_0142567 Ga0373955_0142567_561_893 108
14 3300036401 Ga0373937_0104509 Ga0373937_0104509_892_1224 108
15 3300046454 Ga0495592_0000274 Ga0495592_0000274_37729_38061 108
16 3300046463 Ga0495653_0256126 Ga0495653_0256126_560_892 108
17 3300046473 Ga0495582_0171182 Ga0495582_0171182_508_840 108
18 3300046475 Ga0495639_0060897 Ga0495639_0060897_924_1256 108
19 3300046476 Ga0495662_0015364 Ga0495662_0015364_482_814 108
20 3300046477 Ga0495664_0420110 Ga0495664_0420110_253_585 108
21 3300046511 Ga0495608_0013519 Ga0495608_0013519_1266_1598 108
22 3300046514 Ga0495618_0008843 Ga0495618_0008843_335_667 108
23 3300046516 Ga0495628_0000155 Ga0495628_0000155_37485_37817 108
24 3300046517 Ga0495630_0001341 Ga0495630_0001341_5157_5489 108
25 3300046526 Ga0495666_0008802 Ga0495666_0008802_2388_2720 108
26 3300046529 Ga0495652_0205117 Ga0495652_0205117_516_848 108
27 3300046533 Ga0495640_0000470 Ga0495640_0000470_9980_10312 108
28 3300046535 Ga0495586_0003028 Ga0495586_0003028_5279_5611 108
29 3300046536 Ga0495587_0032560 Ga0495587_0032560_269_601 108
30 3300046543 Ga0495645_0033726 Ga0495645_0033726_85_417 108
31 3300046559 Ga0495667_0001302 Ga0495667_0001302_14868_15200 108
32 3300046642 Ga0495634_0003300 Ga0495634_0003300_12078_12410 108
33 3300046663 Ga0495635_0019885 Ga0495635_0019885_122_454 108
34 3300046678 Ga0495599_0003173 Ga0495599_0003173_2003_2335 108
35 3300046683 Ga0495658_0012227 Ga0495658_0012227_3532_3864 108
36 3300046689 Ga0495613_0000960 Ga0495613_0000960_16293_16625 108
37 3300046690 Ga0495624_0025098 Ga0495624_0025098_1393_1725 108
38 3300046809 Ga0495600_0015921 Ga0495600_0015921_2459_2791 108
39 3300047317 Ga0495604_0001586 Ga0495604_0001586_5429_5761 108
40 3300047318 Ga0495636_0000352 Ga0495636_0000352_10882_11214 108
41 3300047319 Ga0495674_0175309 Ga0495674_0175309_824_1156 108
42 3300047322 Ga0495680_0000202 Ga0495680_0000202_35967_36299 108
43 3300047673 Ga0495593_0236526 Ga0495593_0236526_373_705 108
44 3300053077 Ga0495601_0001838 Ga0495601_0001838_11171_11503 108
45 3300053085 Ga0495619_0242041 Ga0495619_0242041_85_417 108
46 3300050489 nmdc:mga03683_439208_c1 nmdc:mga03683_439208_c1_66_401 109
47 3300005341 Ga0070691_10532147 Ga0070691_105321472 111
48 3300005545 Ga0070695_100050036 Ga0070695_1000500362 111
49 3300005547 Ga0070693_101326684 Ga0070693_1013266841 111
50 3300006871 Ga0075434_100022419 Ga0075434_1000224195 111
51 3300009094 Ga0111539_10011015 Ga0111539_100110153 111
52 3300009147 Ga0114129_10000140 Ga0114129_1000014058 111
53 3300010159 Ga0099796_10220008 Ga0099796_102200081 111
54 3300014326 Ga0157380_11319996 Ga0157380_113199962 111
55 3300034816 Ga0373930_0023791 Ga0373930_0023791_690_1031 111
56 3300034818 Ga0373950_0018851 Ga0373950_0018851_566_907 111
57 3300035085 Ga0373929_0033815 Ga0373929_0033815_158_499 111
58 3300035088 Ga0373940_0011130 Ga0373940_0011130_1659_2000 111
59 3300035090 Ga0373949_0002521 Ga0373949_0002521_3943_4284 111
60 3300035092 Ga0373952_0012282 Ga0373952_0012282_209_550 111
61 3300035112 Ga0373932_0017089 Ga0373932_0017089_1468_1809 111
62 3300035114 Ga0373939_0266008 Ga0373939_0266008_37_378 111
63 3300035241 Ga0373961_0009693 Ga0373961_0009693_1603_1944 111
64 3300035242 Ga0373962_0252629 Ga0373962_0252629_232_573 111
65 3300035691 Ga0373931_0000474 Ga0373931_0000474_11229_11570 111
66 3300042876 Ga0451577_2016617 Ga0451577_2016617_115_456 111
67 3300045051 Ga0451576_0012118 Ga0451576_0012118_2087_2428 111
68 3300045051 Ga0451576_0037187 Ga0451576_0037187_2729_3070 111
69 3300046537 Ga0495598_0005928 Ga0495598_0005928_1181_1522 111
70 3300046615 Ga0495656_0226191 Ga0495656_0226191_20_361 111
71 3300050507 nmdc:mga05p37_137_c1 nmdc:mga05p37_137_c1_21322_21663 111
72 3300050508 nmdc:mga09592_1371_c1 nmdc:mga09592_1371_c1_1993_2334 111
