F451218

General Info

Members Datasets Scaffolds Average Seq Length
474 275 431 269

Family's Representative Sequence

Representative Sequence 3300041405|Ga0439438_007747|Ga0439438_007747_1892_2779
Length 295
Sequence MLYESHCFTRHADQIKGVVAAIMTSKLTSKTAIVTGAAQGIGAAIVRLFAQEDCFVYVTDINDELGTNVADSLGDRASYLRLDVRREDDWQRVTAQILKVRGRLDVLVNNAGITGFEHGAVPHDPEHARLEDWHAVHQTNLDGVFLGCKYAIRAMRHHGTGSIINISSRSGLVGIPGAAAYASSKAAVRNHTKTVALYCAGQGLKVRCNSIHPAAILTPMWEPMLGTGVDRQERMAALVRDTPLRRFAMPEEVAALALLLASDEATYMTGSELNIDGGLLAGTAATPAAVDDTGD

Samples

Sample ID Description Type Environment
1 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
2 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
3 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
4 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
5 2643221693 Rhizobium sp. Root491 Isolate Unclassified
6 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
7 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
8 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
9 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
10 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
11 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
12 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
13 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
14 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
15 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
16 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
17 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
18 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
19 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
20 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
21 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
22 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
23 2902330777 Methylobacterium sp. 2A Isolate Unclassified
24 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
25 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
26 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
27 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
28 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
29 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
30 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
31 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
32 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
33 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
34 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
35 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
36 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
37 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
38 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
39 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
40 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
41 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
101 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
154 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
155 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
156 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
161 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
177 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
178 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
179 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
180 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
181 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
182 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
183 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
184 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
188 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
189 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
190 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
191 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
192 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
193 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
199 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
208 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
209 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
210 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
211 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
217 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
218 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
219 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
225 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
226 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
227 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
228 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
229 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
230 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
231 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
248 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
249 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
250 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
251 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
252 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
253 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
254 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
255 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
258 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
259 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
260 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
263 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
264 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
265 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
266 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
267 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
270 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
271 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
272 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
273 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
274 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
275 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.35
Metatranscriptomes 0
Isolates 8.65

