F451294

General Info

Members Datasets Scaffolds Average Seq Length
475 286 950 151

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100782126|Ga0070690_1007821262
Length 163
Sequence MAESASGLILRMTRTFDATPERVFAAWTDPQHFGAWFGPVGMTTVLCEIDPRVGGEWRLMGQGENLPGRQPGSGLVRPTVSGKYLEIEPPSRLVFSFAWLEKDDFASPRGQETIVTIQFKPAGERTEMVFTQAVFKDEQSLAAHNRGWTESFDKLGDVLRRAA

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
93 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
94 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
104 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
160 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
162 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
163 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
164 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
171 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
172 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
173 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
174 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
175 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
176 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
177 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
178 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
179 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
180 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
181 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
184 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
185 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
193 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
194 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
195 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
196 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
204 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
205 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
206 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
209 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
210 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
249 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
254 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
255 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
263 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
264 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
266 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
275 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
276 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
279 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
280 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
281 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
285 2791355199
286 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.21
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.95
Nodule 0
Rhizoplane 5.68
Rhizosphere 86.11
Stem 0
Stem Tuber 0
Unclassified 11.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100782126 3300005330 Unclassified 739
2 JGI25153J46596_10004067 3300003215 Bacteria 7964
3 Ga0070676_10030330 3300005328 Bacteria 3083
4 Ga0070676_10132351 3300005328 Bacteria 1579
5 Ga0070683_100160273 3300005329 Unclassified 2134
6 Ga0070683_100820483 3300005329 Bacteria 892
7 Ga0070690_100482360 3300005330 Bacteria 924
8 Ga0070670_100485777 3300005331 Bacteria 1097
9 Ga0068869_100284728 3300005334 Bacteria 1330
10 Ga0068869_100379909 3300005334 Bacteria 1157
11 Ga0068869_100800790 3300005334 Bacteria 810
12 Ga0070666_10085826 3300005335 Bacteria 2156
13 Ga0070682_100015803 3300005337 Bacteria 4381
14 Ga0070682_100175881 3300005337 Bacteria 1491
15 Ga0070682_101071135 3300005337 Bacteria 673
16 Ga0068868_100016101 3300005338 Bacteria 5546
17 Ga0070689_100204778 3300005340 Unclassified 1612
18 Ga0070689_101390972 3300005340 Bacteria 634
19 Ga0070687_100198759 3300005343 Bacteria 1213
20 Ga0070661_100060582 3300005344 Bacteria 2777
21 Ga0070661_100382531 3300005344 Bacteria 1110
22 Ga0070668_100062216 3300005347 Bacteria 2891
23 Ga0070668_100835717 3300005347 Bacteria 820
24 Ga0070675_101234376 3300005354 Bacteria 688
25 Ga0070671_100558603 3300005355 Unclassified 987
26 Ga0070673_100099471 3300005364 Bacteria 2392
27 Ga0070673_100389719 3300005364 Bacteria 1244
28 Ga0070688_100217906 3300005365 Bacteria 1343
29 Ga0070659_100264312 3300005366 Bacteria 1428
30 Ga0070659_100294600 3300005366 Bacteria 1352
31 Ga0070659_100408598 3300005366 Bacteria 1147
32 Ga0070667_100053042 3300005367 Bacteria 3422
33 Ga0070709_10017254 3300005434 Bacteria 4137
34 Ga0070709_10021407 3300005434 Bacteria 3765
35 Ga0070709_10091466 3300005434 Bacteria 2008
36 Ga0070709_10192194 3300005434 Bacteria 1440
37 Ga0070709_10390566 3300005434 Bacteria 1037