73 3300050509 nmdc:mga0qj67_363565_c1 nmdc:mga0qj67_363565_c1_499_840 111
74 3300050511 nmdc:mga08y16_1517_c1 nmdc:mga08y16_1517_c1_2917_3258 111
75 3300050512 nmdc:mga0n895_15290_c1 nmdc:mga0n895_15290_c1_2432_2776 111
76 3300005545 Ga0070695_100189347 Ga0070695_1001893472 112
77 3300006914 Ga0075436_100004877 Ga0075436_1000048779 112
78 3300009098 Ga0105245_10888703 Ga0105245_108887031 112
79 3300009177 Ga0105248_10893060 Ga0105248_108930603 112
80 3300009553 Ga0105249_12644386 Ga0105249_126443861 112
81 3300014969 Ga0157376_10154862 Ga0157376_101548622 112
82 3300035691 Ga0373931_0077001 Ga0373931_0077001_891_1235 112
83 3300035691 Ga0373931_0599983 Ga0373931_0599983_115_453 112
84 3300039438 Ga0436360_1181460 Ga0436360_1181460_759_1103 112
85 3300041404 Ga0439436_0099134 Ga0439436_0099134_275_619 112
86 3300041405 Ga0439438_091025 Ga0439438_091025_184_528 112
87 3300041410 Ga0439461_0000947 Ga0439461_0000947_969_1313 112
88 3300042435 Ga0439434_0000266 Ga0439434_0000266_8049_8393 112
89 3300042436 Ga0439435_0000003 Ga0439435_0000003_7077_7421 112
90 3300046475 Ga0495639_0025562 Ga0495639_0025562_1896_2240 112
91 3300046681 Ga0495647_0037753 Ga0495647_0037753_1422_1766 112
92 3300049572 Ga0501036_0848822 Ga0501036_0848822_212_556 112
93 3300050514 nmdc:mga08x19_3053_c1 nmdc:mga08x19_3053_c1_8007_8345 112
94 3300006871 Ga0075434_100540066 Ga0075434_1005400662 113
95 3300050512 nmdc:mga0n895_178188_c1 nmdc:mga0n895_178188_c1_806_1156 113
96 3300005330 Ga0070690_101288534 Ga0070690_1012885341 114
97 3300005340 Ga0070689_100050986 Ga0070689_1000509863 114
98 3300005340 Ga0070689_100207302 Ga0070689_1002073023 114
99 3300005364 Ga0070673_100304511 Ga0070673_1003045111 114
100 3300005438 Ga0070701_10439694 Ga0070701_104396942 114
101 3300005441 Ga0070700_100756537 Ga0070700_1007565372 114
102 3300005444 Ga0070694_100097732 Ga0070694_1000977323 114
103 3300005444 Ga0070694_100115709 Ga0070694_1001157093 114
104 3300005458 Ga0070681_10676740 Ga0070681_106767402 114
105 3300005466 Ga0070685_11037130 Ga0070685_110371302 114
106 3300005518 Ga0070699_102227877 Ga0070699_1022278771 114
107 3300005535 Ga0070684_100728932 Ga0070684_1007289322 114
108 3300005536 Ga0070697_100005347 Ga0070697_10000534710 114
109 3300005545 Ga0070695_100145042 Ga0070695_1001450421 114
110 3300005549 Ga0070704_100409528 Ga0070704_1004095282 114
111 3300005615 Ga0070702_100100019 Ga0070702_1001000192 114
112 3300005615 Ga0070702_100497998 Ga0070702_1004979983 114
113 3300005618 Ga0068864_101146724 Ga0068864_1011467241 114
114 3300006844 Ga0075428_100035134 Ga0075428_1000351343 114
115 3300006844 Ga0075428_101011566 Ga0075428_1010115662 114
116 3300006880 Ga0075429_100500343 Ga0075429_1005003432 114
117 3300007265 Ga0099794_10228060 Ga0099794_102280602 114
118 3300009094 Ga0111539_10021238 Ga0111539_100212383 114
119 3300009147 Ga0114129_10203742 Ga0114129_102037423 114
120 3300009176 Ga0105242_10227952 Ga0105242_102279523 114
121 3300025934 Ga0207686_10332571 Ga0207686_103325712 114
122 3300025936 Ga0207670_10172017 Ga0207670_101720173 114
123 3300025936 Ga0207670_10225645 Ga0207670_102256452 114
124 3300025960 Ga0207651_10685168 Ga0207651_106851682 114
125 3300026075 Ga0207708_10384738 Ga0207708_103847382 114
126 3300027695 Ga0209966_1006295 Ga0209966_10062953 114
127 3300027876 Ga0209974_10037149 Ga0209974_100371491 114
128 3300027907 Ga0207428_10101856 Ga0207428_101018563 114
129 3300032002 Ga0307416_100188388 Ga0307416_1001883883 114
130 3300032005 Ga0307411_10462254 Ga0307411_104622542 114
131 3300035115 Ga0373941_0495387 Ga0373941_0495387_76_474 114
132 3300041408 Ga0439453_0021828 Ga0439453_0021828_566_916 114
133 3300042001 Ga0439441_001825 Ga0439441_001825_37_387 114
134 3300042003 Ga0439443_011957 Ga0439443_011957_638_988 114