Biome Distribution

Category Percentage (%)
Aerial Root 0.63
Bulb 0
Endosphere 6.96
Nodule 0
Rhizoplane 3.8
Rhizosphere 76.79
Stem 0
Stem Tuber 0
Unclassified 11.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10002673 3300005288 Bacteria 16127
2 Ga0065704_10144112 3300005289 Bacteria 1476
3 Ga0065712_10067816 3300005290 Bacteria 29496
4 Ga0065707_10131737 3300005295 Bacteria 1904
5 Ga0070683_100155224 3300005329 Bacteria 2171
6 Ga0070670_100006319 3300005331 Bacteria 10027
7 Ga0070680_100493293 3300005336 Bacteria 1047
8 Ga0070689_100178710 3300005340 Bacteria 1723
9 Ga0070669_100271854 3300005353 Unclassified 1355
10 Ga0070671_100004760 3300005355 Bacteria 10786
11 Ga0070673_100021115 3300005364 Bacteria 4712
12 Ga0070688_100147821 3300005365 Bacteria 1603
13 Ga0070709_10187945 3300005434 Bacteria 1455
14 Ga0070714_100114040 3300005435 Bacteria 2397
15 Ga0070714_100281308 3300005435 Bacteria 1546
16 Ga0070713_100015645 3300005436 Bacteria 5682
17 Ga0070684_100178598 3300005535 Bacteria 1930
18 Ga0070686_100014396 3300005544 Bacteria 4561
19 Ga0070696_100058746 3300005546 Bacteria 2686
20 Ga0070693_100280702 3300005547 Bacteria 1115
21 Ga0070665_100001559 3300005548 Bacteria 26480
22 Ga0070665_100046838 3300005548 Bacteria 4341
23 Ga0070665_100077062 3300005548 Bacteria 3340
24 Ga0068854_100014354 3300005578 Bacteria 5220
25 Ga0068856_100033417 3300005614 Bacteria 5036
26 Ga0068859_100215902 3300005617 Bacteria 2005
27 Ga0068866_10000010 3300005718 Bacteria 98038
28 Ga0068863_100007643 3300005841 Bacteria 10571
29 Ga0068858_100054505 3300005842 Bacteria 3697
30 Ga0070717_10010926 3300006028 Bacteria 6874
31 Ga0075363_100002524 3300006048 Bacteria 7505
32 Ga0075363_100028661 3300006048 Bacteria 2866
33 Ga0075364_10042241 3300006051 Bacteria 2962
34 Ga0075432_10004553 3300006058 Bacteria 4718
35 Ga0075362_10000001 3300006177 Bacteria 215983
36 Ga0075369_10003528 3300006186 Bacteria 5694
37 Ga0075366_10000420 3300006195 Bacteria 19887
38 Ga0075366_10023013 3300006195 Bacteria 3629
39 Ga0075366_10028711 3300006195 Bacteria 3266
40 Ga0075370_10000755 3300006353 Bacteria 12931
41 Ga0075370_10002962 3300006353 Bacteria 7979
42 Ga0075436_100061874 3300006914 Bacteria 2587
43 Ga0097620_100215919 3300006931 Bacteria 2005
44 Ga0105251_10009557 3300009011 Bacteria 5715
45 Ga0105244_10009826 3300009036 Bacteria 5842
46 Ga0105244_10013674 3300009036 Bacteria 4730
47 Ga0105250_10074408 3300009092 Bacteria 1374
48 Ga0105240_10001164 3300009093 Bacteria 46080
49 Ga0105240_10097845 3300009093 Bacteria 3575
50 Ga0105240_10118551 3300009093 Bacteria 3189
51 Ga0105245_10055605 3300009098 Bacteria 3555
52 Ga0105247_10006021 3300009101 Bacteria 7553
53 Ga0105243_10018050 3300009148 Bacteria 5337
54 Ga0105242_10000033 3300009176 Bacteria 98044
55 Ga0105242_10033807 3300009176 Unclassified 4097
56 Ga0105248_10053246 3300009177 Bacteria 4541
57 Ga0105237_10077233 3300009545 Bacteria 3320
58 Ga0105238_10086028 3300009551 Bacteria 3131
59 Ga0105249_10013530 3300009553 Bacteria 7206
60 Ga0105239_10000158 3300010375 Bacteria 98044
61 Ga0105239_10090933 3300010375 Bacteria 3367
62 Ga0105246_10008208 3300011119 Bacteria 6413
63 Ga0157373_10003097 3300013100 Bacteria 12568
64 Ga0157373_10018736 3300013100 Bacteria 5037
65 Ga0157371_10000042 3300013102 Bacteria 198938
66 Ga0157371_10000087 3300013102 Bacteria 146302
67 Ga0157371_10001302 3300013102 Bacteria 26246
68 Ga0157371_10016467 3300013102 Bacteria 5517
69 Ga0157371_10019184 3300013102 Bacteria 5046
70 Ga0157370_10000949 3300013104 Bacteria 36770
71 Ga0157370_10098135 3300013104 Bacteria 2748
72 Ga0157370_10150210 3300013104 Bacteria 2168
73 Ga0157369_10002690 3300013105 Bacteria 21198
74 Ga0157369_10193509 3300013105 Bacteria 2136
75 Ga0157374_10004364 3300013296 Bacteria 11902
76 Ga0157374_10111161 3300013296 Unclassified 2636
77 Ga0163162_10022470 3300013306 Bacteria 6214
78 Ga0163162_10165104 3300013306 Bacteria 2338
79 Ga0157372_10447531 3300013307 Bacteria 1505
80 Ga0157372_10509624 3300013307 Bacteria 1403
81 Ga0157375_10011487 3300013308 Bacteria 7824
82 Ga0163163_10090946 3300014325 Bacteria 3065
83 Ga0163163_10505791 3300014325 Unclassified 1270
84 Ga0157377_10004660 3300014745 Bacteria 6344
85 Ga0157379_10015012 3300014968 Bacteria 6795
86 Ga0157379_10165151 3300014968 Bacteria 1998
87 Ga0157379_10355921 3300014968 Bacteria 1341
88 Ga0157376_10582000 3300014969 Bacteria 1112
89 Ga0182005_1000869 3300015265 Bacteria 13440
90 Ga0213874_10038026 3300021377 Bacteria 1427
91 Ga0213876_10000108 3300021384 Bacteria 91222
92 Ga0209233_1021129 3300025261 Bacteria 1693
93 Ga0207655_1023841 3300025728 Bacteria 3018
94 Ga0207655_1060934 3300025728 Bacteria 1460
95 Ga0207713_1015739 3300025735 Bacteria 3866
96 Ga0207642_10000039 3300025899 Bacteria 37647
97 Ga0207699_10158442 3300025906 Bacteria 1505
98 Ga0207695_10002020 3300025913 Bacteria 31228
99 Ga0207671_10035283 3300025914 Bacteria 3713
100 Ga0207693_10000798 3300025915 Bacteria 28107
101 Ga0207660_10012385 3300025917 Bacteria 5580
102 Ga0207649_10039175 3300025920 Bacteria 2871
103 Ga0207681_10245574 3300025923 Unclassified 1395
104 Ga0207694_10062970 3300025924 Bacteria 2889
105 Ga0207650_10095516 3300025925 Bacteria 2279
106 Ga0207650_10197693 3300025925 Bacteria 1609
107 Ga0207700_10277510 3300025928 Bacteria 1440
108 Ga0207706_10130497 3300025933 Bacteria 2210
109 Ga0207686_10000040 3300025934 Bacteria 125321
110 Ga0207686_10017041 3300025934 Unclassified 4086
111 Ga0207670_10135985 3300025936 Bacteria 1807
112 Ga0207665_10006227 3300025939 Bacteria 7926
113 Ga0207711_10021883 3300025941 Bacteria 5341
114 Ga0207651_10059571 3300025960 Bacteria 2646
115 Ga0207712_10007079 3300025961 Bacteria 7074
116 Ga0207640_10011609 3300025981 Bacteria 4992
117 Ga0207640_10115642 3300025981 Bacteria 1911
118 Ga0207703_10040815 3300026035 Bacteria 3716
119 Ga0207641_10111822 3300026088 Bacteria 2422
120 Ga0207676_10006866 3300026095 Bacteria 8062
121 Ga0209813_10035576 3300027866 Bacteria 1492
122 Ga0207428_10349684 3300027907 Bacteria 1088
123 Ga0268266_10012466 3300028379 Bacteria 7346
124 Ga0268266_10019875 3300028379 Bacteria 5724
125 Ga0268266_10135770 3300028379 Bacteria 2203
126 Ga0265338_10000002 3300028800 Bacteria 856588
127 Ga0265327_10044196 3300031251 Bacteria 2378
128 Ga0307516_10011376 3300031730 Bacteria 9677
129 Ga0307405_10137084 3300031731 Bacteria 1700
130 Ga0307405_10142945 3300031731 Bacteria 1671
131 Ga0307405_10153394 3300031731 Bacteria 1623
132 Ga0307413_10007152 3300031824 Bacteria 5157
133 Ga0307413_10022210 3300031824 Bacteria 3415
134 Ga0307410_10016814 3300031852 Bacteria 4373
135 Ga0307410_10022985 3300031852 Bacteria 3866
136 Ga0307410_10076420 3300031852 Bacteria 2338
137 Ga0307406_10004380 3300031901 Bacteria 7678
138 Ga0307406_10215039 3300031901 Bacteria 1425
139 Ga0307407_10098201 3300031903 Bacteria 1811
140 Ga0307407_10267320 3300031903 Bacteria 1179
