F451186

General Info

Members Datasets Scaffolds Average Seq Length
474 183 948 287

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10382063|Ga0207664_103820632
Length 336
Sequence MKPASPSYICFDADIGGHPVGLPVNCIRPGVTRVSVALDAQNSKYGEYKMDNPITFFGWFAFAILAFIVLSTILGSFFTVNTAQVAVITRFGRFLRVANPGLNWKWPFIDSVAGRISLRVNQITLTMETKTKDNVFVTIPISVQNRVRPEKAFDAFYKLSNPAEQIQAYVEQVILGHVPGMTLDEVFASQSGIAAAVKQELDADMAGFGYEIVNVLVTDIVPDAKVKSAMNDINAAQREQVAANARGLQGQGIANQRKAIIEGLQGSIEQFQKVVGGVSTSEVMQLVLVTQYFDTIKSIGENDKTNTLFLTHSPGAVKDITDEIMRSMIVADRAKA

Samples

Sample ID Description Type Environment
1 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
69 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
70 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
118 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
123 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
135 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
180 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
181 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
182 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
183 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.48
Nodule 0
Rhizoplane 1.48
Rhizosphere 96.62
Stem 0
Stem Tuber 0
Unclassified 10.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207664_10382063 3300025929 Bacteria 1250
2 Ga0070658_10060021 3300005327 Bacteria 3096
3 Ga0070683_100012263 3300005329 Bacteria 7443
4 Ga0070683_100042392 3300005329 Bacteria 4191
5 Ga0070683_100048221 3300005329 Bacteria 3938
6 Ga0070683_100501885 3300005329 Bacteria 1159
7 Ga0070683_100533457 3300005329 Unclassified 1122
8 Ga0070670_100018319 3300005331 Bacteria 6008
9 Ga0068869_100001508 3300005334 Bacteria 13802
10 Ga0070666_10016212 3300005335 Bacteria 4765
11 Ga0070666_10018763 3300005335 Bacteria 4454
12 Ga0070666_10219469 3300005335 Bacteria 1341
13 Ga0070680_100077803 3300005336 Bacteria 2732
14 Ga0068868_100014635 3300005338 Bacteria 5787
15 Ga0068868_100016643 3300005338 Bacteria 5467
16 Ga0070660_100119712 3300005339 Bacteria 2100
17 Ga0070660_100352716 3300005339 Bacteria 1212
18 Ga0070689_100071865 3300005340 Bacteria 2704
19 Ga0070661_100019063 3300005344 Bacteria 4885
20 Ga0070669_100024011 3300005353 Bacteria 4369
21 Ga0070675_100405313 3300005354 Bacteria 1217
22 Ga0070671_100022168 3300005355 Bacteria 5189
23 Ga0070671_100285032 3300005355 Bacteria 1405
24 Ga0070667_100000556 3300005367 Bacteria 37028
25 Ga0070667_100054129 3300005367 Bacteria 3388
26 Ga0070709_10072118 3300005434 Bacteria 2231
27 Ga0070714_100127356 3300005435 Unclassified 2272
28 Ga0070714_100161760 3300005435 Bacteria 2026
29 Ga0070714_100259084 3300005435 Unclassified 1610
30 Ga0070713_100016874 3300005436 Bacteria 5501
31 Ga0070713_100026125 3300005436 Bacteria 4579
32 Ga0070713_100132971 3300005436 Bacteria 2196
33 Ga0070713_100304074 3300005436 Unclassified 1469
34 Ga0070713_100420482 3300005436 Bacteria 1251
35 Ga0070710_10031671 3300005437 Bacteria 2858
36 Ga0070681_10006662 3300005458 Bacteria 11241
37 Ga0070681_10033065 3300005458 Bacteria 5191
38 Ga0070681_10074030 3300005458 Bacteria 3367
39 Ga0070681_10408909 3300005458 Bacteria 1269
40 Ga0070679_100010587 3300005530 Bacteria 8751
41 Ga0070679_100010694 3300005530 Bacteria 8710
42 Ga0070679_100143035 3300005530 Bacteria 2371
43 Ga0070679_100351710 3300005530 Bacteria 1421
44 Ga0070684_100001897 3300005535 Bacteria 15313
45 Ga0070684_100004269 3300005535 Bacteria 10837
46 Ga0070684_100081542 3300005535 Bacteria 2863
47 Ga0070684_100184984 3300005535 Unclassified 1894
48 Ga0068853_100068101 3300005539 Bacteria 3094
49 Ga0068853_100173204 3300005539 Bacteria 1953
50 Ga0068853_100208247 3300005539 Bacteria 1782
51 Ga0068853_100292446 3300005539 Unclassified 1504
52 Ga0070665_100106486 3300005548 Bacteria 2806
53 Ga0070665_100122576 3300005548 Bacteria 2601
54 Ga0070665_100248144 3300005548 Bacteria 1781
55 Ga0068855_100003889 3300005563 Bacteria 18249
56 Ga0068855_100016907 3300005563 Bacteria 8771
57 Ga0068855_100022210 3300005563 Bacteria 7604
58 Ga0068855_100048716 3300005563 Unclassified 4999
59 Ga0068855_100093821 3300005563 Bacteria 3461
60 Ga0068855_100194324 3300005563 Bacteria 2287
61 Ga0068855_100216325 3300005563 Unclassified 2151
62 Ga0070664_100140714 3300005564 Bacteria 2125
63 Ga0070664_100174298 3300005564 Bacteria 1909
64 Ga0070664_100245706 3300005564 Bacteria 1607
65 Ga0068857_100000598 3300005577 Bacteria 26483
66 Ga0068857_100004958 3300005577 Bacteria 11309
67 Ga0068857_100024919 3300005577 Bacteria 5268