38 Ga0070714_100208940 3300005435 Unclassified 1788
39 Ga0070713_100018513 3300005436 Bacteria 5292
40 Ga0070713_100145501 3300005436 Unclassified 2103
41 Ga0070713_100825899 3300005436 Bacteria 889
42 Ga0070710_10002269 3300005437 Bacteria 9095
43 Ga0070710_11196977 3300005437 Bacteria 561
44 Ga0070701_10440203 3300005438 Bacteria 834
45 Ga0070711_100013048 3300005439 Bacteria 5210
46 Ga0070711_100087610 3300005439 Bacteria 2236
47 Ga0070705_100086012 3300005440 Unclassified 1945
48 Ga0070705_100334393 3300005440 Bacteria 1098
49 Ga0070700_100106289 3300005441 Bacteria 1858
50 Ga0070708_100220416 3300005445 Bacteria 1779
51 Ga0070663_100453349 3300005455 Bacteria 1057
52 Ga0070678_100010614 3300005456 Bacteria 5638
53 Ga0070662_100695881 3300005457 Bacteria 860
54 Ga0070662_100722273 3300005457 Bacteria 844
55 Ga0070681_10113717 3300005458 Bacteria 2646
56 Ga0068867_100286777 3300005459 Bacteria 1352
57 Ga0068867_100902896 3300005459 Bacteria 795
58 Ga0070685_10247398 3300005466 Bacteria 1179
59 Ga0070699_100374839 3300005518 Bacteria 1284
60 Ga0070699_100424439 3300005518 Bacteria 1204
61 Ga0070679_100169945 3300005530 Bacteria 2153
62 Ga0070684_100082144 3300005535 Bacteria 2852
63 Ga0070684_100620360 3300005535 Bacteria 1006
64 Ga0070697_100597500 3300005536 Bacteria 970
65 Ga0070672_100176485 3300005543 Bacteria 1779
66 Ga0070672_100233553 3300005543 Bacteria 1545
67 Ga0070686_100130270 3300005544 Unclassified 1738
68 Ga0070686_100378389 3300005544 Bacteria 1071
69 Ga0070686_101495586 3300005544 Bacteria 569
70 Ga0070695_100407464 3300005545 Bacteria 1032
71 Ga0070696_100509318 3300005546 Bacteria 959
72 Ga0070696_100887837 3300005546 Bacteria 739
73 Ga0070693_100095900 3300005547 Bacteria 1797
74 Ga0070693_100782531 3300005547 Bacteria 706
75 Ga0070665_100114843 3300005548 Bacteria 2695
76 Ga0070665_100723364 3300005548 Unclassified 1008
77 Ga0070665_101631273 3300005548 Unclassified 653
78 Ga0070664_100101337 3300005564 Bacteria 2504
79 Ga0068854_100986116 3300005578 Bacteria 745
80 Ga0068856_100143853 3300005614 Bacteria 2392
81 Ga0070702_100156808 3300005615 Bacteria 1467
82 Ga0070702_100556584 3300005615 Bacteria 852
83 Ga0068852_100155851 3300005616 Bacteria 2128
84 Ga0068852_102209851 3300005616 Bacteria 572
85 Ga0068859_100111726 3300005617 Bacteria 2795
86 Ga0068864_100088449 3300005618 Bacteria 2728
87 Ga0068864_100273765 3300005618 Bacteria 1574
88 Ga0068866_10148186 3300005718 Bacteria 1356
89 Ga0068866_10564205 3300005718 Bacteria 763
90 Ga0068851_10108324 3300005834 Bacteria 1481
91 Ga0068863_100011482 3300005841 Bacteria 8565
92 Ga0068863_101001295 3300005841 Bacteria 838
93 Ga0068863_101177114 3300005841 Bacteria 772
94 Ga0068858_100412144 3300005842 Bacteria 1299
95 Ga0068860_100324072 3300005843 Bacteria 1512
96 Ga0068860_100494803 3300005843 Bacteria 1220
97 Ga0068862_100441388 3300005844 Bacteria 1225
98 Ga0081455_10008538 3300005937 Bacteria 10631
99 Ga0081455_10488963 3300005937 Bacteria 830
100 Ga0081540_1010440 3300005983 Bacteria 6290
101 Ga0081540_1014983 3300005983 Bacteria 4928
102 Ga0081540_1236911 3300005983 Bacteria 642
103 Ga0081539_10011759 3300005985 Bacteria 6860
104 Ga0081539_10018994 3300005985 Bacteria 4732
105 Ga0070717_10000430 3300006028 Bacteria 26747
106 Ga0075365_10136844 3300006038 Bacteria 1698
107 Ga0075365_10455218 3300006038 Bacteria 904
108 Ga0075365_10695082 3300006038 Bacteria 718
109 Ga0075365_10973817 3300006038 Bacteria 598
110 Ga0075368_10028726 3300006042 Bacteria 2149
111 Ga0075368_10132393 3300006042 Unclassified 1037
112 Ga0075364_10145696 3300006051 Bacteria 1594
113 Ga0070715_10456280 3300006163 Bacteria 722
114 Ga0070716_100000617 3300006173 Bacteria 15022
115 Ga0070716_100272911 3300006173 Bacteria 1163
116 Ga0070716_100305754 3300006173 Bacteria 1108
117 Ga0070716_100764085 3300006173 Bacteria 745
118 Ga0070712_100023446 3300006175 Bacteria 4078
119 Ga0070712_100182413 3300006175 Bacteria 1637
120 Ga0075362_10005907 3300006177 Bacteria 4520
121 Ga0075362_10017972 3300006177 Bacteria 2920
122 Ga0075362_10065078 3300006177 Bacteria 1655
123 Ga0075367_10006406 3300006178 Bacteria 5945
124 Ga0075367_10102193 3300006178 Bacteria 1753
125 Ga0075367_10271904 3300006178 Bacteria 1064
126 Ga0075367_10596890 3300006178 Unclassified 702
127 Ga0075369_10009224 3300006186 Bacteria 3826
128 Ga0097621_100279397 3300006237 Bacteria 1469
129 Ga0097621_100545845 3300006237 Bacteria 1054
130 Ga0075370_10007171 3300006353 Bacteria 5662
131 Ga0075370_10018554 3300006353 Bacteria 3777
132 Ga0075370_10129235 3300006353 Bacteria 1474
133 Ga0068871_100017382 3300006358 Bacteria 5441
134 Ga0075428_100142261 3300006844 Bacteria 2608
135 Ga0075428_100220169 3300006844 Bacteria 2050
136 Ga0075433_10459113 3300006852 Bacteria 1123