141 Ga0307412_10014584 3300031911 Bacteria 4639
142 Ga0307412_10036710 3300031911 Bacteria 3142
143 Ga0307412_10163087 3300031911 Bacteria 1658
144 Ga0307409_100024363 3300031995 Bacteria 4219
145 Ga0307416_100069720 3300032002 Bacteria 2911
146 Ga0307416_100092410 3300032002 Bacteria 2602
147 Ga0307414_10564232 3300032004 Bacteria 1016
148 Ga0307411_10001063 3300032005 Bacteria 10640
149 Ga0307415_100025809 3300032126 Bacteria 3695
150 Ga0307415_100209618 3300032126 Bacteria 1553
151 Ga0307510_10262916 3300033180 Bacteria 1206
152 Ga0373928_0018080 3300035084 Bacteria 1457
153 Ga0373955_0037743 3300035172 Bacteria 2570
154 Ga0373924_0128281 3300035410 Bacteria 1103
155 Ga0373937_0010433 3300036401 Bacteria 8114
156 Ga0373937_0057797 3300036401 Bacteria 3564
157 Ga0373937_0076431 3300036401 Bacteria 3093
158 Ga0436364_0025440 3300037853 Bacteria 1167
159 Ga0436365_1544656 3300039437 Bacteria 122419
160 Ga0436363_1022650 3300039450 Bacteria 2212
161 Ga0439438_007747 3300041405 Bacteria 3635
162 Ga0451839_1458409 3300041496 Bacteria 1310
163 Ga0450902_001813 3300042137 Bacteria 2959
164 Ga0450903_007359 3300042138 Bacteria 1813
165 Ga0451577_0003852 3300042876 Bacteria 16286
166 Ga0451577_0008230 3300042876 Bacteria 10163
167 Ga0451577_0009737 3300042876 Bacteria 9214
168 Ga0451577_0056180 3300042876 Bacteria 3511
169 Ga0451577_0440567 3300042876 Bacteria 1183
170 Ga0453684_0003435 3300044712 Bacteria 35725
171 Ga0453684_0014447 3300044712 Bacteria 12631
172 Ga0453684_0388855 3300044712 Unclassified 1565
173 Ga0451576_0000816 3300045051 Bacteria 60979
174 Ga0451576_0014253 3300045051 Bacteria 8856
175 Ga0451576_0093725 3300045051 Bacteria 3122
176 Ga0451576_0145419 3300045051 Bacteria 2472
177 Ga0451576_0447175 3300045051 Bacteria 1356
178 Ga0495617_015594 3300046452 Bacteria 2573
179 Ga0495617_019114 3300046452 Bacteria 2316
180 Ga0495617_024931 3300046452 Bacteria 2017
181 Ga0495617_042621 3300046452 Bacteria 1517
182 Ga0495627_002032 3300046453 Bacteria 10398
183 Ga0495603_0025487 3300046455 Bacteria 3577
184 Ga0495591_000572 3300046458 Bacteria 28176
185 Ga0495591_004689 3300046458 Bacteria 6566
186 Ga0495591_005240 3300046458 Bacteria 6057
187 Ga0495591_030341 3300046458 Bacteria 1633
188 Ga0495629_0232645 3300046459 Bacteria 1270
189 Ga0495638_0000125 3300046460 Bacteria 125288
190 Ga0495638_0009088 3300046460 Bacteria 6996
191 Ga0495638_0016539 3300046460 Bacteria 4938
192 Ga0495638_0017589 3300046460 Bacteria 4763
193 Ga0495638_0055457 3300046460 Bacteria 2460
194 Ga0495651_0285929 3300046462 Bacteria 1112
195 Ga0495653_0000074 3300046463 Bacteria 83844
196 Ga0495653_0210037 3300046463 Bacteria 1315
197 Ga0495650_0000073 3300046471 Bacteria 253286
198 Ga0495650_0024603 3300046471 Bacteria 2841
199 Ga0495650_0069222 3300046471 Bacteria 1389
200 Ga0495580_0000333 3300046472 Bacteria 38634
201 Ga0495582_0000337 3300046473 Bacteria 25686
202 Ga0495582_0060544 3300046473 Bacteria 2089
203 Ga0495605_0013757 3300046474 Bacteria 4447
204 Ga0495639_0009636 3300046475 Bacteria 4145
205 Ga0495664_0028753 3300046477 Bacteria 3247
206 Ga0495664_0049277 3300046477 Bacteria 2500
207 Ga0495584_0005520 3300046491 Bacteria 6698
208 Ga0495584_0013234 3300046491 Bacteria 4210
209 Ga0495584_0016459 3300046491 Bacteria 3770
210 Ga0495584_0035916 3300046491 Bacteria 2504
211 Ga0495584_0037183 3300046491 Bacteria 2459
212 Ga0495585_0003487 3300046492 Bacteria 10614
213 Ga0495585_0009796 3300046492 Bacteria 5731
214 Ga0495585_0057997 3300046492 Bacteria 2136
215 Ga0495585_0081537 3300046492 Bacteria 1752
216 Ga0495594_0007557 3300046499 Bacteria 5592
217 Ga0495594_0027223 3300046499 Bacteria 3080
218 Ga0495594_0109554 3300046499 Bacteria 1557
219 Ga0495596_0041606 3300046500 Bacteria 1811
220 Ga0495596_0057844 3300046500 Bacteria 1512
221 Ga0495607_0002252 3300046501 Bacteria 15927
222 Ga0495607_0002425 3300046501 Bacteria 15219
223 Ga0495607_0007675 3300046501 Bacteria 7434
224 Ga0495607_0018059 3300046501 Bacteria 4508
225 Ga0495607_0025923 3300046501 Bacteria 3640
226 Ga0495583_0000239 3300046506 Bacteria 91038
227 Ga0495583_0000380 3300046506 Bacteria 68842
228 Ga0495606_0000047 3300046507 Bacteria 207892
229 Ga0495606_0000191 3300046507 Bacteria 107427
230 Ga0495606_0001383 3300046507 Bacteria 32778
231 Ga0495606_0008939 3300046507 Bacteria 8576
232 Ga0495606_0036169 3300046507 Bacteria 3366
233 Ga0495610_0000259 3300046512 Bacteria 55671
234 Ga0495610_0001242 3300046512 Bacteria 22922
235 Ga0495610_0006257 3300046512 Bacteria 8249
236 Ga0495610_0011148 3300046512 Bacteria 5518
237 Ga0495610_0032266 3300046512 Bacteria 2723
238 Ga0495610_0057115 3300046512 Bacteria 1873
239 Ga0495610_0064231 3300046512 Bacteria 1736
240 Ga0495616_0012394 3300046513 Bacteria 4842
241 Ga0495616_0043923 3300046513 Bacteria 2268
242 Ga0495618_0018225 3300046514 Bacteria 4311
243 Ga0495620_0000106 3300046515 Bacteria 66942
244 Ga0495620_0004947 3300046515 Bacteria 7476
245 Ga0495620_0007542 3300046515 Bacteria 5900
246 Ga0495628_0101172 3300046516 Bacteria 2224
247 Ga0495630_0003690 3300046517 Bacteria 10677
248 Ga0495631_0000005 3300046518 Bacteria 159179
249 Ga0495631_0013846 3300046518 Bacteria 3903
250 Ga0495632_0002209 3300046519 Bacteria 15014
251 Ga0495632_0012402 3300046519 Bacteria 4919
252 Ga0495632_0031566 3300046519 Bacteria 2736
253 Ga0495632_0060025 3300046519 Bacteria 1849
254 Ga0495632_0104935 3300046519 Bacteria 1330
255 Ga0495637_0000016 3300046520 Bacteria 226914
256 Ga0495637_0000209 3300046520 Bacteria 45853
257 Ga0495637_0002236 3300046520 Bacteria 10775
258 Ga0495637_0006482 3300046520 Bacteria 5872
259 Ga0495637_0009551 3300046520 Bacteria 4728
260 Ga0495637_0020556 3300046520 Bacteria 3037
261 Ga0495643_0052348 3300046522 Bacteria 2192
262 Ga0495643_0076429 3300046522 Bacteria 1751
263 Ga0495643_0093071 3300046522 Bacteria 1552
264 Ga0495644_0009446 3300046523 Bacteria 3760
265 Ga0495644_0012346 3300046523 Bacteria 3284
266 Ga0495648_0000337 3300046524 Bacteria 51818
267 Ga0495648_0042314 3300046524 Bacteria 2867
268 Ga0495648_0045547 3300046524 Bacteria 2727
269 Ga0495666_0010440 3300046526 Bacteria 4629
270 Ga0495666_0022832 3300046526 Bacteria 3096
271 Ga0495652_0192357 3300046529 Bacteria 1556
272 Ga0495654_0000822 3300046530 Bacteria 23588
273 Ga0495654_0000853 3300046530 Bacteria 23109
274 Ga0495654_0005005 3300046530 Bacteria 7779
275 Ga0495654_0006885 3300046530 Bacteria 6413
276 Ga0495654_0009304 3300046530 Bacteria 5386
277 Ga0495654_0153170 3300046530 Bacteria 1018
278 Ga0495640_0030101 3300046533 Bacteria 3890
279 Ga0495586_0012867 3300046535 Bacteria 4436
280 Ga0495586_0037486 3300046535 Bacteria 2603
281 Ga0495609_0000013 3300046538 Bacteria 328540
282 Ga0495597_0000560 3300046542 Bacteria 30875
283 Ga0495597_0001185 3300046542 Bacteria 19569
284 Ga0495597_0007465 3300046542 Bacteria 5548
285 Ga0495597_0009584 3300046542 Bacteria 4775
286 Ga0495645_0044854 3300046543 Bacteria 3224