68 Ga0068857_100040795 3300005577 Bacteria 4115
69 Ga0068857_100061127 3300005577 Bacteria 3347
70 Ga0068854_100163245 3300005578 Bacteria 1727
71 Ga0068856_100001937 3300005614 Bacteria 21587
72 Ga0068856_100003180 3300005614 Bacteria 16720
73 Ga0068856_100011478 3300005614 Bacteria 8600
74 Ga0068856_100022380 3300005614 Bacteria 6144
75 Ga0068856_100029284 3300005614 Bacteria 5378
76 Ga0068856_100221007 3300005614 Unclassified 1909
77 Ga0068856_100475182 3300005614 Unclassified 1271
78 Ga0068852_100000191 3300005616 Bacteria 41609
79 Ga0068852_100031800 3300005616 Bacteria 4361
80 Ga0068852_100054362 3300005616 Bacteria 3451
81 Ga0068852_100135102 3300005616 Bacteria 2277
82 Ga0068859_100021853 3300005617 Bacteria 6416
83 Ga0068859_100022232 3300005617 Bacteria 6359
84 Ga0068859_100128222 3300005617 Bacteria 2608
85 Ga0068859_100279005 3300005617 Bacteria 1763
86 Ga0068864_100015258 3300005618 Bacteria 6389
87 Ga0068861_100125793 3300005719 Bacteria 2074
88 Ga0068851_10004744 3300005834 Bacteria 6155
89 Ga0068851_10016193 3300005834 Bacteria 3564
90 Ga0068851_10044333 3300005834 Bacteria 2245
91 Ga0068863_100005720 3300005841 Bacteria 12202
92 Ga0068863_100008412 3300005841 Bacteria 10075
93 Ga0068863_100415881 3300005841 Bacteria 1317
94 Ga0068858_100003615 3300005842 Bacteria 15304
95 Ga0068858_100055934 3300005842 Bacteria 3647
96 Ga0068858_100090308 3300005842 Unclassified 2850
97 Ga0068860_100000402 3300005843 Bacteria 56413
98 Ga0068860_100132716 3300005843 Bacteria 2391
99 Ga0068862_100190454 3300005844 Bacteria 1845
100 Ga0070717_10010947 3300006028 Bacteria 6869
101 Ga0070717_10017920 3300006028 Bacteria 5522
102 Ga0097621_100013610 3300006237 Bacteria 6070
103 Ga0097621_100016800 3300006237 Bacteria 5545
104 Ga0097621_100045128 3300006237 Bacteria 3558
105 Ga0097621_100110222 3300006237 Unclassified 2325
106 Ga0097621_100287556 3300006237 Unclassified 1448
107 Ga0068871_100002517 3300006358 Bacteria 12494
108 Ga0068871_100021953 3300006358 Bacteria 4916
109 Ga0068871_100114755 3300006358 Unclassified 2270
110 Ga0068871_100266373 3300006358 Bacteria 1496
111 Ga0068871_100366918 3300006358 Bacteria 1276
112 Ga0068865_100139291 3300006881 Bacteria 1828
113 Ga0097620_100021853 3300006931 Bacteria 6416
114 Ga0097620_100022232 3300006931 Bacteria 6359
115 Ga0097620_100128223 3300006931 Bacteria 2608
116 Ga0097620_100279022 3300006931 Bacteria 1763
117 Ga0099794_10011140 3300007265 Bacteria 3843
118 Ga0099794_10054683 3300007265 Bacteria 1927
119 Ga0099794_10176987 3300007265 Unclassified 1088
120 Ga0105240_10000735 3300009093 Bacteria 59884
121 Ga0105240_10001081 3300009093 Bacteria 48105
122 Ga0105240_10001270 3300009093 Bacteria 43667
123 Ga0105240_10002000 3300009093 Bacteria 33627
124 Ga0105240_10011336 3300009093 Bacteria 12420
125 Ga0105240_10046673 3300009093 Bacteria 5488
126 Ga0105240_10055069 3300009093 Bacteria 4981
127 Ga0105240_10109967 3300009093 Unclassified 3336
128 Ga0105240_10176993 3300009093 Unclassified 2521
129 Ga0105240_10241329 3300009093 Bacteria 2095
130 Ga0105240_10256852 3300009093 Bacteria 2018
131 Ga0105245_10000204 3300009098 Bacteria 56632
132 Ga0105245_10002961 3300009098 Bacteria 15229
133 Ga0105245_10002973 3300009098 Bacteria 15195
134 Ga0105247_10007618 3300009101 Bacteria 6630
135 Ga0105247_10169838 3300009101 Bacteria 1449
136 Ga0105243_10122718 3300009148 Unclassified 2193
137 Ga0105241_10002349 3300009174 Bacteria 14213
138 Ga0105241_10003640 3300009174 Bacteria 11439
139 Ga0105241_10008966 3300009174 Bacteria 7354
140 Ga0105241_10032006 3300009174 Bacteria 3938
141 Ga0105241_10167030 3300009174 Bacteria 1814
142 Ga0105241_10349293 3300009174 Bacteria 1284
143 Ga0105241_10468162 3300009174 Bacteria 1118
144 Ga0105242_10018525 3300009176 Bacteria 5445
145 Ga0105242_10019125 3300009176 Bacteria 5365
146 Ga0105248_10080412 3300009177 Bacteria 3663
147 Ga0105248_10227728 3300009177 Bacteria 2098
148 Ga0105237_10002327 3300009545 Bacteria 23591
149 Ga0105237_10002782 3300009545 Bacteria 21249
150 Ga0105237_10173292 3300009545 Bacteria 2158
151 Ga0105237_10249418 3300009545 Unclassified 1777
152 Ga0105237_10276081 3300009545 Bacteria 1683
153 Ga0105237_10325384 3300009545 Unclassified 1541
154 Ga0105238_10000252 3300009551 Bacteria 59882
155 Ga0105238_10003709 3300009551 Bacteria 15198
156 Ga0105238_10020167 3300009551 Bacteria 6784
157 Ga0105238_10026297 3300009551 Bacteria 5931
158 Ga0105238_10040651 3300009551 Bacteria 4711
159 Ga0105249_10015405 3300009553 Bacteria 6766
160 Ga0105239_10031165 3300010375 Bacteria 5867