137 Ga0075434_100058416 3300006871 Bacteria 3834
138 Ga0075434_100232916 3300006871 Bacteria 1861
139 Ga0075434_100417132 3300006871 Bacteria 1363
140 Ga0075434_101802251 3300006871 Unclassified 619
141 Ga0068865_100077508 3300006881 Bacteria 2375
142 Ga0075436_100079236 3300006914 Bacteria 2275
143 Ga0075436_100143702 3300006914 Bacteria 1677
144 Ga0075436_100542843 3300006914 Bacteria 853
145 Ga0075436_100764637 3300006914 Unclassified 718
146 Ga0097620_100111719 3300006931 Bacteria 2795
147 Ga0075435_100089269 3300007076 Bacteria 2541
148 Ga0075435_100344275 3300007076 Bacteria 1277
149 Ga0075435_100564122 3300007076 Bacteria 986
150 Ga0099795_10062259 3300007788 Bacteria 1388
151 Ga0105251_10045081 3300009011 Bacteria 2127
152 Ga0111539_10384361 3300009094 Bacteria 1634
153 Ga0111539_10546764 3300009094 Bacteria 1349
154 Ga0111539_10926431 3300009094 Bacteria 1013
155 Ga0111539_12171472 3300009094 Bacteria 644
156 Ga0105245_10403714 3300009098 Bacteria 1366
157 Ga0105245_10641251 3300009098 Unclassified 1092
158 Ga0105243_11108668 3300009148 Unclassified 800
159 Ga0105241_10015721 3300009174 Bacteria 5545
160 Ga0105242_10015228 3300009176 Bacteria 5973
161 Ga0105242_11390399 3300009176 Bacteria 729
162 Ga0105242_11457339 3300009176 Bacteria 714
163 Ga0105248_10395982 3300009177 Bacteria 1555
164 Ga0105238_10125418 3300009551 Plasmid 2547
165 Ga0105035_132205 3300009988 Unclassified 511
166 Ga0105246_10548991 3300011119 Bacteria 990
167 Ga0105246_11590091 3300011119 Bacteria 617
168 Ga0157323_1022429 3300012495 Unclassified 612
169 Ga0157313_1010307 3300012503 Bacteria 790
170 Ga0157338_1000820 3300012515 Bacteria 2020
171 Ga0157369_11981769 3300013105 Unclassified 591
172 Ga0157374_10311644 3300013296 Bacteria 1558
173 Ga0157378_10060291 3300013297 Bacteria 3386
174 Ga0163162_10830035 3300013306 Bacteria 1040
175 Ga0163162_13244889 3300013306 Unclassified 522
176 Ga0157380_11584443 3300014326 Bacteria 710
177 Ga0157377_10128318 3300014745 Bacteria 1545
178 Ga0157376_10180064 3300014969 Bacteria 1931
179 Ga0163161_10120347 3300017792 Unclassified 1972
180 Ga0224572_1010530 3300024225 Bacteria 1741
181 Ga0207713_1070665 3300025735 Bacteria 1290
182 Ga0207653_10275834 3300025885 Bacteria 648
183 Ga0207710_10002851 3300025900 Bacteria 7872
184 Ga0207688_10067750 3300025901 Bacteria 2020
185 Ga0207688_10174007 3300025901 Bacteria 1281
186 Ga0207688_10207711 3300025901 Bacteria 1176
187 Ga0207680_10033146 3300025903 Bacteria 2943
188 Ga0207680_10543319 3300025903 Bacteria 829
189 Ga0207685_10001029 3300025905 Bacteria 5447
190 Ga0207699_10040801 3300025906 Bacteria 2677
191 Ga0207699_10151353 3300025906 Bacteria 1535
192 Ga0207699_10257894 3300025906 Bacteria 1204
193 Ga0207699_10414062 3300025906 Bacteria 962
194 Ga0207645_10028834 3300025907 Bacteria 3581
195 Ga0207707_10865872 3300025912 Bacteria 749
196 Ga0207671_10194932 3300025914 Bacteria 1580
197 Ga0207671_10703255 3300025914 Bacteria 804
198 Ga0207693_10006662 3300025915 Bacteria 9540
199 Ga0207693_10028396 3300025915 Bacteria 4420
200 Ga0207693_10030888 3300025915 Bacteria 4231
201 Ga0207693_11027172 3300025915 Bacteria 628
202 Ga0207663_10058573 3300025916 Bacteria 2432
203 Ga0207663_10228593 3300025916 Bacteria 1358
204 Ga0207663_11154892 3300025916 Bacteria 623
205 Ga0207660_10489622 3300025917 Unclassified 997
206 Ga0207657_10120279 3300025919 Bacteria 2161
207 Ga0207649_10172867 3300025920 Unclassified 1506
208 Ga0207652_10433028 3300025921 Bacteria 1186
209 Ga0207681_10268617 3300025923 Bacteria 1338
210 Ga0207694_10339257 3300025924 Bacteria 1242
211 Ga0207694_10381134 3300025924 Bacteria 1170
212 Ga0207650_10304007 3300025925 Bacteria 1303
213 Ga0207650_10486326 3300025925 Bacteria 1030
214 Ga0207659_10582221 3300025926 Bacteria 953
215 Ga0207659_11792538 3300025926 Bacteria 521
216 Ga0207687_10022551 3300025927 Bacteria 4191
217 Ga0207687_10722202 3300025927 Unclassified 847
218 Ga0207700_10002382 3300025928 Bacteria 10810
219 Ga0207700_10041771 3300025928 Bacteria 3357
220 Ga0207690_10062753 3300025932 Bacteria 2531
221 Ga0207690_10328577 3300025932 Bacteria 1204
222 Ga0207690_10358511 3300025932 Bacteria 1154
223 Ga0207706_10159008 3300025933 Bacteria 1987
224 Ga0207686_10031459 3300025934 Bacteria 3151
225 Ga0207709_10319908 3300025935 Bacteria 1161
226 Ga0207709_11213304 3300025935 Unclassified 622
227 Ga0207670_10006317 3300025936 Bacteria 6564
228 Ga0207670_10021699 3300025936 Bacteria 3966
229 Ga0207670_10413614 3300025936 Bacteria 1081
230 Ga0207665_10000756 3300025939 Bacteria 21750
231 Ga0207665_10426240 3300025939 Bacteria 1014
232 Ga0207665_10690107 3300025939 Bacteria 802
233 Ga0207691_10371624 3300025940 Bacteria 1221
234 Ga0207691_11328015 3300025940 Unclassified 593
235 Ga0207711_10300603 3300025941 Bacteria 1480