135 3300042013 Ga0439456_138391 Ga0439456_138391_102_452 114
136 3300042156 Ga0439446_0108465 Ga0439446_0108465_353_703 114
137 3300042437 Ga0439444_0004987 Ga0439444_0004987_893_1243 114
138 3300042461 Ga0439460_0002261 Ga0439460_0002261_2713_3063 114
139 3300042530 Ga0450916_059353 Ga0450916_059353_50_400 114
140 3300045051 Ga0451576_0101679 Ga0451576_0101679_1413_1766 114
141 3300046459 Ga0495629_0164917 Ga0495629_0164917_887_1237 114
142 3300046476 Ga0495662_0031701 Ga0495662_0031701_553_903 114
143 3300046533 Ga0495640_0017100 Ga0495640_0017100_1764_2114 114
144 3300046557 Ga0495622_0433134 Ga0495622_0433134_31_405 114
145 3300046663 Ga0495635_0010007 Ga0495635_0010007_4219_4569 114
146 3300046681 Ga0495647_0121944 Ga0495647_0121944_181_531 114
147 3300046689 Ga0495613_0743928 Ga0495613_0743928_82_432 114
148 3300047317 Ga0495604_0158670 Ga0495604_0158670_481_831 114
149 3300047319 Ga0495674_0788972 Ga0495674_0788972_125_475 114
150 3300047673 Ga0495593_0249881 Ga0495593_0249881_423_821 114
151 3300049522 Ga0501299_203090 Ga0501299_203090_16_369 114
152 3300049572 Ga0501036_0643062 Ga0501036_0643062_250_600 114
153 3300049575 Ga0501039_0035648 Ga0501039_0035648_664_1014 114
154 3300049577 Ga0501041_0007932 Ga0501041_0007932_2064_2414 114
155 3300049577 Ga0501041_1094370 Ga0501041_1094370_104_454 114
156 3300049578 Ga0501042_0578817 Ga0501042_0578817_140_490 114
157 3300049582 Ga0501048_0024128 Ga0501048_0024128_2128_2478 114
158 3300049587 Ga0501071_0317387 Ga0501071_0317387_799_1149 114
159 3300049668 Ga0501233_151246 Ga0501233_151246_40_399 114
160 3300049822 Ga0501035_0227357 Ga0501035_0227357_1211_1561 114
161 3300050508 nmdc:mga09592_198207_c1 nmdc:mga09592_198207_c1_388_738 114
162 3300050508 nmdc:mga09592_295617_c1 nmdc:mga09592_295617_c1_433_783 114
163 3300050509 nmdc:mga0qj67_457506_c1 nmdc:mga0qj67_457506_c1_375_725 114
164 3300050510 nmdc:mga06r32_259159_c1 nmdc:mga06r32_259159_c1_255_605 114
165 3300050511 nmdc:mga08y16_45414_c1 nmdc:mga08y16_45414_c1_1642_1992 114
166 3300005293 Ga0065715_10610795 Ga0065715_106107952 115
167 3300005329 Ga0070683_100191085 Ga0070683_1001910853 115
168 3300005334 Ga0068869_100001790 Ga0068869_10000179011 115
169 3300005336 Ga0070680_100009580 Ga0070680_1000095804 115
170 3300005337 Ga0070682_100067321 Ga0070682_1000673213 115
171 3300005338 Ga0068868_100015142 Ga0068868_1000151426 115
172 3300005338 Ga0068868_101176093 Ga0068868_1011760932 115
173 3300005340 Ga0070689_100000354 Ga0070689_10000035420 115
174 3300005340 Ga0070689_100179743 Ga0070689_1001797432 115
175 3300005340 Ga0070689_101577004 Ga0070689_1015770041 115
176 3300005341 Ga0070691_10001025 Ga0070691_1000102510 115
177 3300005341 Ga0070691_10362200 Ga0070691_103622001 115
178 3300005343 Ga0070687_100000710 Ga0070687_1000007103 115
179 3300005343 Ga0070687_100044548 Ga0070687_1000445483 115
180 3300005343 Ga0070687_101290335 Ga0070687_1012903352 115
181 3300005345 Ga0070692_10216317 Ga0070692_102163173 115
182 3300005345 Ga0070692_10279581 Ga0070692_102795812 115
183 3300005354 Ga0070675_100798998 Ga0070675_1007989981 115
184 3300005356 Ga0070674_100276893 Ga0070674_1002768933 115
185 3300005365 Ga0070688_100166888 Ga0070688_1001668883 115
186 3300005406 Ga0070703_10006186 Ga0070703_100061862 115
187 3300005437 Ga0070710_10553129 Ga0070710_105531292 115
188 3300005438 Ga0070701_10000907 Ga0070701_100009073 115
189 3300005440 Ga0070705_100000902 Ga0070705_1000009022 115
190 3300005440 Ga0070705_100018068 Ga0070705_1000180684 115
191 3300005441 Ga0070700_100015380 Ga0070700_1000153803 115
192 3300005441 Ga0070700_101223150 Ga0070700_1012231502 115
193 3300005444 Ga0070694_100001920 Ga0070694_1000019204 115
194 3300005444 Ga0070694_100099062 Ga0070694_1000990622 115
195 3300005445 Ga0070708_100176550 Ga0070708_1001765501 115