161 Ga0105239_10034534 3300010375 Bacteria 5554
162 Ga0105239_10057442 3300010375 Bacteria 4268
163 Ga0105239_10157719 3300010375 Bacteria 2535
164 Ga0105239_10226901 3300010375 Bacteria 2095
165 Ga0105246_10000107 3300011119 Bacteria 36702
166 Ga0105246_10347289 3300011119 Bacteria 1215
167 Ga0157370_10000003 3300013104 Bacteria 367417
168 Ga0157370_10002565 3300013104 Bacteria 21805
169 Ga0157370_10157126 3300013104 Unclassified 2116
170 Ga0157370_10201604 3300013104 Unclassified 1846
171 Ga0157369_10000767 3300013105 Bacteria 41495
172 Ga0157369_10000949 3300013105 Bacteria 36829
173 Ga0157369_10005570 3300013105 Bacteria 14620
174 Ga0157369_10008766 3300013105 Bacteria 11587
175 Ga0157369_10054530 3300013105 Bacteria 4317
176 Ga0157369_10088259 3300013105 Bacteria 3310
177 Ga0157369_10152902 3300013105 Bacteria 2439
178 Ga0157369_10204489 3300013105 Bacteria 2071
179 Ga0157369_10264497 3300013105 Unclassified 1793
180 Ga0157369_10411742 3300013105 Bacteria 1402
181 Ga0157374_10001030 3300013296 Bacteria 24197
182 Ga0157374_10003923 3300013296 Bacteria 12496
183 Ga0157374_10004841 3300013296 Bacteria 11302
184 Ga0157374_10009485 3300013296 Bacteria 8358
185 Ga0157374_10561562 3300013296 Unclassified 1149
186 Ga0157378_10021536 3300013297 Bacteria 5669
187 Ga0157378_10023578 3300013297 Bacteria 5413
188 Ga0157378_10037758 3300013297 Unclassified 4281
189 Ga0157378_10229095 3300013297 Bacteria 1770
190 Ga0157378_10752653 3300013297 Unclassified 997
191 Ga0163162_10012966 3300013306 Bacteria 8133
192 Ga0163162_10298783 3300013306 Bacteria 1742
193 Ga0163162_10317688 3300013306 Bacteria 1690
194 Ga0157372_10000489 3300013307 Bacteria 43671
195 Ga0157372_10012820 3300013307 Bacteria 8933
196 Ga0157372_10015870 3300013307 Bacteria 8079
197 Ga0157372_10023913 3300013307 Bacteria 6630
198 Ga0157372_10145696 3300013307 Bacteria 2731
199 Ga0157372_10152170 3300013307 Bacteria 2671
200 Ga0157372_10196902 3300013307 Bacteria 2334
201 Ga0157372_10203263 3300013307 Bacteria 2295
202 Ga0157375_10000409 3300013308 Bacteria 38902
203 Ga0157375_10012415 3300013308 Bacteria 7557
204 Ga0157375_10175045 3300013308 Bacteria 2295
205 Ga0163163_10004490 3300014325 Bacteria 11908
206 Ga0163163_10007705 3300014325 Bacteria 9513
207 Ga0163163_10015772 3300014325 Bacteria 6997
208 Ga0157380_10380588 3300014326 Bacteria 1332
209 Ga0157379_10000269 3300014968 Bacteria 40897
210 Ga0157379_10020148 3300014968 Bacteria 5894
211 Ga0157379_10169447 3300014968 Bacteria 1971
212 Ga0157376_10000577 3300014969 Bacteria 23677
213 Ga0157376_10012104 3300014969 Bacteria 6389
214 Ga0157376_10111265 3300014969 Bacteria 2411
215 Ga0157376_10346293 3300014969 Bacteria 1421
216 Ga0213872_10001404 3300021361 Bacteria 15849
217 Ga0224572_1014196 3300024225 Unclassified 1522
218 Ga0228598_1003034 3300024227 Bacteria 3639
219 Ga0228598_1010621 3300024227 Unclassified 1833
220 Ga0228598_1021108 3300024227 Bacteria 1282
221 Ga0209233_1023721 3300025261 Bacteria 1549
222 Ga0207656_10001922 3300025321 Bacteria 6910
223 Ga0207656_10041536 3300025321 Bacteria 1954
224 Ga0207656_10081844 3300025321 Bacteria 1452
225 Ga0207710_10000329 3300025900 Bacteria 35896
226 Ga0207710_10106006 3300025900 Bacteria 1330
227 Ga0207680_10242136 3300025903 Bacteria 1243
228 Ga0207699_10041676 3300025906 Unclassified 2653
229 Ga0207705_10028107 3300025909 Bacteria 4010
230 Ga0207705_10175861 3300025909 Bacteria 1613
231 Ga0207654_10000074 3300025911 Bacteria 66092
232 Ga0207654_10000138 3300025911 Bacteria 46993
233 Ga0207654_10005452 3300025911 Bacteria 6434
234 Ga0207654_10038348 3300025911 Bacteria 2688
235 Ga0207654_10050848 3300025911 Bacteria 2383
236 Ga0207654_10219042 3300025911 Bacteria 1262
237 Ga0207707_10015059 3300025912 Bacteria 6733
238 Ga0207707_10040102 3300025912 Bacteria 4091
239 Ga0207695_10001003 3300025913 Bacteria 49974
240 Ga0207695_10004201 3300025913 Bacteria 19786
241 Ga0207695_10006735 3300025913 Bacteria 14829
242 Ga0207695_10016429 3300025913 Bacteria 8660
243 Ga0207695_10019493 3300025913 Bacteria 7811
244 Ga0207695_10032048 3300025913 Bacteria 5756
245 Ga0207695_10036016 3300025913 Bacteria 5355
246 Ga0207695_10079360 3300025913 Bacteria 3327
247 Ga0207695_10119753 3300025913 Bacteria 2602
248 Ga0207695_10138188 3300025913 Bacteria 2388
249 Ga0207671_10000047 3300025914 Bacteria 196307
250 Ga0207671_10000238 3300025914 Bacteria 82806
251 Ga0207671_10000830 3300025914 Bacteria 39238
252 Ga0207671_10010678 3300025914 Bacteria 7555
253 Ga0207671_10217372 3300025914 Unclassified 1496