236 Ga0207689_10214335 3300025942 Bacteria 1591
237 Ga0207689_10248800 3300025942 Bacteria 1470
238 Ga0207661_10126370 3300025944 Bacteria 2184
239 Ga0207651_10077619 3300025960 Bacteria 2379
240 Ga0207651_10174158 3300025960 Unclassified 1700
241 Ga0207712_11435453 3300025961 Unclassified 618
242 Ga0207668_10344497 3300025972 Bacteria 1244
243 Ga0207668_10423623 3300025972 Bacteria 1130
244 Ga0207668_11441952 3300025972 Unclassified 621
245 Ga0207668_11611552 3300025972 Bacteria 586
246 Ga0207640_10423149 3300025981 Bacteria 1091
247 Ga0207658_11125189 3300025986 Bacteria 717
248 Ga0207677_10010183 3300026023 Bacteria 5312
249 Ga0207677_10355873 3300026023 Bacteria 1228
250 Ga0207677_11440693 3300026023 Bacteria 635
251 Ga0207703_12359596 3300026035 Bacteria 508
252 Ga0207639_10357653 3300026041 Bacteria 1306
253 Ga0207639_10765153 3300026041 Bacteria 899
254 Ga0207678_10069659 3300026067 Bacteria 3016
255 Ga0207678_10112816 3300026067 Unclassified 2319
256 Ga0207678_10415710 3300026067 Bacteria 1166
257 Ga0207708_10272864 3300026075 Bacteria 1368
258 Ga0207708_10388342 3300026075 Bacteria 1152
259 Ga0207702_10063171 3300026078 Bacteria 3166
260 Ga0207641_10731653 3300026088 Bacteria 976
261 Ga0207641_11320600 3300026088 Unclassified 722
262 Ga0207648_10217585 3300026089 Unclassified 1697
263 Ga0207648_10426118 3300026089 Bacteria 1205
264 Ga0207676_10254887 3300026095 Bacteria 1581
265 Ga0207675_100224996 3300026118 Bacteria 1808
266 Ga0207675_101749557 3300026118 Unclassified 641
267 Ga0207683_10012112 3300026121 Bacteria 7361
268 Ga0207698_10325772 3300026142 Bacteria 1441
269 Ga0207698_10753002 3300026142 Bacteria 973
270 Ga0209998_10002389 3300027717 Bacteria 4322
271 Ga0209998_10023382 3300027717 Bacteria 1337
272 Ga0207428_10546803 3300027907 Bacteria 838
273 Ga0265357_1000053 3300028023 Bacteria 3976
274 Ga0268266_10076367 3300028379 Bacteria 2911
275 Ga0268266_10090281 3300028379 Bacteria 2685
276 Ga0268265_10428773 3300028380 Bacteria 1230
277 Ga0268264_10320466 3300028381 Bacteria 1465
278 Ga0265334_10015831 3300028573 Bacteria 3127
279 Ga0265773_1023614 3300031018 Bacteria 621
280 Ga0265332_10353007 3300031238 Bacteria 607
281 Ga0265325_10002552 3300031241 Bacteria 12248
282 Ga0265340_10346091 3300031247 Bacteria 657
283 Ga0265339_10023218 3300031249 Bacteria 3587
284 Ga0265316_10065781 3300031344 Bacteria 2807
285 Ga0265313_10002305 3300031595 Bacteria 16724
286 Ga0307406_10444420 3300031901 Bacteria 1039
287 Ga0307411_10583138 3300032005 Unclassified 959
288 Ga0307415_100085398 3300032126 Bacteria 2268
289 Ga0373930_0017890 3300034816 Bacteria 1356
290 Ga0373948_0045152 3300034817 Bacteria 933
291 Ga0373938_0176981 3300034957 Unclassified 580
292 Ga0373940_0014355 3300035088 Bacteria 1931
293 Ga0373949_0003619 3300035090 Bacteria 3633
294 Ga0373951_0032493 3300035091 Bacteria 1234
295 Ga0373952_0044739 3300035092 Bacteria 1035
296 Ga0373932_0020623 3300035112 Bacteria 1730
297 Ga0373939_0011759 3300035114 Bacteria 2216
298 Ga0373939_0059039 3300035114 Bacteria 1215
299 Ga0373941_0045607 3300035115 Bacteria 1373
300 Ga0373945_0341625 3300035116 Unclassified 648
301 Ga0373960_0142762 3300035121 Bacteria 812
302 Ga0373943_0029751 3300035170 Bacteria 2581
303 Ga0373943_0070724 3300035170 Bacteria 1766
304 Ga0373942_0009684 3300035207 Bacteria 2259
305 Ga0373961_0010141 3300035241 Bacteria 2318
306 Ga0373962_0017190 3300035242 Bacteria 1872
307 Ga0373931_0038410 3300035691 Bacteria 2504
308 Ga0373931_0061978 3300035691 Bacteria 2018
309 Ga0373935_0007229 3300035692 Bacteria 6633
310 Ga0373935_0736661 3300035692 Bacteria 726
311 Ga0373927_0016306 3300035695 Bacteria 4902
312 Ga0373927_0020645 3300035695 Bacteria 4319
313 Ga0373947_0001131 3300035725 Bacteria 16382
314 Ga0373925_0468585 3300037068 Bacteria 1033
315 Ga0395900_1347348 3300037418 Unclassified 627
316 Ga0436360_0329185 3300039438 Bacteria 769
317 Ga0451851_0569871 3300041507 Bacteria 764
318 Ga0451853_3606464 3300041512 Bacteria 1153
319 Ga0439459_0009546 3300042438 Bacteria 1680
320 Ga0439459_0059207 3300042438 Bacteria 861
321 Ga0439440_0027395 3300042993 Unclassified 1324
322 Ga0495603_0006194 3300046455 Bacteria 7154
323 Ga0495603_0108953 3300046455 Bacteria 1616
324 Ga0495590_0083857 3300046457 Bacteria 1123
325 Ga0495590_0207889 3300046457 Bacteria 721
326 Ga0495580_0049648 3300046472 Bacteria 2969
327 Ga0495580_0431690 3300046472 Bacteria 885
328 Ga0495582_0003861 3300046473 Bacteria 8435
329 Ga0495639_0096771 3300046475 Bacteria 1390
330 Ga0495594_0021257 3300046499 Bacteria 3463
331 Ga0495596_0295352 3300046500 Bacteria 630
332 Ga0495583_0123654 3300046506 Bacteria 1087
333 Ga0495632_0298058 3300046519 Bacteria 715
334 Ga0495654_0279695 3300046530 Bacteria 687
335 Ga0495667_0410848 3300046559 Bacteria 852