287 Ga0495622_0003429 3300046557 Bacteria 7471
288 Ga0495622_0052369 3300046557 Bacteria 1893
289 Ga0495622_0071663 3300046557 Bacteria 1599
290 Ga0495633_0019790 3300046558 Bacteria 3398
291 Ga0495633_0038823 3300046558 Bacteria 2273
292 Ga0495633_0051281 3300046558 Bacteria 1944
293 Ga0495668_0031108 3300046616 Bacteria 3008
294 Ga0495634_0006923 3300046642 Bacteria 8569
295 Ga0495611_0002227 3300046648 Bacteria 9016
296 Ga0495611_0006072 3300046648 Bacteria 5154
297 Ga0495625_0001999 3300046660 Bacteria 23019
298 Ga0495625_0002509 3300046660 Bacteria 19766
299 Ga0495661_0001171 3300046665 Bacteria 22887
300 Ga0495661_0066894 3300046665 Bacteria 2113
301 Ga0495661_0097121 3300046665 Bacteria 1664
302 Ga0495661_0162756 3300046665 Bacteria 1196
303 Ga0495588_0004377 3300046674 Bacteria 6238
304 Ga0495623_0036485 3300046679 Bacteria 3149
305 Ga0495646_0109779 3300046680 Bacteria 1572
306 Ga0495647_0008258 3300046681 Bacteria 3498
307 Ga0495647_0020034 3300046681 Bacteria 2398
308 Ga0495658_0001905 3300046683 Bacteria 10652
309 Ga0495613_0003883 3300046689 Bacteria 11183
310 Ga0495613_0004129 3300046689 Bacteria 10865
311 Ga0495624_0070028 3300046690 Bacteria 2184
312 Ga0495670_0000373 3300046691 Bacteria 21412
313 Ga0495670_0033157 3300046691 Bacteria 2570
314 Ga0495671_0009122 3300046692 Bacteria 5555
315 Ga0495671_0019731 3300046692 Bacteria 3559
316 Ga0495671_0022381 3300046692 Bacteria 3313
317 Ga0495671_0044456 3300046692 Bacteria 2226
318 Ga0495671_0095733 3300046692 Bacteria 1452
319 Ga0495649_0000235 3300046694 Bacteria 48704
320 Ga0495649_0000267 3300046694 Bacteria 46493
321 Ga0495649_0003429 3300046694 Bacteria 10700
322 Ga0495649_0004927 3300046694 Bacteria 8607
323 Ga0495649_0019939 3300046694 Bacteria 3763
324 Ga0495649_0025217 3300046694 Bacteria 3312
325 Ga0495649_0146291 3300046694 Bacteria 1242
326 Ga0495589_0000799 3300046794 Bacteria 19935
327 Ga0495589_0004134 3300046794 Bacteria 7764
328 Ga0495660_0003700 3300046810 Bacteria 9389
329 Ga0495660_0028665 3300046810 Bacteria 3143
330 Ga0495674_0004168 3300047319 Bacteria 13947
331 Ga0495672_0000957 3300047320 Bacteria 29998
332 Ga0495672_0005734 3300047320 Bacteria 9778
333 Ga0495672_0012510 3300047320 Bacteria 5917
334 Ga0495672_0035507 3300047320 Bacteria 3070
335 Ga0495672_0123508 3300047320 Bacteria 1372
336 Ga0495676_0000001 3300047321 Bacteria 624167
337 Ga0495676_0218593 3300047321 Bacteria 1314
338 Ga0495680_0085932 3300047322 Bacteria 2368
339 Ga0495683_0000010 3300047323 Bacteria 223494
340 Ga0495683_0000111 3300047323 Bacteria 83676
341 Ga0495683_0000300 3300047323 Bacteria 42071
342 Ga0495683_0000893 3300047323 Bacteria 21046
343 Ga0495679_001739 3300047446 Bacteria 11996
344 Ga0495679_004386 3300047446 Bacteria 6532
345 Ga0495673_0000315 3300047469 Bacteria 62914
346 Ga0495673_0008224 3300047469 Bacteria 5888
347 Ga0495673_0036979 3300047469 Bacteria 2234
348 Ga0495673_0060795 3300047469 Bacteria 1619
349 Ga0495681_0001840 3300047470 Bacteria 15589
350 Ga0495681_0002167 3300047470 Bacteria 14237
351 Ga0495681_0014674 3300047470 Bacteria 4476
352 Ga0495681_0140769 3300047470 Bacteria 1019
353 Ga0495684_0317276 3300047471 Bacteria 1115
354 Ga0495686_0044585 3300047472 Bacteria 2808
355 Ga0495686_0102027 3300047472 Bacteria 1729
356 Ga0495686_0109881 3300047472 Bacteria 1654
357 Ga0495686_0131840 3300047472 Bacteria 1481
358 Ga0495614_0070503 3300048089 Bacteria 1506
359 Ga0495626_0000008 3300048091 Bacteria 271853
360 Ga0495626_0001694 3300048091 Bacteria 16945
361 Ga0495626_0003736 3300048091 Bacteria 9609
362 Ga0495626_0071605 3300048091 Bacteria 1557
363 Ga0496100_0177282 3300048903 Bacteria 1539
364 Ga0496102_0248524 3300048905 Bacteria 1677
365 Ga0496102_0302989 3300048905 Bacteria 1506
366 Ga0496103_0078561 3300048906 Bacteria 2073
367 Ga0496103_0155598 3300048906 Bacteria 1465
368 Ga0496104_0033215 3300048907 Bacteria 4805
369 Ga0496104_0196982 3300048907 Bacteria 1926
370 Ga0496105_0070751 3300048908 Bacteria 2884
371 Ga0496105_0099613 3300048908 Bacteria 2400
372 Ga0496107_0077653 3300048910 Bacteria 2419
373 Ga0496108_0144498 3300048911 Bacteria 2050
374 Ga0496108_0153930 3300048911 Bacteria 1985
375 Ga0496109_0006440 3300048912 Bacteria 9891
376 Ga0496112_0097791 3300048915 Bacteria 2905
377 Ga0496113_0014292 3300048916 Bacteria 5413
378 Ga0496113_0062315 3300048916 Bacteria 2816
379 Ga0496114_0035388 3300048917 Bacteria 4123
380 Ga0496115_0164042 3300048918 Bacteria 1837
381 Ga0496116_0083794 3300048919 Bacteria 1966
382 Ga0496117_0000036 3300048920 Bacteria 325635
383 Ga0496118_0020707 3300048921 Bacteria 5823
384 Ga0496120_0000036 3300048923 Bacteria 206505
385 Ga0496122_0000002 3300048925 Bacteria 905834
386 Ga0496122_0021019 3300048925 Bacteria 5862
387 Ga0496122_0027483 3300048925 Bacteria 4862
388 Ga0496122_0045887 3300048925 Bacteria 3390
389 Ga0496122_0053275 3300048925 Bacteria 3052
390 Ga0496123_0000002 3300048926 Bacteria 1811682
391 Ga0496123_0021464 3300048926 Bacteria 5018
392 Ga0496123_0021553 3300048926 Bacteria 5004
393 Ga0496123_0033831 3300048926 Bacteria 3671
394 Ga0496123_0051409 3300048926 Bacteria 2744
395 Ga0496124_0000352 3300048927 Bacteria 83918
396 Ga0496124_0002004 3300048927 Bacteria 27739
397 Ga0496124_0009476 3300048927 Bacteria 10028
398 Ga0496124_0015783 3300048927 Bacteria 7216
399 Ga0496124_0040910 3300048927 Bacteria 4004
400 Ga0496124_0157262 3300048927 Bacteria 1776
401 Ga0496125_0002700 3300048928 Bacteria 22587
402 Ga0496125_0072924 3300048928 Bacteria 2673
403 Ga0496126_0022135 3300048929 Bacteria 6192
404 Ga0496126_0175697 3300048929 Bacteria 1822
405 Ga0495678_001289 3300049459 Bacteria 20269
406 Ga0495678_007901 3300049459 Bacteria 5457
407 Ga0495678_023832 3300049459 Bacteria 2653
408 Ga0495678_050172 3300049459 Bacteria 1618
409 Ga0495678_086461 3300049459 Bacteria 1114
410 nmdc:mga03683_18938_c1 3300050489 Bacteria 2623
411 nmdc:mga03683_48_c1 3300050489 Bacteria 53827
412 nmdc:mga03n38_217_c1 3300050490 Bacteria 13275
413 nmdc:mga00v17_19_c1 3300050491 Bacteria 115002
414 nmdc:mga0yw44_109487_c1 3300050492 Bacteria 1769
415 nmdc:mga0k408_39269_c1 3300050493 Bacteria 2718
416 nmdc:mga0k408_93_c1 3300050493 Bacteria 42678
417 nmdc:mga06z11_157033_c1 3300050494 Bacteria 1297
418 nmdc:mga07m45_424_c2 3300050496 Bacteria 15989
419 nmdc:mga07m45_46_c1 3300050496 Bacteria 18747
420 nmdc:mga0rr50_470411_c1 3300050513 Bacteria 1067
421 nmdc:mga0sz30_342_c1 3300050516 Bacteria 11527
422 nmdc:mga0sz30_64_c1 3300050516 Bacteria 41162
423 Ga0500635_0001853 3300053080 Bacteria 5152
424 Ga0500641_0012263 3300053096 Bacteria 3128
425 Ga0500560_000014 3300053107 Bacteria 24771
426 Ga0500572_008143 3300053111 Bacteria 2443
427 Ga0500561_0000094 3300053137 Bacteria 17138
428 Ga0500616_0054828 3300053153 Bacteria 2086
429 Ga0500622_0086790 3300053156 Bacteria 1559
430 Ga0500624_000218 3300053157 Bacteria 21576
431 Ga0500634_0012206 3300053161 Bacteria 4465