254 Ga0207663_10027299 3300025916 Bacteria 3325
255 Ga0207657_10005999 3300025919 Bacteria 12641
256 Ga0207657_10056191 3300025919 Bacteria 3397
257 Ga0207657_10199974 3300025919 Unclassified 1608
258 Ga0207649_10012017 3300025920 Bacteria 4789
259 Ga0207649_10153042 3300025920 Bacteria 1591
260 Ga0207652_10015355 3300025921 Bacteria 6219
261 Ga0207652_10248062 3300025921 Unclassified 1605
262 Ga0207652_10302736 3300025921 Bacteria 1443
263 Ga0207652_10316209 3300025921 Bacteria 1409
264 Ga0207681_10042648 3300025923 Bacteria 3032
265 Ga0207694_10004468 3300025924 Bacteria 10914
266 Ga0207694_10004538 3300025924 Bacteria 10828
267 Ga0207694_10025486 3300025924 Bacteria 4495
268 Ga0207694_10071915 3300025924 Unclassified 2703
269 Ga0207694_10173559 3300025924 Bacteria 1746
270 Ga0207694_10269516 3300025924 Unclassified 1396
271 Ga0207694_10322794 3300025924 Bacteria 1274
272 Ga0207650_10011151 3300025925 Bacteria 6182
273 Ga0207659_10093569 3300025926 Bacteria 2250
274 Ga0207687_10003588 3300025927 Bacteria 10448
275 Ga0207687_10006724 3300025927 Bacteria 7583
276 Ga0207687_10010709 3300025927 Bacteria 5989
277 Ga0207687_10043965 3300025927 Bacteria 3080
278 Ga0207687_10161158 3300025927 Bacteria 1722
279 Ga0207700_10085657 3300025928 Bacteria 2474
280 Ga0207700_10204782 3300025928 Bacteria 1665
281 Ga0207664_10472162 3300025929 Unclassified 1121
282 Ga0207644_10027960 3300025931 Bacteria 3899
283 Ga0207644_10252105 3300025931 Bacteria 1408
284 Ga0207706_10026672 3300025933 Bacteria 5171
285 Ga0207686_10010197 3300025934 Bacteria 5109
286 Ga0207686_10010771 3300025934 Bacteria 4983
287 Ga0207686_10041267 3300025934 Bacteria 2812
288 Ga0207709_10296074 3300025935 Bacteria 1201
289 Ga0207704_10076239 3300025938 Bacteria 2148
290 Ga0207711_10025547 3300025941 Bacteria 4954
291 Ga0207711_10102131 3300025941 Bacteria 2538
292 Ga0207711_10202042 3300025941 Unclassified 1814
293 Ga0207711_10440975 3300025941 Bacteria 1212
294 Ga0207689_10000163 3300025942 Bacteria 57617
295 Ga0207661_10003682 3300025944 Bacteria 10681
296 Ga0207661_10212088 3300025944 Bacteria 1707
297 Ga0207661_10494163 3300025944 Unclassified 1118
298 Ga0207679_10039878 3300025945 Bacteria 3357
299 Ga0207679_10146501 3300025945 Unclassified 1916
300 Ga0207679_10168215 3300025945 Bacteria 1802
301 Ga0207667_10000188 3300025949 Bacteria 90598
302 Ga0207667_10005700 3300025949 Bacteria 15186
303 Ga0207667_10011164 3300025949 Bacteria 10454
304 Ga0207667_10034044 3300025949 Bacteria 5473
305 Ga0207667_10055584 3300025949 Bacteria 4161
306 Ga0207667_10057134 3300025949 Unclassified 4097
307 Ga0207667_10095225 3300025949 Bacteria 3074
308 Ga0207667_10104642 3300025949 Bacteria 2919
309 Ga0207640_10133183 3300025981 Bacteria 1800
310 Ga0207658_10000076 3300025986 Bacteria 108585
311 Ga0207677_10000368 3300026023 Bacteria 31429
312 Ga0207677_10019962 3300026023 Bacteria 4058
313 Ga0207703_10020992 3300026035 Bacteria 5111
314 Ga0207703_10155063 3300026035 Bacteria 2000
315 Ga0207703_10521926 3300026035 Bacteria 1117
316 Ga0207639_10156543 3300026041 Bacteria 1915
317 Ga0207639_10160044 3300026041 Bacteria 1896
318 Ga0207639_10265530 3300026041 Bacteria 1503
319 Ga0207702_10000782 3300026078 Bacteria 33667
320 Ga0207702_10017671 3300026078 Bacteria 5901
321 Ga0207702_10024829 3300026078 Bacteria 4972
322 Ga0207702_10035341 3300026078 Bacteria 4178
323 Ga0207702_10061347 3300026078 Bacteria 3207
324 Ga0207702_10302439 3300026078 Bacteria 1518
325 Ga0207641_10000457 3300026088 Bacteria 46657
326 Ga0207641_10008637 3300026088 Bacteria 8411
327 Ga0207648_10012595 3300026089 Bacteria 7913
328 Ga0207648_10143601 3300026089 Unclassified 2105
329 Ga0207676_10001228 3300026095 Bacteria 19102
330 Ga0207676_10048247 3300026095 Bacteria 3305
331 Ga0207674_10002326 3300026116 Bacteria 24058
332 Ga0207674_10009009 3300026116 Bacteria 11464
333 Ga0207674_10056486 3300026116 Bacteria 3986
334 Ga0207674_10069476 3300026116 Bacteria 3543
335 Ga0207674_10100608 3300026116 Unclassified 2872
336 Ga0207674_10161576 3300026116 Bacteria 2194
337 Ga0207698_10000406 3300026142 Bacteria 24878
338 Ga0207698_10034123 3300026142 Bacteria 3706
339 Ga0207698_10256976 3300026142 Bacteria 1602
340 Ga0209588_1031938 3300027671 Bacteria 1686
341 Ga0265354_1000133 3300028016 Bacteria 13245
342 Ga0265354_1001128 3300028016 Bacteria 4081
343 Ga0268266_10042121 3300028379 Bacteria 3898
344 Ga0268266_10086114 3300028379 Bacteria 2746
345 Ga0268265_10168649 3300028380 Bacteria 1868
346 Ga0268264_10000795 3300028381 Bacteria 34167