336 Ga0495611_0110704 3300046648 Unclassified 1278
337 Ga0495588_0632197 3300046674 Unclassified 560
338 Ga0495647_0012955 3300046681 Bacteria 2880
339 Ga0495613_0001421 3300046689 Bacteria 18261
340 Ga0495670_0229830 3300046691 Bacteria 986
341 Ga0495600_0132912 3300046809 Bacteria 1617
342 Ga0495581_0313608 3300047315 Bacteria 916
343 Ga0495581_0493494 3300047315 Bacteria 712
344 Ga0495672_0013642 3300047320 Bacteria 5594
345 Ga0495676_0020464 3300047321 Bacteria 5804
346 Ga0495680_0017789 3300047322 Bacteria 6051
347 Ga0495684_0170493 3300047471 Bacteria 1619
348 Ga0495602_0656555 3300048088 Bacteria 716
349 Ga0495614_0035823 3300048089 Bacteria 2132
350 Ga0496102_0019359 3300048905 Bacteria 5996
351 Ga0496103_0145419 3300048906 Bacteria 1517
352 Ga0496103_0356387 3300048906 Unclassified 940
353 Ga0496104_0342259 3300048907 Bacteria 1408
354 Ga0496104_0688789 3300048907 Bacteria 930
355 Ga0496105_0838377 3300048908 Unclassified 696
356 Ga0496105_1061409 3300048908 Unclassified 603
357 Ga0496106_0054450 3300048909 Bacteria 3022
358 Ga0496106_0851627 3300048909 Bacteria 721
359 Ga0496107_0002957 3300048910 Bacteria 11251
360 Ga0496107_0004681 3300048910 Bacteria 9288
361 Ga0496108_1460972 3300048911 Bacteria 570
362 Ga0496109_0032140 3300048912 Bacteria 4715
363 Ga0496109_0166874 3300048912 Bacteria 2064
364 Ga0496110_0059131 3300048913 Bacteria 3377
365 Ga0496111_0027263 3300048914 Bacteria 4040
366 Ga0496111_0041481 3300048914 Bacteria 3302
367 Ga0496111_0249007 3300048914 Bacteria 1319
368 Ga0496111_0957192 3300048914 Bacteria 615
369 Ga0496112_0102120 3300048915 Bacteria 2837
370 Ga0496112_0266352 3300048915 Bacteria 1662
371 Ga0496112_0519342 3300048915 Bacteria 1125
372 Ga0496113_0030438 3300048916 Bacteria 3907
373 Ga0496113_0106729 3300048916 Unclassified 2175
374 Ga0496115_0106559 3300048918 Bacteria 2301
375 Ga0496115_0963871 3300048918 Unclassified 654
376 Ga0496115_1141142 3300048918 Bacteria 589
377 Ga0496121_0479901 3300048924 Bacteria 794
378 Ga0496125_0182932 3300048928 Bacteria 1394
379 Ga0501031_0291019 3300049568 Bacteria 1059
380 Ga0501031_0600796 3300049568 Bacteria 708
381 Ga0501031_0747116 3300049568 Bacteria 628
382 Ga0501033_0083347 3300049570 Bacteria 2344
383 Ga0501034_0710982 3300049571 Bacteria 903
384 Ga0501034_1313837 3300049571 Bacteria 600
385 Ga0501034_1330561 3300049571 Bacteria 595
386 Ga0501036_0062762 3300049572 Bacteria 3147
387 Ga0501037_0523082 3300049573 Unclassified 803
388 Ga0501038_0085369 3300049574 Bacteria 2655
389 Ga0501038_0164897 3300049574 Bacteria 1798
390 Ga0501038_0507898 3300049574 Bacteria 921
391 Ga0501039_0067782 3300049575 Bacteria 2771
392 Ga0501039_0813964 3300049575 Bacteria 728
393 Ga0501040_0204759 3300049576 Bacteria 1401
394 Ga0501041_0033420 3300049577 Bacteria 3112
395 Ga0501041_0070034 3300049577 Bacteria 2152
396 Ga0501042_0111517 3300049578 Bacteria 1970
397 Ga0501046_0093386 3300049580 Bacteria 2313
398 Ga0501046_0145986 3300049580 Bacteria 1787
399 Ga0501048_0006223 3300049582 Bacteria 9079
400 Ga0501048_0021414 3300049582 Bacteria 4734
401 Ga0501067_0174789 3300049583 Bacteria 1196
402 Ga0501069_0368664 3300049585 Bacteria 848
403 Ga0501070_0545135 3300049586 Bacteria 929
404 Ga0501070_0571560 3300049586 Bacteria 903
405 Ga0501071_0085136 3300049587 Bacteria 2318
406 Ga0501071_0393102 3300049587 Unclassified 1058
407 Ga0501071_0808940 3300049587 Unclassified 723
408 Ga0501072_0029805 3300049588 Bacteria 4264
409 Ga0501073_0054474 3300049589 Bacteria 2800
410 Ga0501073_0917506 3300049589 Bacteria 603
411 Ga0501074_0066817 3300049590 Bacteria 2586
412 Ga0501074_0116452 3300049590 Unclassified 1912
413 Ga0501074_0249099 3300049590 Bacteria 1263
414 Ga0501074_0630470 3300049590 Unclassified 758
415 Ga0501075_0008080 3300049591 Bacteria 7317
416 Ga0501075_0103107 3300049591 Bacteria 2167
417 Ga0501075_0250676 3300049591 Bacteria 1349
418 Ga0501076_0057885 3300049592 Bacteria 3079
419 Ga0501076_0285757 3300049592 Bacteria 1351
420 Ga0501076_0297237 3300049592 Bacteria 1323
421 Ga0501077_0025001 3300049593 Bacteria 3792
422 Ga0501077_0042765 3300049593 Bacteria 2880
423 Ga0501077_0080251 3300049593 Bacteria 2067
424 Ga0501077_0130277 3300049593 Bacteria 1595
425 Ga0501079_0040672 3300049741 Bacteria 3587
426 Ga0501080_0769188 3300049742 Bacteria 846
427 Ga0501080_0898954 3300049742 Bacteria 772
428 Ga0501080_0990860 3300049742 Unclassified 729
429 Ga0501081_0045708 3300049743 Bacteria 3007
430 Ga0501045_0008524 3300049824 Bacteria 7145
431 Ga0501045_0111730 3300049824 Bacteria 2026
432 Ga0501045_0176157 3300049824 Bacteria 1593
433 nmdc:mga03683_211780_c1 3300050489 Bacteria 892
434 nmdc:mga03683_62432_c1 3300050489 Bacteria 1578
435 nmdc:mga03683_67613_c1 3300050489 Bacteria 1521