196 3300005458 Ga0070681_10109171 Ga0070681_101091712 115
197 3300005459 Ga0068867_100000656 Ga0068867_10000065624 115
198 3300005467 Ga0070706_100032346 Ga0070706_1000323463 115
199 3300005468 Ga0070707_101153497 Ga0070707_1011534971 115
200 3300005518 Ga0070699_100008087 Ga0070699_10000808714 115
201 3300005518 Ga0070699_100022732 Ga0070699_1000227323 115
202 3300005518 Ga0070699_100298934 Ga0070699_1002989342 115
203 3300005535 Ga0070684_100932422 Ga0070684_1009324221 115
204 3300005536 Ga0070697_100021112 Ga0070697_1000211123 115
205 3300005536 Ga0070697_100577440 Ga0070697_1005774403 115
206 3300005536 Ga0070697_100889286 Ga0070697_1008892862 115
207 3300005539 Ga0068853_101071231 Ga0068853_1010712311 115
208 3300005544 Ga0070686_100000107 Ga0070686_10000010722 115
209 3300005544 Ga0070686_100241382 Ga0070686_1002413822 115
210 3300005545 Ga0070695_100001550 Ga0070695_1000015503 115
211 3300005545 Ga0070695_100047842 Ga0070695_1000478422 115
212 3300005546 Ga0070696_100002104 Ga0070696_1000021043 115
213 3300005546 Ga0070696_100025195 Ga0070696_1000251954 115
214 3300005546 Ga0070696_100052874 Ga0070696_1000528743 115
215 3300005547 Ga0070693_100000606 Ga0070693_1000006063 115
216 3300005549 Ga0070704_100000347 Ga0070704_10000034722 115
217 3300005563 Ga0068855_100004392 Ga0068855_10000439222 115
218 3300005563 Ga0068855_100373055 Ga0068855_1003730552 115
219 3300005564 Ga0070664_100704044 Ga0070664_1007040443 115
220 3300005578 Ga0068854_100037770 Ga0068854_1000377702 115
221 3300005578 Ga0068854_100258513 Ga0068854_1002585133 115
222 3300005614 Ga0068856_100019751 Ga0068856_1000197516 115
223 3300005614 Ga0068856_100093411 Ga0068856_1000934112 115
224 3300005614 Ga0068856_100115404 Ga0068856_1001154043 115
225 3300005615 Ga0070702_100000219 Ga0070702_1000002193 115
226 3300005615 Ga0070702_100528924 Ga0070702_1005289242 115
227 3300005616 Ga0068852_100141209 Ga0068852_1001412092 115
228 3300005617 Ga0068859_100004135 Ga0068859_1000041356 115
229 3300005617 Ga0068859_100277592 Ga0068859_1002775922 115
230 3300005618 Ga0068864_100359865 Ga0068864_1003598652 115
231 3300005718 Ga0068866_10000328 Ga0068866_1000032810 115
232 3300005719 Ga0068861_100032569 Ga0068861_1000325692 115
233 3300005840 Ga0068870_10157723 Ga0068870_101577232 115
234 3300005841 Ga0068863_100131990 Ga0068863_1001319902 115
235 3300005841 Ga0068863_100858432 Ga0068863_1008584322 115
236 3300005842 Ga0068858_100000324 Ga0068858_1000003243 115
237 3300005842 Ga0068858_100236612 Ga0068858_1002366122 115
238 3300005843 Ga0068860_100000836 Ga0068860_10000083626 115
239 3300005843 Ga0068860_101012935 Ga0068860_1010129352 115
240 3300005844 Ga0068862_100025993 Ga0068862_1000259935 115
241 3300005844 Ga0068862_100932720 Ga0068862_1009327202 115
242 3300005844 Ga0068862_100995430 Ga0068862_1009954302 115
243 3300005985 Ga0081539_10000188 Ga0081539_1000018891 115
244 3300006163 Ga0070715_10021589 Ga0070715_100215892 115
245 3300006175 Ga0070712_100718625 Ga0070712_1007186252 115
246 3300006177 Ga0075362_10147041 Ga0075362_101470411 115
247 3300006237 Ga0097621_100004271 Ga0097621_1000042714 115
248 3300006237 Ga0097621_100029516 Ga0097621_1000295163 115
249 3300006237 Ga0097621_100700006 Ga0097621_1007000062 115
250 3300006358 Ga0068871_100012982 Ga0068871_1000129826 115
251 3300006358 Ga0068871_100042805 Ga0068871_1000428054 115
252 3300006846 Ga0075430_100098829 Ga0075430_1000988293 115
253 3300006846 Ga0075430_100598232 Ga0075430_1005982323 115
254 3300006846 Ga0075430_101117479 Ga0075430_1011174792 115
255 3300006852 Ga0075433_10000496 Ga0075433_1000049624 115
256 3300006852 Ga0075433_10065177 Ga0075433_100651773 115
257 3300006852 Ga0075433_10967463 Ga0075433_109674632 115
258 3300006871 Ga0075434_100007441 Ga0075434_1000074416 115