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013102 Ga0157371_10000087 Ga0157371_10000087136 231
2 3300044712 Ga0453684_0388855 Ga0453684_0388855_341_1147 240
3 iso_pu_bacteria 2899845264 2899848654 246
4 iso_pu_bacteria 2926760298 2926763255 246
5 3300036401 Ga0373937_0057797 Ga0373937_0057797_1659_2468 247
6 3300053096 Ga0500641_0012263 Ga0500641_0012263_316_1128 248
7 3300046522 Ga0495643_0093071 Ga0495643_0093071_776_1528 250
8 3300048925 Ga0496122_0027483 Ga0496122_0027483_3140_3961 250
9 3300048926 Ga0496123_0021553 Ga0496123_0021553_2288_3109 250
10 iso_pu_bacteria 2738541275 2738709602 255
11 iso_pu_bacteria 2738541301 2738848027 255
12 iso_pu_bacteria 2738541304 2738863756 255
13 iso_pu_bacteria 2738543022 2739296274 255
14 iso_pu_bacteria 2738543033 2739357952 255
15 iso_pu_bacteria 2751185897 2753767898 255
16 iso_pu_bacteria 2808606401 2809061892 255
17 iso_pu_bacteria 2808606404 2809077856 255
18 iso_pu_bacteria 2808606405 2809082436 255
19 iso_pu_bacteria 2842775625 2842776599 255
20 iso_pu_bacteria 2880518877 2880519925 255
21 iso_pu_bacteria 2928027323 2928028397 255
22 iso_pu_bacteria 2928100450 2928101157 255
23 iso_pu_bacteria 2928959182 2928960432 255
24 iso_pu_bacteria 2928968154 2928971175 255
25 iso_pu_bacteria 2984564862 2984565722 255
26 iso_pu_bacteria 8002060224 8002062408 255
27 3300013296 Ga0157374_10111161 Ga0157374_101111612 256
28 iso_pu_bacteria 2554235003 2554245925 256
29 iso_pu_bacteria 2558860242 2559296309 256
30 iso_pu_bacteria 2643221693 2644522888 256
31 iso_pu_bacteria 2808606387 2808988527 256
32 iso_pu_bacteria 2899275550 2899278032 256
33 iso_pu_bacteria 2979089926 2979091713 256
34 iso_pu_bacteria 2979095461 2979097233 256
35 iso_pu_bacteria 3000017691 3000020979 256
36 iso_pu_bacteria 650716007 650842701 256
37 iso_pu_bacteria 8054460903 8054465519 256
38 3300031901 Ga0307406_10215039 Ga0307406_102150392 257
39 3300047471 Ga0495684_0317276 Ga0495684_0317276_326_1099 257
40 3300006048 Ga0075363_100002524 Ga0075363_1000025246 259
41 3300006051 Ga0075364_10042241 Ga0075364_100422412 259
42 3300006177 Ga0075362_10000001 Ga0075362_1000000134 259
43 3300006186 Ga0075369_10003528 Ga0075369_100035286 259
44 3300006195 Ga0075366_10000420 Ga0075366_1000042021 259
45 3300006195 Ga0075366_10023013 Ga0075366_100230134 259
46 3300006353 Ga0075370_10000755 Ga0075370_100007552 259
47 3300013102 Ga0157371_10016467 Ga0157371_100164674 259
48 3300013306 Ga0163162_10165104 Ga0163162_101651042 259
49 3300025914 Ga0207671_10035283 Ga0207671_100352832 259
50 3300025941 Ga0207711_10021883 Ga0207711_100218834 259
51 3300025981 Ga0207640_10011609 Ga0207640_100116094 259
52 3300031251 Ga0265327_10044196 Ga0265327_100441962 259
53 3300031911 Ga0307412_10036710 Ga0307412_100367105 259
54 3300035084 Ga0373928_0018080 Ga0373928_0018080_547_1326 259
55 3300041496 Ga0451839_1458409 Ga0451839_1458409_353_1132 259
56 3300045051 Ga0451576_0093725 Ga0451576_0093725_1240_2019 259
57 3300045051 Ga0451576_0447175 Ga0451576_0447175_154_933 259
58 3300046462 Ga0495651_0285929 Ga0495651_0285929_173_952 259
59 3300046512 Ga0495610_0032266 Ga0495610_0032266_1640_2419 259
60 3300046529 Ga0495652_0192357 Ga0495652_0192357_641_1420 259
61 3300046689 Ga0495613_0003883 Ga0495613_0003883_199_978 259
62 3300047472 Ga0495686_0044585 Ga0495686_0044585_1439_2218 259
63 3300048918 Ga0496115_0164042 Ga0496115_0164042_71_850 259
64 3300048925 Ga0496122_0053275 Ga0496122_0053275_808_1587 259
65 3300048926 Ga0496123_0021464 Ga0496123_0021464_3829_4608 259
66 3300048926 Ga0496123_0033831 Ga0496123_0033831_1951_2730 259
67 3300048927 Ga0496124_0000352 Ga0496124_0000352_11347_12126 259
68 3300048927 Ga0496124_0002004 Ga0496124_0002004_15525_16304 259
69 3300048927 Ga0496124_0009476 Ga0496124_0009476_6640_7419 259
70 3300048927 Ga0496124_0040910 Ga0496124_0040910_1754_2533 259
71 3300048927 Ga0496124_0157262 Ga0496124_0157262_801_1580 259
72 3300050489 nmdc:mga03683_48_c1 nmdc:mga03683_48_c1_36934_37713 259
73 3300050490 nmdc:mga03n38_217_c1 nmdc:mga03n38_217_c1_9535_10314 259
74 3300050493 nmdc:mga0k408_39269_c1 nmdc:mga0k408_39269_c1_475_1254 259
75 3300050493 nmdc:mga0k408_93_c1 nmdc:mga0k408_93_c1_39529_40308 259
76 3300050496 nmdc:mga07m45_46_c1 nmdc:mga07m45_46_c1_16839_17618 259
77 3300050513 nmdc:mga0rr50_470411_c1 nmdc:mga0rr50_470411_c1_127_906 259
78 3300050516 nmdc:mga0sz30_342_c1 nmdc:mga0sz30_342_c1_5564_6343 259
79 3300053156 Ga0500622_0086790 Ga0500622_0086790_102_881 259
80 3300005548 Ga0070665_100046838 Ga0070665_1000468383 260
81 3300006048 Ga0075363_100028661 Ga0075363_1000286614 260
82 3300006195 Ga0075366_10028711 Ga0075366_100287115 260
83 3300009148 Ga0105243_10018050 Ga0105243_100180503 260
84 3300013100 Ga0157373_10003097 Ga0157373_100030973 260
85 3300013102 Ga0157371_10000042 Ga0157371_1000004250 260
86 3300013104 Ga0157370_10000949 Ga0157370_1000094932 260
87 3300021377 Ga0213874_10038026 Ga0213874_100380262 260
88 3300021384 Ga0213876_10000108 Ga0213876_1000010817 260
89 3300025261 Ga0209233_1021129 Ga0209233_10211292 260
90 3300025925 Ga0207650_10197693 Ga0207650_101976932 260
91 3300027866 Ga0209813_10035576 Ga0209813_100355761 260
92 3300028379 Ga0268266_10019875 Ga0268266_100198754 260
93 3300028800 Ga0265338_10000002 Ga0265338_10000002493 260
94 3300039437 Ga0436365_1544656 Ga0436365_1544656_91073_91855 260
95 3300039450 Ga0436363_1022650 Ga0436363_1022650_224_1006 260
96 3300042876 Ga0451577_0440567 Ga0451577_0440567_343_1131 260
97 3300045051 Ga0451576_0014253 Ga0451576_0014253_7065_7868 260
98 3300046558 Ga0495633_0019790 Ga0495633_0019790_310_1104 260
99 3300048916 Ga0496113_0014292 Ga0496113_0014292_343_1137 260
100 3300048919 Ga0496116_0083794 Ga0496116_0083794_500_1294 260
101 3300048920 Ga0496117_0000036 Ga0496117_0000036_162415_163209 260
102 3300048921 Ga0496118_0020707 Ga0496118_0020707_3808_4602 260
103 3300048923 Ga0496120_0000036 Ga0496120_0000036_68250_69044 260
104 3300048925 Ga0496122_0000002 Ga0496122_0000002_718061_718855 260
105 3300048925 Ga0496122_0021019 Ga0496122_0021019_1814_2608 260
106 3300048926 Ga0496123_0000002 Ga0496123_0000002_1092828_1093622 260
107 3300048926 Ga0496123_0000002 Ga0496123_0000002_718061_718855 260
108 3300048927 Ga0496124_0015783 Ga0496124_0015783_6138_6932 260
109 3300050489 nmdc:mga03683_18938_c1 nmdc:mga03683_18938_c1_904_1698 260
110 3300050491 nmdc:mga00v17_19_c1 nmdc:mga00v17_19_c1_8093_8887 260
111 3300050492 nmdc:mga0yw44_109487_c1 nmdc:mga0yw44_109487_c1_645_1439 260
112 3300050494 nmdc:mga06z11_157033_c1 nmdc:mga06z11_157033_c1_437_1231 260
113 3300050516 nmdc:mga0sz30_64_c1 nmdc:mga0sz30_64_c1_15795_16589 260
114 3300053080 Ga0500635_0001853 Ga0500635_0001853_2212_2997 260
115 3300053107 Ga0500560_000014 Ga0500560_000014_20263_21057 260
116 3300053111 Ga0500572_008143 Ga0500572_008143_38_832 260
117 3300053137 Ga0500561_0000094 Ga0500561_0000094_7046_7840 260
118 3300053157 Ga0500624_000218 Ga0500624_000218_9392_10186 260
119 3300053161 Ga0500634_0012206 Ga0500634_0012206_846_1640 260
120 iso_pu_bacteria 2993693658 2993694657 260
121 3300046516 Ga0495628_0101172 Ga0495628_0101172_625_1425 261
122 3300053153 Ga0500616_0054828 Ga0500616_0054828_29_814 261
123 3300005295 Ga0065707_10131737 Ga0065707_101317373 262
124 3300006353 Ga0075370_10002962 Ga0075370_100029622 263
125 3300050496 nmdc:mga07m45_424_c2 nmdc:mga07m45_424_c2_11905_12699 263
126 iso_pu_bacteria 2902330777 2902331767 263
127 3300005546 Ga0070696_100058746 Ga0070696_1000587462 264
128 3300005547 Ga0070693_100280702 Ga0070693_1002807021 264
129 3300005578 Ga0068854_100014354 Ga0068854_1000143542 264
130 3300013100 Ga0157373_10018736 Ga0157373_100187362 264