436 nmdc:mga03683_90808_c1 3300050489 Bacteria 1331
437 nmdc:mga00v17_384732_c1 3300050491 Bacteria 912
438 nmdc:mga0yw44_304284_c1 3300050492 Bacteria 1069
439 nmdc:mga06z11_415350_c1 3300050494 Bacteria 811
440 nmdc:mga07m45_297894_c1 3300050496 Bacteria 938
441 nmdc:mga05p37_145352_c1 3300050507 Bacteria 2904
442 nmdc:mga05p37_1950786_c1 3300050507 Unclassified 558
443 nmdc:mga05p37_216745_c1 3300050507 Bacteria 2312
444 nmdc:mga0qj67_6481_c1 3300050509 Bacteria 8602
445 nmdc:mga08y16_1128593_c1 3300050511 Bacteria 758
446 nmdc:mga08y16_119395_c1 3300050511 Bacteria 2744
447 nmdc:mga08y16_403682_c1 3300050511 Bacteria 1398
448 nmdc:mga08y16_630205_c1 3300050511 Bacteria 1078
449 nmdc:mga08y16_638997_c1 3300050511 Unclassified 1069
450 nmdc:mga0n895_119546_c1 3300050512 Bacteria 2656
451 nmdc:mga0n895_14424_c1 3300050512 Bacteria 7176
452 nmdc:mga0rr50_363159_c1 3300050513 Bacteria 1219
453 nmdc:mga08x19_694968_c1 3300050514 Bacteria 722
454 nmdc:mga0a205_75729_c1 3300050515 Bacteria 3251
455 nmdc:mga0sz30_19040_c1 3300050516 Bacteria 2753
456 Ga0500635_0067404 3300053080 Bacteria 1262
457 Ga0495655_0248232 3300053083 Bacteria 598
458 Ga0495619_0001224 3300053085 Bacteria 16809
459 Ga0500566_0219192 3300053094 Bacteria 947
460 Ga0500641_0000359 3300053096 Bacteria 16910
461 Ga0500568_0005157 3300053139 Bacteria 6813
462 Ga0500637_0009891 3300053178 Bacteria 4878
463 Ga0501084_0061739 3300054114 Bacteria 3138
464 Ga0501084_0127765 3300054114 Bacteria 2140
465 Ga0501084_0352738 3300054114 Unclassified 1243
466 Ga0501084_0979039 3300054114 Bacteria 711
467 Ga0501082_0022789 3300060353 Bacteria 5394
468 Ga0501082_0161474 3300060353 Bacteria 1947
469 Ga0501082_0330286 3300060353 Bacteria 1329
470 Ga0530510_0008703 3300061734 Bacteria 7096
471 Ga0530510_0077575 3300061734 Bacteria 2414
472 Ga0530510_0092755 3300061734 Bacteria 2204
473 Ga0530510_0279001 3300061734 Bacteria 1248
474 2793076979
475 8006989125 8006984368 Bacteria 9651211
476 Ga0070690_100782126
477 JGI25153J46596_10004067
478 Ga0070676_10030330
479 Ga0070676_10132351
480 Ga0070683_100160273
481 Ga0070683_100820483
482 Ga0070690_100482360
483 Ga0070670_100485777
484 Ga0068869_100284728
485 Ga0068869_100379909
486 Ga0068869_100800790
487 Ga0070666_10085826
488 Ga0070682_100015803
489 Ga0070682_100175881
490 Ga0070682_101071135
491 Ga0068868_100016101
492 Ga0070689_100204778
493 Ga0070689_101390972
494 Ga0070687_100198759
495 Ga0070661_100060582
496 Ga0070661_100382531
497 Ga0070668_100062216
498 Ga0070668_100835717
499 Ga0070675_101234376
500 Ga0070671_100558603
501 Ga0070673_100099471
502 Ga0070673_100389719
503 Ga0070688_100217906
504 Ga0070659_100264312
505 Ga0070659_100294600
506 Ga0070659_100408598
507 Ga0070667_100053042
508 Ga0070709_10017254
509 Ga0070709_10021407
510 Ga0070709_10091466
511 Ga0070709_10192194
512 Ga0070709_10390566
513 Ga0070714_100208940
514 Ga0070713_100018513
515 Ga0070713_100145501
516 Ga0070713_100825899
517 Ga0070710_10002269
518 Ga0070710_11196977
519 Ga0070701_10440203
520 Ga0070711_100013048
521 Ga0070711_100087610
522 Ga0070705_100086012
523 Ga0070705_100334393
524 Ga0070700_100106289
525 Ga0070708_100220416
526 Ga0070663_100453349
527 Ga0070678_100010614
528 Ga0070662_100695881
529 Ga0070662_100722273
530 Ga0070681_10113717
531 Ga0068867_100286777
532 Ga0068867_100902896
533 Ga0070685_10247398
534 Ga0070699_100374839
535 Ga0070699_100424439
536 Ga0070679_100169945
537 Ga0070684_100082144
538 Ga0070684_100620360
539 Ga0070697_100597500
540 Ga0070672_100176485
541 Ga0070672_100233553
542 Ga0070686_100130270
543 Ga0070686_100378389
544 Ga0070686_101495586
545 Ga0070695_100407464
546 Ga0070696_100509318
547 Ga0070696_100887837
548 Ga0070693_100095900
549 Ga0070693_100782531
550 Ga0070665_100114843
551 Ga0070665_100723364
552 Ga0070665_101631273
553 Ga0070664_100101337
554 Ga0068854_100986116
555 Ga0068856_100143853
556 Ga0070702_100156808
557 Ga0070702_100556584
558 Ga0068852_100155851
559 Ga0068852_102209851
560 Ga0068859_100111726
561 Ga0068864_100088449
562 Ga0068864_100273765
563 Ga0068866_10148186
564 Ga0068866_10564205
565 Ga0068851_10108324
566 Ga0068863_100011482
567 Ga0068863_101001295
568 Ga0068863_101177114
569 Ga0068858_100412144
570 Ga0068860_100324072
571 Ga0068860_100494803
572 Ga0068862_100441388
573 Ga0081455_10008538
574 Ga0081455_10488963
575 Ga0081540_1010440
576 Ga0081540_1014983
577 Ga0081540_1236911
578 Ga0081539_10011759
579 Ga0081539_10018994
580 Ga0070717_10000430
581 Ga0075365_10136844
582 Ga0075365_10455218
583 Ga0075365_10695082
584 Ga0075365_10973817
585 Ga0075368_10028726
586 Ga0075368_10132393
587 Ga0075364_10145696
588 Ga0070715_10456280
589 Ga0070716_100000617
590 Ga0070716_100272911
591 Ga0070716_100305754
592 Ga0070716_100764085
593 Ga0070712_100023446