259 3300006871 Ga0075434_100152138 Ga0075434_1001521383 115
260 3300006880 Ga0075429_100000121 Ga0075429_10000012127 115
261 3300006881 Ga0068865_100001679 Ga0068865_10000167911 115
262 3300006914 Ga0075436_100007640 Ga0075436_1000076409 115
263 3300006914 Ga0075436_100019372 Ga0075436_1000193723 115
264 3300006914 Ga0075436_100019533 Ga0075436_1000195333 115
265 3300006914 Ga0075436_100270189 Ga0075436_1002701892 115
266 3300006931 Ga0097620_100004135 Ga0097620_1000041356 115
267 3300006931 Ga0097620_100277597 Ga0097620_1002775973 115
268 3300007076 Ga0075435_100000808 Ga0075435_10000080820 115
269 3300007076 Ga0075435_100035448 Ga0075435_1000354483 115
270 3300009092 Ga0105250_10294990 Ga0105250_102949902 115
271 3300009094 Ga0111539_10129258 Ga0111539_101292583 115
272 3300009098 Ga0105245_10006327 Ga0105245_100063273 115
273 3300009147 Ga0114129_10057107 Ga0114129_100571075 115
274 3300009147 Ga0114129_11452947 Ga0114129_114529472 115
275 3300009148 Ga0105243_10001708 Ga0105243_1000170820 115
276 3300009174 Ga0105241_10584155 Ga0105241_105841552 115
277 3300009176 Ga0105242_10000703 Ga0105242_1000070319 115
278 3300009177 Ga0105248_10083010 Ga0105248_100830104 115
279 3300009545 Ga0105237_11706497 Ga0105237_117064972 115
280 3300009553 Ga0105249_10003012 Ga0105249_1000301211 115
281 3300010375 Ga0105239_10049925 Ga0105239_100499252 115
282 3300010375 Ga0105239_11682078 Ga0105239_116820782 115
283 3300011119 Ga0105246_10075054 Ga0105246_100750543 115
284 3300013102 Ga0157371_10235480 Ga0157371_102354801 115
285 3300013296 Ga0157374_10357511 Ga0157374_103575113 115
286 3300013297 Ga0157378_10052844 Ga0157378_100528443 115
287 3300013306 Ga0163162_10722978 Ga0163162_107229783 115
288 3300013308 Ga0157375_10465820 Ga0157375_104658203 115
289 3300014745 Ga0157377_10375928 Ga0157377_103759282 115
290 3300014969 Ga0157376_10013539 Ga0157376_100135397 115
291 3300014969 Ga0157376_13002049 Ga0157376_130020492 115
292 3300021441 Ga0213871_10090604 Ga0213871_100906043 115
293 3300025885 Ga0207653_10018040 Ga0207653_100180403 115
294 3300025899 Ga0207642_10001059 Ga0207642_100010593 115
295 3300025901 Ga0207688_10368256 Ga0207688_103682563 115
296 3300025905 Ga0207685_10213814 Ga0207685_102138142 115
297 3300025905 Ga0207685_10367736 Ga0207685_103677362 115
298 3300025908 Ga0207643_10133767 Ga0207643_101337672 115
299 3300025910 Ga0207684_10074098 Ga0207684_100740983 115
300 3300025911 Ga0207654_11222759 Ga0207654_112227592 115
301 3300025912 Ga0207707_10083467 Ga0207707_100834672 115
302 3300025912 Ga0207707_10631688 Ga0207707_106316882 115
303 3300025915 Ga0207693_10510386 Ga0207693_105103862 115
304 3300025917 Ga0207660_10020295 Ga0207660_100202954 115
305 3300025918 Ga0207662_10000993 Ga0207662_1000099310 115
306 3300025918 Ga0207662_10020347 Ga0207662_100203473 115
307 3300025918 Ga0207662_11000531 Ga0207662_110005311 115
308 3300025922 Ga0207646_10396651 Ga0207646_103966512 115
309 3300025922 Ga0207646_11565605 Ga0207646_115656052 115
310 3300025927 Ga0207687_10204975 Ga0207687_102049753 115
311 3300025928 Ga0207700_10428002 Ga0207700_104280023 115
312 3300025934 Ga0207686_10007801 Ga0207686_100078016 115
313 3300025935 Ga0207709_10001744 Ga0207709_100017445 115
314 3300025935 Ga0207709_11097817 Ga0207709_110978172 115
315 3300025936 Ga0207670_10002341 Ga0207670_100023412 115
316 3300025936 Ga0207670_10075047 Ga0207670_100750472 115
317 3300025937 Ga0207669_10494705 Ga0207669_104947053 115
318 3300025938 Ga0207704_10028217 Ga0207704_100282173 115
319 3300025940 Ga0207691_11325723 Ga0207691_113257232 115
320 3300025941 Ga0207711_10068688 Ga0207711_100686884 115
321 3300025942 Ga0207689_10002082 Ga0207689_1000208212 115
322 3300025944 Ga0207661_10215019 Ga0207661_102150192 115