131 3300025933 Ga0207706_10130497 Ga0207706_101304972 264
132 3300025981 Ga0207640_10115642 Ga0207640_101156422 264
133 3300005289 Ga0065704_10144112 Ga0065704_101441122 265
134 3300005548 Ga0070665_100001559 Ga0070665_1000015596 265
135 3300009545 Ga0105237_10077233 Ga0105237_100772332 265
136 3300014325 Ga0163163_10505791 Ga0163163_105057911 265
137 3300014968 Ga0157379_10165151 Ga0157379_101651512 265
138 3300028379 Ga0268266_10012466 Ga0268266_100124666 265
139 3300031730 Ga0307516_10011376 Ga0307516_1001137612 265
140 3300031731 Ga0307405_10142945 Ga0307405_101429452 265
141 3300031731 Ga0307405_10153394 Ga0307405_101533942 265
142 3300031911 Ga0307412_10163087 Ga0307412_101630872 265
143 3300032002 Ga0307416_100069720 Ga0307416_1000697204 265
144 3300032004 Ga0307414_10564232 Ga0307414_105642322 265
145 3300032126 Ga0307415_100209618 Ga0307415_1002096182 265
146 3300042876 Ga0451577_0009737 Ga0451577_0009737_2867_3664 265
147 3300044712 Ga0453684_0003435 Ga0453684_0003435_9124_9921 265
148 iso_pu_bacteria 2574179768 2574430900 265
149 3300005435 Ga0070714_100281308 Ga0070714_1002813081 266
150 3300005436 Ga0070713_100015645 Ga0070713_1000156452 266
151 3300006028 Ga0070717_10010926 Ga0070717_100109264 266
152 3300025915 Ga0207693_10000798 Ga0207693_1000079817 266
153 3300025928 Ga0207700_10277510 Ga0207700_102775102 266
154 3300025939 Ga0207665_10006227 Ga0207665_100062274 266
155 3300035410 Ga0373924_0128281 Ga0373924_0128281_41_841 266
156 3300036401 Ga0373937_0010433 Ga0373937_0010433_1984_2784 266
157 3300047472 Ga0495686_0131840 Ga0495686_0131840_230_1030 266
158 3300005336 Ga0070680_100493293 Ga0070680_1004932931 267
159 3300025917 Ga0207660_10012385 Ga0207660_100123856 267
160 3300031852 Ga0307410_10076420 Ga0307410_100764202 267
161 3300035172 Ga0373955_0037743 Ga0373955_0037743_350_1153 267
162 3300036401 Ga0373937_0076431 Ga0373937_0076431_361_1164 267
163 3300037853 Ga0436364_0025440 Ga0436364_0025440_209_1015 267
164 3300042876 Ga0451577_0003852 Ga0451577_0003852_1993_2796 267
165 3300042876 Ga0451577_0056180 Ga0451577_0056180_1503_2306 267
166 3300044712 Ga0453684_0014447 Ga0453684_0014447_639_1445 267
167 3300044712 Ga0453684_0014447 Ga0453684_0014447_8092_8898 267
168 3300046455 Ga0495603_0025487 Ga0495603_0025487_2631_3434 267
169 3300046473 Ga0495582_0060544 Ga0495582_0060544_469_1272 267
170 3300046475 Ga0495639_0009636 Ga0495639_0009636_354_1157 267
171 3300046477 Ga0495664_0028753 Ga0495664_0028753_394_1197 267
172 3300046499 Ga0495594_0027223 Ga0495594_0027223_1816_2619 267
173 3300046514 Ga0495618_0018225 Ga0495618_0018225_1148_1951 267
174 3300046517 Ga0495630_0003690 Ga0495630_0003690_455_1258 267
175 3300046526 Ga0495666_0022832 Ga0495666_0022832_1103_1906 267
176 3300046533 Ga0495640_0030101 Ga0495640_0030101_1786_2589 267
177 3300046535 Ga0495586_0012867 Ga0495586_0012867_1800_2603 267
178 3300046535 Ga0495586_0037486 Ga0495586_0037486_1171_1974 267
179 3300046642 Ga0495634_0006923 Ga0495634_0006923_933_1736 267
180 3300046681 Ga0495647_0020034 Ga0495647_0020034_1142_1945 267
181 3300046683 Ga0495658_0001905 Ga0495658_0001905_8536_9339 267
182 3300046689 Ga0495613_0004129 Ga0495613_0004129_8298_9101 267
183 3300047319 Ga0495674_0004168 Ga0495674_0004168_9136_9939 267
184 3300047321 Ga0495676_0218593 Ga0495676_0218593_13_816 267
185 iso_pu_bacteria 2510065055 2510293155 267
186 iso_pu_bacteria 2917832318 2917836224 267
187 iso_pu_bacteria 2974298342 2974301579 267
188 3300005434 Ga0070709_10187945 Ga0070709_101879452 268
189 3300025906 Ga0207699_10158442 Ga0207699_101584422 268
190 3300045051 Ga0451576_0145419 Ga0451576_0145419_970_1833 268
191 3300048089 Ga0495614_0070503 Ga0495614_0070503_60_866 268
192 3300005353 Ga0070669_100271854 Ga0070669_1002718541 269
193 3300005718 Ga0068866_10000010 Ga0068866_100000109 269
194 3300005842 Ga0068858_100054505 Ga0068858_1000545052 269
195 3300009093 Ga0105240_10001164 Ga0105240_100011648 269
196 3300009176 Ga0105242_10000033 Ga0105242_100000338 269
197 3300009553 Ga0105249_10013530 Ga0105249_100135306 269
198 3300010375 Ga0105239_10000158 Ga0105239_100001588 269
199 3300014745 Ga0157377_10004660 Ga0157377_100046602 269
200 3300025899 Ga0207642_10000039 Ga0207642_1000003931 269
201 3300025913 Ga0207695_10002020 Ga0207695_1000202012 269
202 3300025923 Ga0207681_10245574 Ga0207681_102455742 269
203 3300025934 Ga0207686_10000040 Ga0207686_1000004031 269
204 3300025961 Ga0207712_10007079 Ga0207712_100070792 269
205 3300026035 Ga0207703_10040815 Ga0207703_100408152 269
206 3300031731 Ga0307405_10137084 Ga0307405_101370842 269
207 3300031824 Ga0307413_10022210 Ga0307413_100222105 269
208 3300031852 Ga0307410_10022985 Ga0307410_100229854 269
209 3300031903 Ga0307407_10098201 Ga0307407_100982013 269
210 3300031903 Ga0307407_10267320 Ga0307407_102673202 269
211 3300031995 Ga0307409_100024363 Ga0307409_1000243635 269
212 3300032002 Ga0307416_100092410 Ga0307416_1000924102 269
213 3300042876 Ga0451577_0008230 Ga0451577_0008230_5869_6687 269
214 3300046459 Ga0495629_0232645 Ga0495629_0232645_289_1098 269
215 3300046506 Ga0495583_0000380 Ga0495583_0000380_59293_60102 269
216 3300046518 Ga0495631_0013846 Ga0495631_0013846_579_1388 269
217 3300046523 Ga0495644_0012346 Ga0495644_0012346_1531_2340 269
218 3300046681 Ga0495647_0008258 Ga0495647_0008258_1356_2165 269
219 iso_pu_bacteria 2773857672 2774130554 269
220 iso_pu_bacteria 2826581358 2826581963 269
221 iso_pu_bacteria 2842815866 2842816750 269
222 iso_pu_bacteria 2919456309 2919460314 269
223 iso_pu_bacteria 2984499530 2984504022 269
224 iso_pu_bacteria 8056137416 8056139567 269
225 3300031824 Ga0307413_10007152 Ga0307413_100071525 270
226 3300031852 Ga0307410_10016814 Ga0307410_100168142 270
227 3300031901 Ga0307406_10004380 Ga0307406_100043806 270
228 3300031911 Ga0307412_10014584 Ga0307412_100145842 270
229 3300032005 Ga0307411_10001063 Ga0307411_1000106313 270
230 3300032126 Ga0307415_100025809 Ga0307415_1000258093 270
231 3300045051 Ga0451576_0000816 Ga0451576_0000816_19452_20267 270
232 3300009176 Ga0105242_10033807 Ga0105242_100338071 271
233 3300013102 Ga0157371_10001302 Ga0157371_100013029 271
234 3300013307 Ga0157372_10509624 Ga0157372_105096242 271
235 3300025934 Ga0207686_10017041 Ga0207686_100170411 271
236 3300033180 Ga0307510_10262916 Ga0307510_102629161 271
237 3300005329 Ga0070683_100155224 Ga0070683_1001552243 272
238 3300005331 Ga0070670_100006319 Ga0070670_10000631910 272
239 3300005355 Ga0070671_100004760 Ga0070671_1000047607 272
240 3300005364 Ga0070673_100021115 Ga0070673_1000211155 272
241 3300005365 Ga0070688_100147821 Ga0070688_1001478212 272
242 3300005535 Ga0070684_100178598 Ga0070684_1001785982 272
243 3300005544 Ga0070686_100014396 Ga0070686_1000143965 272
244 3300005548 Ga0070665_100077062 Ga0070665_1000770623 272
245 3300005614 Ga0068856_100033417 Ga0068856_1000334174 272
246 3300005617 Ga0068859_100215902 Ga0068859_1002159022 272
247 3300005841 Ga0068863_100007643 Ga0068863_10000764311 272
248 3300006931 Ga0097620_100215919 Ga0097620_1002159192 272
249 3300009036 Ga0105244_10013674 Ga0105244_100136742 272
250 3300009093 Ga0105240_10118551 Ga0105240_101185513 272
251 3300009098 Ga0105245_10055605 Ga0105245_100556054 272
252 3300009101 Ga0105247_10006021 Ga0105247_100060217 272
253 3300009177 Ga0105248_10053246 Ga0105248_100532464 272
254 3300009551 Ga0105238_10086028 Ga0105238_100860283 272
255 3300010375 Ga0105239_10090933 Ga0105239_100909331 272
256 3300011119 Ga0105246_10008208 Ga0105246_100082083 272
257 3300013104 Ga0157370_10098135 Ga0157370_100981352 272
258 3300013296 Ga0157374_10004364 Ga0157374_100043649 272