347 Ga0268264_10020104 3300028381 Bacteria 5455
348 Ga0265318_10045691 3300028577 Bacteria 1655
349 Ga0265336_10014394 3300028666 Bacteria 2622
350 Ga0265336_10024845 3300028666 Bacteria 1889
351 Ga0265338_10006065 3300028800 Bacteria 15521
352 Ga0265338_10019972 3300028800 Bacteria 7072
353 Ga0265338_10022299 3300028800 Bacteria 6561
354 Ga0265338_10036742 3300028800 Bacteria 4681
355 Ga0265338_10062870 3300028800 Bacteria 3241
356 Ga0265338_10065688 3300028800 Bacteria 3145
357 Ga0265338_10115831 3300028800 Bacteria 2148
358 Ga0265338_10168751 3300028800 Unclassified 1681
359 Ga0265770_1000129 3300030878 Bacteria 9181
360 Ga0265760_10002190 3300031090 Bacteria 5710
361 Ga0265760_10007073 3300031090 Unclassified 3212
362 Ga0265760_10015555 3300031090 Bacteria 2181
363 Ga0265330_10002789 3300031235 Bacteria 9373
364 Ga0265328_10000015 3300031239 Bacteria 150629
365 Ga0265328_10000062 3300031239 Bacteria 61951
366 Ga0265328_10000164 3300031239 Bacteria 30575
367 Ga0265328_10058311 3300031239 Bacteria 1418
368 Ga0265328_10081241 3300031239 Bacteria 1194
369 Ga0265325_10004724 3300031241 Bacteria 8535
370 Ga0265325_10016593 3300031241 Unclassified 4114
371 Ga0265325_10077724 3300031241 Bacteria 1654
372 Ga0265325_10116080 3300031241 Unclassified 1295
373 Ga0265329_10001920 3300031242 Bacteria 9795
374 Ga0265329_10016586 3300031242 Bacteria 2549
375 Ga0265340_10000748 3300031247 Bacteria 18463
376 Ga0265340_10044445 3300031247 Bacteria 2173
377 Ga0265340_10050356 3300031247 Bacteria 2021
378 Ga0265339_10000026 3300031249 Bacteria 165764
379 Ga0265339_10000075 3300031249 Bacteria 85133
380 Ga0265339_10001488 3300031249 Bacteria 17299
381 Ga0265339_10073735 3300031249 Bacteria 1814
382 Ga0265331_10000420 3300031250 Bacteria 42997
383 Ga0265331_10002092 3300031250 Bacteria 13775
384 Ga0265331_10002152 3300031250 Bacteria 13542
385 Ga0265331_10004674 3300031250 Bacteria 8480
386 Ga0265331_10085697 3300031250 Bacteria 1460
387 Ga0265327_10000135 3300031251 Bacteria 162683
388 Ga0265327_10000161 3300031251 Bacteria 144768
389 Ga0265327_10000251 3300031251 Bacteria 106698
390 Ga0265327_10001429 3300031251 Bacteria 30326
391 Ga0265327_10001565 3300031251 Bacteria 28072
392 Ga0265327_10031830 3300031251 Bacteria 2959
393 Ga0265316_10000262 3300031344 Bacteria 60181
394 Ga0265316_10004038 3300031344 Bacteria 14695
395 Ga0265316_10013582 3300031344 Bacteria 7226
396 Ga0265316_10034989 3300031344 Bacteria 4077
397 Ga0265316_10036523 3300031344 Bacteria 3972
398 Ga0265316_10090840 3300031344 Bacteria 2330
399 Ga0265316_10225038 3300031344 Unclassified 1383
400 Ga0265313_10000508 3300031595 Bacteria 40898
401 Ga0265313_10000540 3300031595 Bacteria 39475
402 Ga0265313_10032477 3300031595 Bacteria 2665
403 Ga0265314_10004182 3300031711 Bacteria 13557
404 Ga0265314_10006775 3300031711 Bacteria 10050
405 Ga0265314_10080384 3300031711 Bacteria 2152
406 Ga0265342_10001406 3300031712 Bacteria 22482
407 Ga0265342_10002597 3300031712 Bacteria 15465
408 Ga0265342_10019929 3300031712 Bacteria 4314
409 Ga0265342_10082654 3300031712 Bacteria 1853
410 Ga0316212_1003540 3300033547 Unclassified 2254
411 Ga0373957_0103038 3300035120 Bacteria 1144
412 Ga0373937_0157253 3300036401 Bacteria 2131
413 Ga0395900_0175118 3300037418 Bacteria 2182
414 Ga0395905_0099846 3300037471 Bacteria 2726
415 Ga0436364_0488122 3300037853 Bacteria 2179
416 Ga0395901_0015100 3300038443 Bacteria 7854
417 Ga0395901_0437567 3300038443 Bacteria 1339
418 Ga0436360_0192532 3300039438 Bacteria 1203
419 Ga0436361_0125301 3300039447 Bacteria 1175
420 Ga0436361_1056164 3300039447 Bacteria 31731
421 Ga0439448_0063472 3300042005 Bacteria 1223
422 Ga0466963_0004935 3300044694 Bacteria 7780
423 Ga0466958_0056063 3300045836 Bacteria 2393
424 Ga0466967_0020138 3300045976 Bacteria 5383
425 Ga0495629_0000013 3300046459 Bacteria 212317
426 Ga0495629_0028581 3300046459 Bacteria 3958
427 Ga0495629_0367803 3300046459 Bacteria 979
428 Ga0495580_0055927 3300046472 Bacteria 2779
429 Ga0495580_0133884 3300046472 Bacteria 1718
430 Ga0495582_0001601 3300046473 Bacteria 12772
431 Ga0495639_0003687 3300046475 Bacteria 6593
432 Ga0495664_0281562 3300046477 Unclassified 1005
433 Ga0495594_0005630 3300046499 Bacteria 6440
434 Ga0495594_0120159 3300046499 Unclassified 1485
435 Ga0495628_0070289 3300046516 Bacteria 2729
436 Ga0495665_0188593 3300046531 Bacteria 1070
437 Ga0495586_0047160 3300046535 Bacteria 2325
438 Ga0495586_0143729 3300046535 Bacteria 1340
439 Ga0495645_0247644 3300046543 Bacteria 1186
440 Ga0495634_0038311 3300046642 Bacteria 3269