323 3300025949 Ga0207667_10118069 Ga0207667_101180693 115
324 3300025949 Ga0207667_10823388 Ga0207667_108233882 115
325 3300025961 Ga0207712_10015318 Ga0207712_100153182 115
326 3300025981 Ga0207640_10017445 Ga0207640_100174452 115
327 3300025986 Ga0207658_12171757 Ga0207658_121717572 115
328 3300026023 Ga0207677_10063377 Ga0207677_100633773 115
329 3300026023 Ga0207677_11747547 Ga0207677_117475472 115
330 3300026035 Ga0207703_10023007 Ga0207703_100230073 115
331 3300026035 Ga0207703_10107973 Ga0207703_101079732 115
332 3300026035 Ga0207703_10232947 Ga0207703_102329473 115
333 3300026041 Ga0207639_10826144 Ga0207639_108261442 115
334 3300026075 Ga0207708_10003381 Ga0207708_100033816 115
335 3300026078 Ga0207702_10069665 Ga0207702_100696653 115
336 3300026078 Ga0207702_10115816 Ga0207702_101158162 115
337 3300026078 Ga0207702_10252922 Ga0207702_102529222 115
338 3300026088 Ga0207641_10059939 Ga0207641_100599392 115
339 3300026088 Ga0207641_10704053 Ga0207641_107040531 115
340 3300026089 Ga0207648_10000171 Ga0207648_1000017152 115
341 3300026118 Ga0207675_100000321 Ga0207675_10000032144 115
342 3300027364 Ga0209967_1001457 Ga0209967_10014573 115
343 3300027378 Ga0209981_1006155 Ga0209981_10061553 115
344 3300027462 Ga0210000_1000915 Ga0210000_10009153 115
345 3300027682 Ga0209971_1057190 Ga0209971_10571902 115
346 3300027695 Ga0209966_1088827 Ga0209966_10888272 115
347 3300027907 Ga0207428_10000544 Ga0207428_1000054413 115
348 3300027907 Ga0207428_10221371 Ga0207428_102213712 115
349 3300028380 Ga0268265_10013266 Ga0268265_100132664 115
350 3300028380 Ga0268265_10918834 Ga0268265_109188341 115
351 3300028380 Ga0268265_11424454 Ga0268265_114244542 115
352 3300028381 Ga0268264_10000745 Ga0268264_100007459 115
353 3300031548 Ga0307408_101638996 Ga0307408_1016389962 115
354 3300031665 Ga0316575_10071029 Ga0316575_100710293 115
355 3300031691 Ga0316579_10032127 Ga0316579_100321272 115
356 3300031728 Ga0316578_10083273 Ga0316578_100832732 115
357 3300032133 Ga0316583_10005541 Ga0316583_100055413 115
358 3300035083 Ga0373926_0002730 Ga0373926_0002730_1780_2160 115
359 3300035085 Ga0373929_0008931 Ga0373929_0008931_816_1178 115
360 3300035085 Ga0373929_0140762 Ga0373929_0140762_109_456 115
361 3300035086 Ga0373934_0003344 Ga0373934_0003344_4092_4451 115
362 3300035111 Ga0373923_0116168 Ga0373923_0116168_185_547 115
363 3300035116 Ga0373945_0016830 Ga0373945_0016830_711_1091 115
364 3300035117 Ga0373953_0106823 Ga0373953_0106823_399_761 115
365 3300035117 Ga0373953_0204224 Ga0373953_0204224_67_426 115
366 3300035117 Ga0373953_0499891 Ga0373953_0499891_128_481 115
367 3300035118 Ga0373954_0000001 Ga0373954_0000001_25341_25700 115
368 3300035118 Ga0373954_0184972 Ga0373954_0184972_447_809 115
369 3300035119 Ga0373956_0039456 Ga0373956_0039456_162_524 115
370 3300035119 Ga0373956_0366285 Ga0373956_0366285_188_547 115
371 3300035120 Ga0373957_0024725 Ga0373957_0024725_1704_2066 115
372 3300035120 Ga0373957_0550894 Ga0373957_0550894_56_415 115
373 3300035170 Ga0373943_0107759 Ga0373943_0107759_85_465 115
374 3300035172 Ga0373955_0013563 Ga0373955_0013563_3525_3887 115
375 3300035172 Ga0373955_0204507 Ga0373955_0204507_282_641 115
376 3300035398 Ga0316574_0796490 Ga0316574_0796490_60_419 115
377 3300035410 Ga0373924_0009847 Ga0373924_0009847_1953_2312 115
378 3300035410 Ga0373924_0050300 Ga0373924_0050300_1296_1676 115
379 3300035691 Ga0373931_0020186 Ga0373931_0020186_1338_1691 115
380 3300035692 Ga0373935_0035605 Ga0373935_0035605_886_1266 115
381 3300035692 Ga0373935_1084188 Ga0373935_1084188_212_574 115
382 3300035695 Ga0373927_0013771 Ga0373927_0013771_2043_2423 115
383 3300035724 Ga0373933_0002321 Ga0373933_0002321_6499_6861 115
384 3300035724 Ga0373933_0005099 Ga0373933_0005099_2412_2771 115
385 3300035724 Ga0373933_0166888 Ga0373933_0166888_764_1117 115