259 3300013306 Ga0163162_10022470 Ga0163162_100224702 272
260 3300013308 Ga0157375_10011487 Ga0157375_100114873 272
261 3300014325 Ga0163163_10090946 Ga0163163_100909464 272
262 3300014968 Ga0157379_10015012 Ga0157379_100150121 272
263 3300014968 Ga0157379_10355921 Ga0157379_103559212 272
264 3300014969 Ga0157376_10582000 Ga0157376_105820002 272
265 3300025728 Ga0207655_1023841 Ga0207655_10238412 272
266 3300025920 Ga0207649_10039175 Ga0207649_100391753 272
267 3300025924 Ga0207694_10062970 Ga0207694_100629703 272
268 3300025925 Ga0207650_10095516 Ga0207650_100955163 272
269 3300025960 Ga0207651_10059571 Ga0207651_100595713 272
270 3300026088 Ga0207641_10111822 Ga0207641_101118223 272
271 3300026095 Ga0207676_10006866 Ga0207676_1000686610 272
272 3300028379 Ga0268266_10135770 Ga0268266_101357701 272
273 3300046452 Ga0495617_024931 Ga0495617_024931_76_894 272
274 3300046472 Ga0495580_0000333 Ga0495580_0000333_6424_7245 272
275 3300046473 Ga0495582_0000337 Ga0495582_0000337_1148_1969 272
276 3300046491 Ga0495584_0037183 Ga0495584_0037183_1455_2273 272
277 3300046499 Ga0495594_0007557 Ga0495594_0007557_710_1531 272
278 3300046499 Ga0495594_0109554 Ga0495594_0109554_482_1312 272
279 3300046501 Ga0495607_0018059 Ga0495607_0018059_3279_4097 272
280 3300046507 Ga0495606_0001383 Ga0495606_0001383_8152_8970 272
281 3300046512 Ga0495610_0001242 Ga0495610_0001242_10051_10869 272
282 3300046515 Ga0495620_0000106 Ga0495620_0000106_25132_25965 272
283 3300046520 Ga0495637_0006482 Ga0495637_0006482_615_1433 272
284 3300046522 Ga0495643_0052348 Ga0495643_0052348_534_1352 272
285 3300046524 Ga0495648_0000337 Ga0495648_0000337_13736_14554 272
286 3300046526 Ga0495666_0010440 Ga0495666_0010440_629_1450 272
287 3300046530 Ga0495654_0009304 Ga0495654_0009304_1680_2513 272
288 3300046557 Ga0495622_0071663 Ga0495622_0071663_737_1558 272
289 3300046558 Ga0495633_0038823 Ga0495633_0038823_631_1449 272
290 3300046691 Ga0495670_0000373 Ga0495670_0000373_20152_20970 272
291 3300046694 Ga0495649_0004927 Ga0495649_0004927_6997_7815 272
292 3300046810 Ga0495660_0003700 Ga0495660_0003700_6857_7675 272
293 3300047446 Ga0495679_004386 Ga0495679_004386_4975_5808 272
294 3300048905 Ga0496102_0248524 Ga0496102_0248524_215_1033 272
295 3300048906 Ga0496103_0155598 Ga0496103_0155598_327_1145 272
296 3300048907 Ga0496104_0033215 Ga0496104_0033215_2312_3130 272
297 3300048908 Ga0496105_0070751 Ga0496105_0070751_1852_2670 272
298 3300048910 Ga0496107_0077653 Ga0496107_0077653_1078_1896 272
299 3300048911 Ga0496108_0144498 Ga0496108_0144498_703_1521 272
300 3300048912 Ga0496109_0006440 Ga0496109_0006440_1530_2348 272
301 3300048915 Ga0496112_0097791 Ga0496112_0097791_1585_2403 272
302 3300048916 Ga0496113_0062315 Ga0496113_0062315_828_1646 272
303 3300048917 Ga0496114_0035388 Ga0496114_0035388_1350_2168 272
304 3300049459 Ga0495678_086461 Ga0495678_086461_218_1051 272
305 3300005288 Ga0065714_10002673 Ga0065714_100026733 273
306 3300005290 Ga0065712_10067816 Ga0065712_1006781615 273
307 3300005340 Ga0070689_100178710 Ga0070689_1001787102 273
308 3300005435 Ga0070714_100114040 Ga0070714_1001140401 273
309 3300006058 Ga0075432_10004553 Ga0075432_100045533 273
310 3300006914 Ga0075436_100061874 Ga0075436_1000618742 273
311 3300009011 Ga0105251_10009557 Ga0105251_100095572 273
312 3300009036 Ga0105244_10009826 Ga0105244_100098264 273
313 3300009092 Ga0105250_10074408 Ga0105250_100744081 273
314 3300009093 Ga0105240_10097845 Ga0105240_100978453 273
315 3300013102 Ga0157371_10019184 Ga0157371_100191846 273
316 3300013104 Ga0157370_10150210 Ga0157370_101502103 273
317 3300013105 Ga0157369_10002690 Ga0157369_100026906 273
318 3300013105 Ga0157369_10193509 Ga0157369_101935092 273
319 3300013307 Ga0157372_10447531 Ga0157372_104475311 273
320 3300015265 Ga0182005_1000869 Ga0182005_10008695 273
321 3300025728 Ga0207655_1060934 Ga0207655_10609341 273
322 3300025735 Ga0207713_1015739 Ga0207713_10157393 273
323 3300025936 Ga0207670_10135985 Ga0207670_101359852 273
324 3300027907 Ga0207428_10349684 Ga0207428_103496841 273
325 3300041405 Ga0439438_007747 Ga0439438_007747_1892_2779 273
326 3300042137 Ga0450902_001813 Ga0450902_001813_185_1006 273
327 3300042138 Ga0450903_007359 Ga0450903_007359_517_1338 273
328 3300046452 Ga0495617_015594 Ga0495617_015594_778_1599 273
329 3300046452 Ga0495617_019114 Ga0495617_019114_987_1808 273
330 3300046452 Ga0495617_042621 Ga0495617_042621_229_1050 273
331 3300046453 Ga0495627_002032 Ga0495627_002032_8825_9646 273
332 3300046458 Ga0495591_000572 Ga0495591_000572_24506_25327 273
333 3300046458 Ga0495591_004689 Ga0495591_004689_1869_2723 273
334 3300046458 Ga0495591_005240 Ga0495591_005240_4543_5364 273
335 3300046458 Ga0495591_030341 Ga0495591_030341_523_1344 273
336 3300046460 Ga0495638_0000125 Ga0495638_0000125_76908_77795 273
337 3300046460 Ga0495638_0009088 Ga0495638_0009088_2858_3679 273
338 3300046460 Ga0495638_0016539 Ga0495638_0016539_727_1548 273
339 3300046460 Ga0495638_0017589 Ga0495638_0017589_1730_2569 273
340 3300046460 Ga0495638_0055457 Ga0495638_0055457_739_1560 273
341 3300046463 Ga0495653_0000074 Ga0495653_0000074_50589_51428 273
342 3300046463 Ga0495653_0210037 Ga0495653_0210037_252_1073 273
343 3300046471 Ga0495650_0000073 Ga0495650_0000073_59708_60529 273
344 3300046471 Ga0495650_0024603 Ga0495650_0024603_748_1587 273
345 3300046471 Ga0495650_0069222 Ga0495650_0069222_354_1175 273
346 3300046474 Ga0495605_0013757 Ga0495605_0013757_3460_4281 273
347 3300046477 Ga0495664_0049277 Ga0495664_0049277_714_1535 273
348 3300046491 Ga0495584_0005520 Ga0495584_0005520_4862_5683 273
349 3300046491 Ga0495584_0013234 Ga0495584_0013234_123_1010 273
350 3300046491 Ga0495584_0016459 Ga0495584_0016459_497_1318 273
351 3300046491 Ga0495584_0035916 Ga0495584_0035916_431_1252 273
352 3300046492 Ga0495585_0003487 Ga0495585_0003487_8997_9818 273
353 3300046492 Ga0495585_0009796 Ga0495585_0009796_4748_5569 273
354 3300046492 Ga0495585_0057997 Ga0495585_0057997_376_1215 273
355 3300046492 Ga0495585_0081537 Ga0495585_0081537_496_1317 273
356 3300046500 Ga0495596_0041606 Ga0495596_0041606_562_1383 273
357 3300046500 Ga0495596_0057844 Ga0495596_0057844_325_1146 273
358 3300046501 Ga0495607_0002252 Ga0495607_0002252_1004_1825 273
359 3300046501 Ga0495607_0002425 Ga0495607_0002425_5593_6414 273
360 3300046501 Ga0495607_0007675 Ga0495607_0007675_1438_2292 273
361 3300046501 Ga0495607_0025923 Ga0495607_0025923_1139_1960 273
362 3300046506 Ga0495583_0000239 Ga0495583_0000239_78195_79016 273
363 3300046507 Ga0495606_0000047 Ga0495606_0000047_107968_108789 273
364 3300046507 Ga0495606_0000191 Ga0495606_0000191_41046_41885 273
365 3300046507 Ga0495606_0008939 Ga0495606_0008939_6196_7017 273
366 3300046507 Ga0495606_0036169 Ga0495606_0036169_795_1616 273
367 3300046512 Ga0495610_0000259 Ga0495610_0000259_43254_44075 273
368 3300046512 Ga0495610_0006257 Ga0495610_0006257_2986_3807 273
369 3300046512 Ga0495610_0011148 Ga0495610_0011148_1398_2252 273
370 3300046512 Ga0495610_0057115 Ga0495610_0057115_918_1739 273
371 3300046512 Ga0495610_0064231 Ga0495610_0064231_402_1241 273
372 3300046513 Ga0495616_0012394 Ga0495616_0012394_2318_3139 273
373 3300046513 Ga0495616_0043923 Ga0495616_0043923_503_1324 273
374 3300046515 Ga0495620_0004947 Ga0495620_0004947_2099_2920 273
375 3300046515 Ga0495620_0007542 Ga0495620_0007542_272_1093 273
376 3300046518 Ga0495631_0000005 Ga0495631_0000005_50879_51700 273
377 3300046519 Ga0495632_0002209 Ga0495632_0002209_5037_5891 273
378 3300046519 Ga0495632_0012402 Ga0495632_0012402_3206_4027 273
379 3300046519 Ga0495632_0031566 Ga0495632_0031566_381_1202 273
380 3300046519 Ga0495632_0060025 Ga0495632_0060025_895_1782 273