441 Ga0495635_0000710 3300046663 Bacteria 21459
442 Ga0495623_0090993 3300046679 Bacteria 1873
443 Ga0495647_0018612 3300046681 Bacteria 2475
444 Ga0495658_0001266 3300046683 Bacteria 13286
445 Ga0495658_0033293 3300046683 Bacteria 2821
446 Ga0495613_0002565 3300046689 Bacteria 13674
447 Ga0495613_0011884 3300046689 Bacteria 6471
448 Ga0495613_0028131 3300046689 Bacteria 4182
449 Ga0495613_0245366 3300046689 Bacteria 1251
450 Ga0495600_0011541 3300046809 Bacteria 5509
451 Ga0495581_0000323 3300047315 Bacteria 23616
452 Ga0495604_0001460 3300047317 Bacteria 19428
453 Ga0495604_0249773 3300047317 Unclassified 1210
454 Ga0495680_0001669 3300047322 Bacteria 23602
455 Ga0495680_0131483 3300047322 Bacteria 1839
456 Ga0495675_0164165 3300047444 Unclassified 1367
457 Ga0495684_0352729 3300047471 Bacteria 1044
458 Ga0495614_0005054 3300048089 Bacteria 5953
459 Ga0496101_0042397 3300048904 Bacteria 3248
460 Ga0496105_0007514 3300048908 Bacteria 8443
461 Ga0496106_0025188 3300048909 Bacteria 4426
462 Ga0496107_0043428 3300048910 Bacteria 3229
463 Ga0496109_0156498 3300048912 Bacteria 2135
464 Ga0496112_0278364 3300048915 Bacteria 1621
465 Ga0496114_0002637 3300048917 Bacteria 13682
466 Ga0495595_0019507 3300053084 Bacteria 2942
467 Ga0495619_0000898 3300053085 Bacteria 19484
468 Ga0495619_0080295 3300053085 Bacteria 2195
469 Ga0500572_000396 3300053111 Bacteria 15358
470 Ga0500652_000092 3300053131 Bacteria 37694
471 Ga0500652_134268 3300053131 Bacteria 1032
472 Ga0500559_0000023 3300053136 Bacteria 127993
473 Ga0500616_0062399 3300053153 Bacteria 1926
474 Ga0500601_001555 3300053737 Bacteria 2489
475 Ga0207664_10382063
476 Ga0070658_10060021
477 Ga0070683_100012263
478 Ga0070683_100042392
479 Ga0070683_100048221
480 Ga0070683_100501885
481 Ga0070683_100533457
482 Ga0070670_100018319
483 Ga0068869_100001508
484 Ga0070666_10016212
485 Ga0070666_10018763
486 Ga0070666_10219469
487 Ga0070680_100077803
488 Ga0068868_100014635
489 Ga0068868_100016643
490 Ga0070660_100119712
491 Ga0070660_100352716
492 Ga0070689_100071865
493 Ga0070661_100019063
494 Ga0070669_100024011
495 Ga0070675_100405313
496 Ga0070671_100022168
497 Ga0070671_100285032
498 Ga0070667_100000556
499 Ga0070667_100054129
500 Ga0070709_10072118
501 Ga0070714_100127356
502 Ga0070714_100161760
503 Ga0070714_100259084
504 Ga0070713_100016874
505 Ga0070713_100026125
506 Ga0070713_100132971
507 Ga0070713_100304074
508 Ga0070713_100420482
509 Ga0070710_10031671
510 Ga0070681_10006662
511 Ga0070681_10033065
512 Ga0070681_10074030
513 Ga0070681_10408909
514 Ga0070679_100010587
515 Ga0070679_100010694
516 Ga0070679_100143035
517 Ga0070679_100351710
518 Ga0070684_100001897
519 Ga0070684_100004269
520 Ga0070684_100081542
521 Ga0070684_100184984
522 Ga0068853_100068101
523 Ga0068853_100173204
524 Ga0068853_100208247
525 Ga0068853_100292446
526 Ga0070665_100106486
527 Ga0070665_100122576
528 Ga0070665_100248144
529 Ga0068855_100003889
530 Ga0068855_100016907
531 Ga0068855_100022210
532 Ga0068855_100048716
533 Ga0068855_100093821
534 Ga0068855_100194324
535 Ga0068855_100216325
536 Ga0070664_100140714
537 Ga0070664_100174298
538 Ga0070664_100245706
539 Ga0068857_100000598
540 Ga0068857_100004958
541 Ga0068857_100024919
542 Ga0068857_100040795
543 Ga0068857_100061127
544 Ga0068854_100163245
545 Ga0068856_100001937
546 Ga0068856_100003180
547 Ga0068856_100011478
548 Ga0068856_100022380
549 Ga0068856_100029284
550 Ga0068856_100221007
551 Ga0068856_100475182
552 Ga0068852_100000191
553 Ga0068852_100031800
554 Ga0068852_100054362
555 Ga0068852_100135102
556 Ga0068859_100021853
557 Ga0068859_100022232
558 Ga0068859_100128222
559 Ga0068859_100279005
560 Ga0068864_100015258
561 Ga0068861_100125793
562 Ga0068851_10004744
563 Ga0068851_10016193
564 Ga0068851_10044333
565 Ga0068863_100005720
566 Ga0068863_100008412
567 Ga0068863_100415881
568 Ga0068858_100003615
569 Ga0068858_100055934
570 Ga0068858_100090308
571 Ga0068860_100000402
572 Ga0068860_100132716
573 Ga0068862_100190454
574 Ga0070717_10010947
575 Ga0070717_10017920
576 Ga0097621_100013610
577 Ga0097621_100016800
578 Ga0097621_100045128
579 Ga0097621_100110222
580 Ga0097621_100287556
581 Ga0068871_100002517
582 Ga0068871_100021953
583 Ga0068871_100114755
584 Ga0068871_100266373
585 Ga0068871_100366918
586 Ga0068865_100139291
587 Ga0097620_100021853
588 Ga0097620_100022232
589 Ga0097620_100128223
590 Ga0097620_100279022
591 Ga0099794_10011140
592 Ga0099794_10054683
593 Ga0099794_10176987
594 Ga0105240_10000735
595 Ga0105240_10001081
596 Ga0105240_10001270