386 3300035724 Ga0373933_0662960 Ga0373933_0662960_106_459 115
387 3300035725 Ga0373947_0170075 Ga0373947_0170075_664_1044 115
388 3300036401 Ga0373937_0002024 Ga0373937_0002024_6570_6929 115
389 3300036401 Ga0373937_0024411 Ga0373937_0024411_1815_2177 115
390 3300036401 Ga0373937_0527042 Ga0373937_0527042_643_996 115
391 3300036647 Ga0316582_0004025 Ga0316582_0004025_3762_4121 115
392 3300036712 Ga0316584_0274873 Ga0316584_0274873_10_369 115
393 3300037068 Ga0373925_0036088 Ga0373925_0036088_1397_1777 115
394 3300037588 Ga0316581_0032114 Ga0316581_0032114_1065_1424 115
395 3300041486 Ga0451807_1260896 Ga0451807_1260896_234_596 115
396 3300044901 Ga0466960_0517531 Ga0466960_0517531_237_608 115
397 3300044901 Ga0466960_0893329 Ga0466960_0893329_116_463 115
398 3300046455 Ga0495603_0003125 Ga0495603_0003125_4736_5116 115
399 3300046462 Ga0495651_0713272 Ga0495651_0713272_36_389 115
400 3300046472 Ga0495580_0017287 Ga0495580_0017287_590_970 115
401 3300046473 Ga0495582_0144306 Ga0495582_0144306_488_868 115
402 3300046511 Ga0495608_0477174 Ga0495608_0477174_338_697 115
403 3300046529 Ga0495652_0165973 Ga0495652_0165973_676_1029 115
404 3300046529 Ga0495652_0279301 Ga0495652_0279301_717_1079 115
405 3300046559 Ga0495667_0080091 Ga0495667_0080091_1684_2046 115
406 3300046559 Ga0495667_0220656 Ga0495667_0220656_772_1131 115
407 3300046663 Ga0495635_0076184 Ga0495635_0076184_1489_1851 115
408 3300047317 Ga0495604_0874054 Ga0495604_0874054_30_389 115
409 3300047321 Ga0495676_0094476 Ga0495676_0094476_297_677 115
410 3300047322 Ga0495680_0079858 Ga0495680_0079858_282_644 115
411 3300047322 Ga0495680_0427565 Ga0495680_0427565_409_795 115
412 3300047471 Ga0495684_1023274 Ga0495684_1023274_130_492 115
413 3300048909 Ga0496106_0632025 Ga0496106_0632025_215_568 115
414 3300048915 Ga0496112_1512049 Ga0496112_1512049_30_383 115
415 3300048917 Ga0496114_0523027 Ga0496114_0523027_519_872 115
416 3300049568 Ga0501031_0103606 Ga0501031_0103606_293_646 115
417 3300049568 Ga0501031_1041512 Ga0501031_1041512_91_444 115
418 3300049570 Ga0501033_0134818 Ga0501033_0134818_861_1226 115
419 3300049572 Ga0501036_1675428 Ga0501036_1675428_104_457 115
420 3300049574 Ga0501038_0033404 Ga0501038_0033404_1190_1543 115
421 3300049574 Ga0501038_0344208 Ga0501038_0344208_194_547 115
422 3300049575 Ga0501039_0016663 Ga0501039_0016663_4248_4601 115
423 3300049575 Ga0501039_0119010 Ga0501039_0119010_61_414 115
424 3300049576 Ga0501040_0001554 Ga0501040_0001554_13550_13903 115
425 3300049576 Ga0501040_0031718 Ga0501040_0031718_521_874 115
426 3300049576 Ga0501040_0897749 Ga0501040_0897749_29_382 115
427 3300049577 Ga0501041_0047670 Ga0501041_0047670_2232_2585 115
428 3300049578 Ga0501042_0071446 Ga0501042_0071446_431_796 115
429 3300049580 Ga0501046_0132752 Ga0501046_0132752_1420_1773 115
430 3300049580 Ga0501046_0323493 Ga0501046_0323493_637_990 115
431 3300049582 Ga0501048_0007565 Ga0501048_0007565_3708_4061 115
432 3300049587 Ga0501071_1274409 Ga0501071_1274409_174_548 115
433 3300049588 Ga0501072_0020854 Ga0501072_0020854_2468_2821 115
434 3300049588 Ga0501072_0039913 Ga0501072_0039913_2332_2685 115
435 3300049588 Ga0501072_0251037 Ga0501072_0251037_178_552 115
436 3300049590 Ga0501074_0031021 Ga0501074_0031021_3422_3775 115
437 3300049590 Ga0501074_0070493 Ga0501074_0070493_1587_1940 115
438 3300049591 Ga0501075_0006283 Ga0501075_0006283_829_1182 115
439 3300049591 Ga0501075_0159503 Ga0501075_0159503_1141_1494 115
440 3300049592 Ga0501076_0056882 Ga0501076_0056882_2579_2932 115
441 3300049592 Ga0501076_0128473 Ga0501076_0128473_920_1273 115
442 3300049593 Ga0501077_0004607 Ga0501077_0004607_6378_6731 115
443 3300049660 Ga0501216_087676 Ga0501216_087676_147_500 115
444 3300049741 Ga0501079_0004381 Ga0501079_0004381_5375_5728 115