381 3300046519 Ga0495632_0104935 Ga0495632_0104935_293_1114 273
382 3300046520 Ga0495637_0000016 Ga0495637_0000016_210180_211001 273
383 3300046520 Ga0495637_0000209 Ga0495637_0000209_17943_18764 273
384 3300046520 Ga0495637_0002236 Ga0495637_0002236_7862_8683 273
385 3300046520 Ga0495637_0009551 Ga0495637_0009551_70_891 273
386 3300046520 Ga0495637_0020556 Ga0495637_0020556_2028_2849 273
387 3300046522 Ga0495643_0076429 Ga0495643_0076429_424_1245 273
388 3300046523 Ga0495644_0009446 Ga0495644_0009446_944_1765 273
389 3300046524 Ga0495648_0042314 Ga0495648_0042314_1998_2819 273
390 3300046524 Ga0495648_0045547 Ga0495648_0045547_559_1380 273
391 3300046530 Ga0495654_0000822 Ga0495654_0000822_1596_2450 273
392 3300046530 Ga0495654_0000853 Ga0495654_0000853_545_1366 273
393 3300046530 Ga0495654_0005005 Ga0495654_0005005_4563_5384 273
394 3300046530 Ga0495654_0006885 Ga0495654_0006885_1261_2082 273
395 3300046530 Ga0495654_0153170 Ga0495654_0153170_101_988 273
396 3300046538 Ga0495609_0000013 Ga0495609_0000013_100907_101728 273
397 3300046542 Ga0495597_0000560 Ga0495597_0000560_11584_12405 273
398 3300046542 Ga0495597_0001185 Ga0495597_0001185_14038_14859 273
399 3300046542 Ga0495597_0007465 Ga0495597_0007465_4181_5002 273
400 3300046542 Ga0495597_0009584 Ga0495597_0009584_3447_4268 273
401 3300046543 Ga0495645_0044854 Ga0495645_0044854_1301_2122 273
402 3300046557 Ga0495622_0003429 Ga0495622_0003429_2343_3164 273
403 3300046557 Ga0495622_0052369 Ga0495622_0052369_797_1618 273
404 3300046558 Ga0495633_0051281 Ga0495633_0051281_847_1668 273
405 3300046616 Ga0495668_0031108 Ga0495668_0031108_545_1366 273
406 3300046648 Ga0495611_0002227 Ga0495611_0002227_3636_4457 273
407 3300046648 Ga0495611_0006072 Ga0495611_0006072_924_1811 273
408 3300046660 Ga0495625_0001999 Ga0495625_0001999_14664_15485 273
409 3300046660 Ga0495625_0002509 Ga0495625_0002509_5852_6673 273
410 3300046665 Ga0495661_0001171 Ga0495661_0001171_13325_14179 273
411 3300046665 Ga0495661_0066894 Ga0495661_0066894_639_1460 273
412 3300046665 Ga0495661_0097121 Ga0495661_0097121_829_1650 273
413 3300046665 Ga0495661_0162756 Ga0495661_0162756_51_872 273
414 3300046674 Ga0495588_0004377 Ga0495588_0004377_4694_5515 273
415 3300046679 Ga0495623_0036485 Ga0495623_0036485_1279_2100 273
416 3300046680 Ga0495646_0109779 Ga0495646_0109779_405_1226 273
417 3300046690 Ga0495624_0070028 Ga0495624_0070028_1059_1880 273
418 3300046691 Ga0495670_0033157 Ga0495670_0033157_1135_1956 273
419 3300046692 Ga0495671_0009122 Ga0495671_0009122_519_1340 273
420 3300046692 Ga0495671_0019731 Ga0495671_0019731_2640_3527 273
421 3300046692 Ga0495671_0022381 Ga0495671_0022381_1976_2797 273
422 3300046692 Ga0495671_0044456 Ga0495671_0044456_801_1622 273
423 3300046692 Ga0495671_0095733 Ga0495671_0095733_306_1127 273
424 3300046694 Ga0495649_0000235 Ga0495649_0000235_32759_33613 273
425 3300046694 Ga0495649_0000267 Ga0495649_0000267_27731_28552 273
426 3300046694 Ga0495649_0003429 Ga0495649_0003429_4707_5528 273
427 3300046694 Ga0495649_0019939 Ga0495649_0019939_2104_2925 273
428 3300046694 Ga0495649_0025217 Ga0495649_0025217_2053_2874 273
429 3300046694 Ga0495649_0146291 Ga0495649_0146291_238_1059 273
430 3300046794 Ga0495589_0000799 Ga0495589_0000799_9227_10048 273
431 3300046794 Ga0495589_0004134 Ga0495589_0004134_10_831 273
432 3300046810 Ga0495660_0028665 Ga0495660_0028665_1767_2588 273
433 3300047320 Ga0495672_0000957 Ga0495672_0000957_3744_4631 273
434 3300047320 Ga0495672_0005734 Ga0495672_0005734_4332_5153 273
435 3300047320 Ga0495672_0012510 Ga0495672_0012510_3139_3960 273
436 3300047320 Ga0495672_0035507 Ga0495672_0035507_650_1471 273
437 3300047320 Ga0495672_0123508 Ga0495672_0123508_70_891 273
438 3300047321 Ga0495676_0000001 Ga0495676_0000001_405438_406259 273
439 3300047322 Ga0495680_0085932 Ga0495680_0085932_252_1073 273
440 3300047323 Ga0495683_0000010 Ga0495683_0000010_80472_81293 273
441 3300047323 Ga0495683_0000111 Ga0495683_0000111_13447_14268 273
442 3300047323 Ga0495683_0000300 Ga0495683_0000300_12744_13631 273
443 3300047323 Ga0495683_0000893 Ga0495683_0000893_19742_20563 273
444 3300047446 Ga0495679_001739 Ga0495679_001739_5450_6271 273
445 3300047469 Ga0495673_0000315 Ga0495673_0000315_61247_62068 273
446 3300047469 Ga0495673_0008224 Ga0495673_0008224_5011_5832 273
447 3300047469 Ga0495673_0036979 Ga0495673_0036979_865_1686 273
448 3300047469 Ga0495673_0060795 Ga0495673_0060795_481_1335 273
449 3300047470 Ga0495681_0001840 Ga0495681_0001840_13653_14474 273
450 3300047470 Ga0495681_0002167 Ga0495681_0002167_6097_6918 273
451 3300047470 Ga0495681_0014674 Ga0495681_0014674_2662_3483 273
452 3300047470 Ga0495681_0140769 Ga0495681_0140769_109_930 273
453 3300047472 Ga0495686_0102027 Ga0495686_0102027_477_1298 273
454 3300047472 Ga0495686_0109881 Ga0495686_0109881_513_1334 273
455 3300048091 Ga0495626_0000008 Ga0495626_0000008_55691_56512 273
456 3300048091 Ga0495626_0001694 Ga0495626_0001694_11540_12361 273
457 3300048091 Ga0495626_0003736 Ga0495626_0003736_5724_6563 273
458 3300048091 Ga0495626_0071605 Ga0495626_0071605_338_1159 273
459 3300048903 Ga0496100_0177282 Ga0496100_0177282_696_1517 273
460 3300048905 Ga0496102_0302989 Ga0496102_0302989_140_961 273
461 3300048906 Ga0496103_0078561 Ga0496103_0078561_595_1416 273
462 3300048907 Ga0496104_0196982 Ga0496104_0196982_780_1601 273
463 3300048908 Ga0496105_0099613 Ga0496105_0099613_1440_2261 273
464 3300048911 Ga0496108_0153930 Ga0496108_0153930_397_1218 273
465 3300048925 Ga0496122_0045887 Ga0496122_0045887_901_1722 273
466 3300048926 Ga0496123_0051409 Ga0496123_0051409_875_1696 273
467 3300048928 Ga0496125_0002700 Ga0496125_0002700_2581_3402 273
468 3300048928 Ga0496125_0072924 Ga0496125_0072924_405_1259 273
469 3300048929 Ga0496126_0022135 Ga0496126_0022135_102_923 273
470 3300048929 Ga0496126_0175697 Ga0496126_0175697_444_1265 273
471 3300049459 Ga0495678_001289 Ga0495678_001289_5030_5851 273
472 3300049459 Ga0495678_007901 Ga0495678_007901_243_1082 273
473 3300049459 Ga0495678_023832 Ga0495678_023832_513_1334 273
474 3300049459 Ga0495678_050172 Ga0495678_050172_25_846 273

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

30

226

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

36

280

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ihi-assembly1.cif.gz_D crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.9587 3 257
4i5f-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s 0.958 4 257
4cqm-assembly1.cif.gz_J crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9541 8 259
4bmn-assembly1.cif.gz_D apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.954 4 257
6ihi-assembly1.cif.gz_B crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.9536 4 257
ID Description Score Start End Superfamily
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9509 1 257 3.40.50.720
4cqmK00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9474 8 257 3.40.50.720
af_Q0JBH4_12_100_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9457 8 85 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9445 5 255 3.40.50.720
4npcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9437 5 256 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A366AS86-F1-model_v4 deleted 0.9673 5 207
AF-A0A433WQW1-F1-model_v4 Short-chain dehydrogenase 0.9606 5 235
AF-K2BKX7-F1-model_v4 Uncharacterized protein 0.9604 5 176
AF-A0A1M3A7B4-F1-model_v4 deleted 0.9602 8 257
AF-A0A1G7AYE0-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family 0.9566 1 259 GO:0016616
GO:0030497

Feature Viewer

pLDDT pTM Quality
89.7 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map