597 Ga0105240_10002000
598 Ga0105240_10011336
599 Ga0105240_10046673
600 Ga0105240_10055069
601 Ga0105240_10109967
602 Ga0105240_10176993
603 Ga0105240_10241329
604 Ga0105240_10256852
605 Ga0105245_10000204
606 Ga0105245_10002961
607 Ga0105245_10002973
608 Ga0105247_10007618
609 Ga0105247_10169838
610 Ga0105243_10122718
611 Ga0105241_10002349
612 Ga0105241_10003640
613 Ga0105241_10008966
614 Ga0105241_10032006
615 Ga0105241_10167030
616 Ga0105241_10349293
617 Ga0105241_10468162
618 Ga0105242_10018525
619 Ga0105242_10019125
620 Ga0105248_10080412
621 Ga0105248_10227728
622 Ga0105237_10002327
623 Ga0105237_10002782
624 Ga0105237_10173292
625 Ga0105237_10249418
626 Ga0105237_10276081
627 Ga0105237_10325384
628 Ga0105238_10000252
629 Ga0105238_10003709
630 Ga0105238_10020167
631 Ga0105238_10026297
632 Ga0105238_10040651
633 Ga0105249_10015405
634 Ga0105239_10031165
635 Ga0105239_10034534
636 Ga0105239_10057442
637 Ga0105239_10157719
638 Ga0105239_10226901
639 Ga0105246_10000107
640 Ga0105246_10347289
641 Ga0157370_10000003
642 Ga0157370_10002565
643 Ga0157370_10157126
644 Ga0157370_10201604
645 Ga0157369_10000767
646 Ga0157369_10000949
647 Ga0157369_10005570
648 Ga0157369_10008766
649 Ga0157369_10054530
650 Ga0157369_10088259
651 Ga0157369_10152902
652 Ga0157369_10204489
653 Ga0157369_10264497
654 Ga0157369_10411742
655 Ga0157374_10001030
656 Ga0157374_10003923
657 Ga0157374_10004841
658 Ga0157374_10009485
659 Ga0157374_10561562
660 Ga0157378_10021536
661 Ga0157378_10023578
662 Ga0157378_10037758
663 Ga0157378_10229095
664 Ga0157378_10752653
665 Ga0163162_10012966
666 Ga0163162_10298783
667 Ga0163162_10317688
668 Ga0157372_10000489
669 Ga0157372_10012820
670 Ga0157372_10015870
671 Ga0157372_10023913
672 Ga0157372_10145696
673 Ga0157372_10152170
674 Ga0157372_10196902
675 Ga0157372_10203263
676 Ga0157375_10000409
677 Ga0157375_10012415
678 Ga0157375_10175045
679 Ga0163163_10004490
680 Ga0163163_10007705
681 Ga0163163_10015772
682 Ga0157380_10380588
683 Ga0157379_10000269
684 Ga0157379_10020148
685 Ga0157379_10169447
686 Ga0157376_10000577
687 Ga0157376_10012104
688 Ga0157376_10111265
689 Ga0157376_10346293
690 Ga0213872_10001404
691 Ga0224572_1014196
692 Ga0228598_1003034
693 Ga0228598_1010621
694 Ga0228598_1021108
695 Ga0209233_1023721
696 Ga0207656_10001922
697 Ga0207656_10041536
698 Ga0207656_10081844
699 Ga0207710_10000329
700 Ga0207710_10106006
701 Ga0207680_10242136
702 Ga0207699_10041676
703 Ga0207705_10028107
704 Ga0207705_10175861
705 Ga0207654_10000074
706 Ga0207654_10000138
707 Ga0207654_10005452
708 Ga0207654_10038348
709 Ga0207654_10050848
710 Ga0207654_10219042
711 Ga0207707_10015059
712 Ga0207707_10040102
713 Ga0207695_10001003
714 Ga0207695_10004201
715 Ga0207695_10006735
716 Ga0207695_10016429
717 Ga0207695_10019493
718 Ga0207695_10032048
719 Ga0207695_10036016
720 Ga0207695_10079360
721 Ga0207695_10119753
722 Ga0207695_10138188
723 Ga0207671_10000047
724 Ga0207671_10000238
725 Ga0207671_10000830
726 Ga0207671_10010678
727 Ga0207671_10217372
728 Ga0207663_10027299
729 Ga0207657_10005999
730 Ga0207657_10056191
731 Ga0207657_10199974
732 Ga0207649_10012017
733 Ga0207649_10153042
734 Ga0207652_10015355
735 Ga0207652_10248062
736 Ga0207652_10302736
737 Ga0207652_10316209
738 Ga0207681_10042648
739 Ga0207694_10004468
740 Ga0207694_10004538
741 Ga0207694_10025486
742 Ga0207694_10071915
743 Ga0207694_10173559
744 Ga0207694_10269516
745 Ga0207694_10322794
746 Ga0207650_10011151
747 Ga0207659_10093569
748 Ga0207687_10003588
749 Ga0207687_10006724
750 Ga0207687_10010709
751 Ga0207687_10043965
752 Ga0207687_10161158
753 Ga0207700_10085657
754 Ga0207700_10204782
755 Ga0207664_10472162
756 Ga0207644_10027960
757 Ga0207644_10252105
758 Ga0207706_10026672
759 Ga0207686_10010197
760 Ga0207686_10010771
761 Ga0207686_10041267
762 Ga0207709_10296074
763 Ga0207704_10076239
764 Ga0207711_10025547
765 Ga0207711_10102131
766 Ga0207711_10202042
767 Ga0207711_10440975
768 Ga0207689_10000163
769 Ga0207661_10003682
770 Ga0207661_10212088
771 Ga0207661_10494163
772 Ga0207679_10039878
773 Ga0207679_10146501
774 Ga0207679_10168215
775 Ga0207667_10000188
776 Ga0207667_10005700
777 Ga0207667_10011164
778 Ga0207667_10034044
779 Ga0207667_10055584
780 Ga0207667_10057134
781 Ga0207667_10095225
782 Ga0207667_10104642
783 Ga0207640_10133183
784 Ga0207658_10000076
785 Ga0207677_10000368
786 Ga0207677_10019962
787 Ga0207703_10020992
788 Ga0207703_10155063
789 Ga0207703_10521926
790 Ga0207639_10156543
791 Ga0207639_10160044
792 Ga0207639_10265530
793 Ga0207702_10000782