594 Ga0070712_100182413
595 Ga0075362_10005907
596 Ga0075362_10017972
597 Ga0075362_10065078
598 Ga0075367_10006406
599 Ga0075367_10102193
600 Ga0075367_10271904
601 Ga0075367_10596890
602 Ga0075369_10009224
603 Ga0097621_100279397
604 Ga0097621_100545845
605 Ga0075370_10007171
606 Ga0075370_10018554
607 Ga0075370_10129235
608 Ga0068871_100017382
609 Ga0075428_100142261
610 Ga0075428_100220169
611 Ga0075433_10459113
612 Ga0075434_100058416
613 Ga0075434_100232916
614 Ga0075434_100417132
615 Ga0075434_101802251
616 Ga0068865_100077508
617 Ga0075436_100079236
618 Ga0075436_100143702
619 Ga0075436_100542843
620 Ga0075436_100764637
621 Ga0097620_100111719
622 Ga0075435_100089269
623 Ga0075435_100344275
624 Ga0075435_100564122
625 Ga0099795_10062259
626 Ga0105251_10045081
627 Ga0111539_10384361
628 Ga0111539_10546764
629 Ga0111539_10926431
630 Ga0111539_12171472
631 Ga0105245_10403714
632 Ga0105245_10641251
633 Ga0105243_11108668
634 Ga0105241_10015721
635 Ga0105242_10015228
636 Ga0105242_11390399
637 Ga0105242_11457339
638 Ga0105248_10395982
639 Ga0105238_10125418
640 Ga0105035_132205
641 Ga0105246_10548991
642 Ga0105246_11590091
643 Ga0157323_1022429
644 Ga0157313_1010307
645 Ga0157338_1000820
646 Ga0157369_11981769
647 Ga0157374_10311644
648 Ga0157378_10060291
649 Ga0163162_10830035
650 Ga0163162_13244889
651 Ga0157380_11584443
652 Ga0157377_10128318
653 Ga0157376_10180064
654 Ga0163161_10120347
655 Ga0224572_1010530
656 Ga0207713_1070665
657 Ga0207653_10275834
658 Ga0207710_10002851
659 Ga0207688_10067750
660 Ga0207688_10174007
661 Ga0207688_10207711
662 Ga0207680_10033146
663 Ga0207680_10543319
664 Ga0207685_10001029
665 Ga0207699_10040801
666 Ga0207699_10151353
667 Ga0207699_10257894
668 Ga0207699_10414062
669 Ga0207645_10028834
670 Ga0207707_10865872
671 Ga0207671_10194932
672 Ga0207671_10703255
673 Ga0207693_10006662
674 Ga0207693_10028396
675 Ga0207693_10030888
676 Ga0207693_11027172
677 Ga0207663_10058573
678 Ga0207663_10228593
679 Ga0207663_11154892
680 Ga0207660_10489622
681 Ga0207657_10120279
682 Ga0207649_10172867
683 Ga0207652_10433028
684 Ga0207681_10268617
685 Ga0207694_10339257
686 Ga0207694_10381134
687 Ga0207650_10304007
688 Ga0207650_10486326
689 Ga0207659_10582221
690 Ga0207659_11792538
691 Ga0207687_10022551
692 Ga0207687_10722202
693 Ga0207700_10002382
694 Ga0207700_10041771
695 Ga0207690_10062753
696 Ga0207690_10328577
697 Ga0207690_10358511
698 Ga0207706_10159008
699 Ga0207686_10031459
700 Ga0207709_10319908
701 Ga0207709_11213304
702 Ga0207670_10006317
703 Ga0207670_10021699
704 Ga0207670_10413614
705 Ga0207665_10000756
706 Ga0207665_10426240
707 Ga0207665_10690107
708 Ga0207691_10371624
709 Ga0207691_11328015
710 Ga0207711_10300603
711 Ga0207689_10214335
712 Ga0207689_10248800
713 Ga0207661_10126370
714 Ga0207651_10077619
715 Ga0207651_10174158
716 Ga0207712_11435453
717 Ga0207668_10344497
718 Ga0207668_10423623
719 Ga0207668_11441952
720 Ga0207668_11611552
721 Ga0207640_10423149
722 Ga0207658_11125189
723 Ga0207677_10010183
724 Ga0207677_10355873
725 Ga0207677_11440693
726 Ga0207703_12359596
727 Ga0207639_10357653
728 Ga0207639_10765153
729 Ga0207678_10069659
730 Ga0207678_10112816
731 Ga0207678_10415710
732 Ga0207708_10272864
733 Ga0207708_10388342
734 Ga0207702_10063171
735 Ga0207641_10731653
736 Ga0207641_11320600
737 Ga0207648_10217585
738 Ga0207648_10426118
739 Ga0207676_10254887
740 Ga0207675_100224996
741 Ga0207675_101749557
742 Ga0207683_10012112
743 Ga0207698_10325772
744 Ga0207698_10753002
745 Ga0209998_10002389
746 Ga0209998_10023382
747 Ga0207428_10546803
748 Ga0265357_1000053
749 Ga0268266_10076367
750 Ga0268266_10090281
751 Ga0268265_10428773
752 Ga0268264_10320466
753 Ga0265334_10015831
754 Ga0265773_1023614
755 Ga0265332_10353007
756 Ga0265325_10002552
757 Ga0265340_10346091
758 Ga0265339_10023218
759 Ga0265316_10065781
760 Ga0265313_10002305
761 Ga0307406_10444420
762 Ga0307411_10583138
763 Ga0307415_100085398
764 Ga0373930_0017890
765 Ga0373948_0045152
766 Ga0373938_0176981
767 Ga0373940_0014355
768 Ga0373949_0003619
769 Ga0373951_0032493
770 Ga0373952_0044739
771 Ga0373932_0020623
772 Ga0373939_0011759
773 Ga0373939_0059039
774 Ga0373941_0045607
775 Ga0373945_0341625
776 Ga0373960_0142762
777 Ga0373943_0029751
778 Ga0373943_0070724
779 Ga0373942_0009684
780 Ga0373961_0010141
781 Ga0373962_0017190
782 Ga0373931_0038410
783 Ga0373931_0061978
784 Ga0373935_0007229
785 Ga0373935_0736661
786 Ga0373927_0016306
787 Ga0373927_0020645
788 Ga0373947_0001131
789 Ga0373925_0468585
790 Ga0395900_1347348
791 Ga0436360_0329185
792 Ga0451851_0569871
793 Ga0451853_3606464
794 Ga0439459_0009546
795 Ga0439459_0059207
796 Ga0439440_0027395
797 Ga0495603_0006194
798 Ga0495603_0108953
799 Ga0495590_0083857
800 Ga0495590_0207889
801 Ga0495580_0049648