445 3300049742 Ga0501080_0100154 Ga0501080_0100154_2316_2669 115
446 3300049743 Ga0501081_0000975 Ga0501081_0000975_13579_13932 115
447 3300049743 Ga0501081_0027284 Ga0501081_0027284_1861_2214 115
448 3300049744 Ga0501083_0203172 Ga0501083_0203172_74_427 115
449 3300049824 Ga0501045_0028724 Ga0501045_0028724_2740_3093 115
450 3300049824 Ga0501045_0041550 Ga0501045_0041550_2870_3223 115
451 3300050507 nmdc:mga05p37_1258557_c1 nmdc:mga05p37_1258557_c1_299_658 115
452 3300050507 nmdc:mga05p37_914645_c1 nmdc:mga05p37_914645_c1_306_659 115
453 3300050509 nmdc:mga0qj67_772269_c1 nmdc:mga0qj67_772269_c1_214_567 115
454 3300050510 nmdc:mga06r32_504105_c1 nmdc:mga06r32_504105_c1_753_1127 115
455 3300050511 nmdc:mga08y16_12448_c1 nmdc:mga08y16_12448_c1_1085_1438 115
456 3300050512 nmdc:mga0n895_1161146_c1 nmdc:mga0n895_1161146_c1_49_420 115
457 3300050512 nmdc:mga0n895_134_c1 nmdc:mga0n895_134_c1_3421_3774 115
458 3300050512 nmdc:mga0n895_225358_c1 nmdc:mga0n895_225358_c1_1317_1664 115
459 3300050512 nmdc:mga0n895_313882_c1 nmdc:mga0n895_313882_c1_49_396 115
460 3300050513 nmdc:mga0rr50_1316109_c1 nmdc:mga0rr50_1316109_c1_207_578 115
461 3300050513 nmdc:mga0rr50_291066_c1 nmdc:mga0rr50_291066_c1_891_1238 115
462 3300050513 nmdc:mga0rr50_3607_c1 nmdc:mga0rr50_3607_c1_3326_3679 115
463 3300050514 nmdc:mga08x19_102325_c1 nmdc:mga08x19_102325_c1_1003_1350 115
464 3300050514 nmdc:mga08x19_17452_c1 nmdc:mga08x19_17452_c1_2993_3364 115
465 3300050514 nmdc:mga08x19_2898_c1 nmdc:mga08x19_2898_c1_7665_8018 115
466 3300050514 nmdc:mga08x19_420452_c1 nmdc:mga08x19_420452_c1_251_598 115
467 3300050514 nmdc:mga08x19_91342_c1 nmdc:mga08x19_91342_c1_401_748 115
468 3300050515 nmdc:mga0a205_223661_c1 nmdc:mga0a205_223661_c1_778_1125 115
469 3300050515 nmdc:mga0a205_8520_c1 nmdc:mga0a205_8520_c1_7805_8158 115
470 3300050515 nmdc:mga0a205_876004_c1 nmdc:mga0a205_876004_c1_163_516 115
471 3300054114 Ga0501084_0009678 Ga0501084_0009678_2847_3200 115
472 3300054114 Ga0501084_0258175 Ga0501084_0258175_831_1184 115
473 3300060353 Ga0501082_0096017 Ga0501082_0096017_1528_1881 115
474 3300060353 Ga0501082_0378842 Ga0501082_0378842_868_1221 115
475 3300061734 Ga0530510_0000264 Ga0530510_0000264_11805_12158 115

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01047

MarR

MarR family

66

117

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.9665 53 107
5duk-assembly1.cif.gz_B n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.966 53 101
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9607 54 106
5duk-assembly1.cif.gz_A n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.9591 53 101
6b3a-assembly1.cif.gz_A apra methyltransferase 1 - gnat didomain in complex with mn2+ and sam 0.952 59 106
ID Description Score Start End Superfamily
4ijaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9741 53 106 1.10.10.10
af_Q2RAU2_5_159_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9624 54 99 1.10.10.10
4awxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9607 54 106 1.10.10.10
af_A4I3U0_697_766_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9445 54 106 1.10.10.10
af_P76268_11_86_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.944 53 106 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2M7AFN2-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9865 50 106 GO:0016301
AF-M0ME02-F1-model_v4 DeoR family transcriptional regulator 0.9819 50 107
AF-A0A2U0XS01-F1-model_v4 deleted 0.9797 54 106
AF-A0A7W7QSG6-F1-model_v4 DNA-binding IclR family transcriptional regulator 0.9774 54 106 GO:0003677
GO:0003700
GO:0045892
AF-A0A1R4HVL7-F1-model_v4 Transcriptional regulator, IclR family 0.9759 50 106 GO:0003677
GO:0003700
GO:0045892

Feature Viewer

pLDDT pTM Quality
81.26 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map