802 Ga0495580_0431690
803 Ga0495582_0003861
804 Ga0495639_0096771
805 Ga0495594_0021257
806 Ga0495596_0295352
807 Ga0495583_0123654
808 Ga0495632_0298058
809 Ga0495654_0279695
810 Ga0495667_0410848
811 Ga0495611_0110704
812 Ga0495588_0632197
813 Ga0495647_0012955
814 Ga0495613_0001421
815 Ga0495670_0229830
816 Ga0495600_0132912
817 Ga0495581_0313608
818 Ga0495581_0493494
819 Ga0495672_0013642
820 Ga0495676_0020464
821 Ga0495680_0017789
822 Ga0495684_0170493
823 Ga0495602_0656555
824 Ga0495614_0035823
825 Ga0496102_0019359
826 Ga0496103_0145419
827 Ga0496103_0356387
828 Ga0496104_0342259
829 Ga0496104_0688789
830 Ga0496105_0838377
831 Ga0496105_1061409
832 Ga0496106_0054450
833 Ga0496106_0851627
834 Ga0496107_0002957
835 Ga0496107_0004681
836 Ga0496108_1460972
837 Ga0496109_0032140
838 Ga0496109_0166874
839 Ga0496110_0059131
840 Ga0496111_0027263
841 Ga0496111_0041481
842 Ga0496111_0249007
843 Ga0496111_0957192
844 Ga0496112_0102120
845 Ga0496112_0266352
846 Ga0496112_0519342
847 Ga0496113_0030438
848 Ga0496113_0106729
849 Ga0496115_0106559
850 Ga0496115_0963871
851 Ga0496115_1141142
852 Ga0496121_0479901
853 Ga0496125_0182932
854 Ga0501031_0291019
855 Ga0501031_0600796
856 Ga0501031_0747116
857 Ga0501033_0083347
858 Ga0501034_0710982
859 Ga0501034_1313837
860 Ga0501034_1330561
861 Ga0501036_0062762
862 Ga0501037_0523082
863 Ga0501038_0085369
864 Ga0501038_0164897
865 Ga0501038_0507898
866 Ga0501039_0067782
867 Ga0501039_0813964
868 Ga0501040_0204759
869 Ga0501041_0033420
870 Ga0501041_0070034
871 Ga0501042_0111517
872 Ga0501046_0093386
873 Ga0501046_0145986
874 Ga0501048_0006223
875 Ga0501048_0021414
876 Ga0501067_0174789
877 Ga0501069_0368664
878 Ga0501070_0545135
879 Ga0501070_0571560
880 Ga0501071_0085136
881 Ga0501071_0393102
882 Ga0501071_0808940
883 Ga0501072_0029805
884 Ga0501073_0054474
885 Ga0501073_0917506
886 Ga0501074_0066817
887 Ga0501074_0116452
888 Ga0501074_0249099
889 Ga0501074_0630470
890 Ga0501075_0008080
891 Ga0501075_0103107
892 Ga0501075_0250676
893 Ga0501076_0057885
894 Ga0501076_0285757
895 Ga0501076_0297237
896 Ga0501077_0025001
897 Ga0501077_0042765
898 Ga0501077_0080251
899 Ga0501077_0130277
900 Ga0501079_0040672
901 Ga0501080_0769188
902 Ga0501080_0898954
903 Ga0501080_0990860
904 Ga0501081_0045708
905 Ga0501045_0008524
906 Ga0501045_0111730
907 Ga0501045_0176157
908 nmdc:mga03683_211780_c1
909 nmdc:mga03683_62432_c1
910 nmdc:mga03683_67613_c1
911 nmdc:mga03683_90808_c1
912 nmdc:mga00v17_384732_c1
913 nmdc:mga0yw44_304284_c1
914 nmdc:mga06z11_415350_c1
915 nmdc:mga07m45_297894_c1
916 nmdc:mga05p37_145352_c1
917 nmdc:mga05p37_1950786_c1
918 nmdc:mga05p37_216745_c1
919 nmdc:mga0qj67_6481_c1
920 nmdc:mga08y16_1128593_c1
921 nmdc:mga08y16_119395_c1
922 nmdc:mga08y16_403682_c1
923 nmdc:mga08y16_630205_c1
924 nmdc:mga08y16_638997_c1
925 nmdc:mga0n895_119546_c1
926 nmdc:mga0n895_14424_c1
927 nmdc:mga0rr50_363159_c1
928 nmdc:mga08x19_694968_c1
929 nmdc:mga0a205_75729_c1
930 nmdc:mga0sz30_19040_c1
931 Ga0500635_0067404
932 Ga0495655_0248232
933 Ga0495619_0001224
934 Ga0500566_0219192
935 Ga0500641_0000359
936 Ga0500568_0005157
937 Ga0500637_0009891
938 Ga0501084_0061739
939 Ga0501084_0127765
940 Ga0501084_0352738
941 Ga0501084_0979039
942 Ga0501082_0022789
943 Ga0501082_0161474
944 Ga0501082_0330286
945 Ga0530510_0008703
946 Ga0530510_0077575
947 Ga0530510_0092755
948 Ga0530510_0279001
949 2793076979
950 8006989125

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

17

160

0.89

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

8

162

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.8911 23 158
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.8753 23 158
4fpw-assembly3.cif.gz_B crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8699 23 157
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.8678 22 158
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.8648 23 158
ID Description Score Start End Superfamily
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8764 25 156 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8659 22 158 3.30.530.20
af_Q8N9S3_197_326_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8619 22 158 3.30.530.20
2luzA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8576 21 158 3.30.530.20
2ldkA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8381 23 158 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A0R3MTD3-F1-model_v4 Glutathione S-transferase 0.9961 49 159 GO:0016740
AF-A0A0R3L6U2-F1-model_v4 Glutathione S-transferase 0.9949 49 159 GO:0016740
AF-A0A1H8MZ17-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9943 21 159
AF-A0A4Q7FPF1-F1-model_v4 Glutathione S-transferase 0.9873 38 159 GO:0016740
AF-A0A560KDR4-F1-model_v4 Uncharacterized protein YndB with AHSA1/START domain 0.9744 49 159

Map