794 Ga0207702_10017671
795 Ga0207702_10024829
796 Ga0207702_10035341
797 Ga0207702_10061347
798 Ga0207702_10302439
799 Ga0207641_10000457
800 Ga0207641_10008637
801 Ga0207648_10012595
802 Ga0207648_10143601
803 Ga0207676_10001228
804 Ga0207676_10048247
805 Ga0207674_10002326
806 Ga0207674_10009009
807 Ga0207674_10056486
808 Ga0207674_10069476
809 Ga0207674_10100608
810 Ga0207674_10161576
811 Ga0207698_10000406
812 Ga0207698_10034123
813 Ga0207698_10256976
814 Ga0209588_1031938
815 Ga0265354_1000133
816 Ga0265354_1001128
817 Ga0268266_10042121
818 Ga0268266_10086114
819 Ga0268265_10168649
820 Ga0268264_10000795
821 Ga0268264_10020104
822 Ga0265318_10045691
823 Ga0265336_10014394
824 Ga0265336_10024845
825 Ga0265338_10006065
826 Ga0265338_10019972
827 Ga0265338_10022299
828 Ga0265338_10036742
829 Ga0265338_10062870
830 Ga0265338_10065688
831 Ga0265338_10115831
832 Ga0265338_10168751
833 Ga0265770_1000129
834 Ga0265760_10002190
835 Ga0265760_10007073
836 Ga0265760_10015555
837 Ga0265330_10002789
838 Ga0265328_10000015
839 Ga0265328_10000062
840 Ga0265328_10000164
841 Ga0265328_10058311
842 Ga0265328_10081241
843 Ga0265325_10004724
844 Ga0265325_10016593
845 Ga0265325_10077724
846 Ga0265325_10116080
847 Ga0265329_10001920
848 Ga0265329_10016586
849 Ga0265340_10000748
850 Ga0265340_10044445
851 Ga0265340_10050356
852 Ga0265339_10000026
853 Ga0265339_10000075
854 Ga0265339_10001488
855 Ga0265339_10073735
856 Ga0265331_10000420
857 Ga0265331_10002092
858 Ga0265331_10002152
859 Ga0265331_10004674
860 Ga0265331_10085697
861 Ga0265327_10000135
862 Ga0265327_10000161
863 Ga0265327_10000251
864 Ga0265327_10001429
865 Ga0265327_10001565
866 Ga0265327_10031830
867 Ga0265316_10000262
868 Ga0265316_10004038
869 Ga0265316_10013582
870 Ga0265316_10034989
871 Ga0265316_10036523
872 Ga0265316_10090840
873 Ga0265316_10225038
874 Ga0265313_10000508
875 Ga0265313_10000540
876 Ga0265313_10032477
877 Ga0265314_10004182
878 Ga0265314_10006775
879 Ga0265314_10080384
880 Ga0265342_10001406
881 Ga0265342_10002597
882 Ga0265342_10019929
883 Ga0265342_10082654
884 Ga0316212_1003540
885 Ga0373957_0103038
886 Ga0373937_0157253
887 Ga0395900_0175118
888 Ga0395905_0099846
889 Ga0436364_0488122
890 Ga0395901_0015100
891 Ga0395901_0437567
892 Ga0436360_0192532
893 Ga0436361_0125301
894 Ga0436361_1056164
895 Ga0439448_0063472
896 Ga0466963_0004935
897 Ga0466958_0056063
898 Ga0466967_0020138
899 Ga0495629_0000013
900 Ga0495629_0028581
901 Ga0495629_0367803
902 Ga0495580_0055927
903 Ga0495580_0133884
904 Ga0495582_0001601
905 Ga0495639_0003687
906 Ga0495664_0281562
907 Ga0495594_0005630
908 Ga0495594_0120159
909 Ga0495628_0070289
910 Ga0495665_0188593
911 Ga0495586_0047160
912 Ga0495586_0143729
913 Ga0495645_0247644
914 Ga0495634_0038311
915 Ga0495635_0000710
916 Ga0495623_0090993
917 Ga0495647_0018612
918 Ga0495658_0001266
919 Ga0495658_0033293
920 Ga0495613_0002565
921 Ga0495613_0011884
922 Ga0495613_0028131
923 Ga0495613_0245366
924 Ga0495600_0011541
925 Ga0495581_0000323
926 Ga0495604_0001460
927 Ga0495604_0249773
928 Ga0495680_0001669
929 Ga0495680_0131483
930 Ga0495675_0164165
931 Ga0495684_0352729
932 Ga0495614_0005054
933 Ga0496101_0042397
934 Ga0496105_0007514
935 Ga0496106_0025188
936 Ga0496107_0043428
937 Ga0496109_0156498
938 Ga0496112_0278364
939 Ga0496114_0002637
940 Ga0495595_0019507
941 Ga0495619_0000898
942 Ga0495619_0080295
943 Ga0500572_000396
944 Ga0500652_000092
945 Ga0500652_134268
946 Ga0500559_0000023
947 Ga0500616_0062399
948 Ga0500601_001555

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01145

Band_7

SPFH domain / Band 7 family

78

251

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fvj-assembly2.cif.gz_B spfh domain of the mouse stomatin (crystal form 2) 0.8836 60 171
4fvj-assembly2.cif.gz_B spfh domain of the mouse stomatin (crystal form 2) 0.8553 60 171
2rpb-assembly1.cif.gz_A the solution structure of membrane protein 0.8408 63 171
7wh3-assembly1.cif.gz_A solution structure of human stomatin spfh domain in a phosphate buffer 0.8098 60 168
2rpb-assembly1.cif.gz_A the solution structure of membrane protein 0.8005 63 171
ID Description Score Start End Superfamily
af_Q6K550_45_154_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9938 61 170 3.30.479.30
af_Q6K550_45_154_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9849 61 170 3.30.479.30
af_Q4CPV3_34_164_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9536 58 181 3.30.479.30
af_A0A1D6ME97_88_221_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9477 58 182 3.30.479.30
af_A4HYE7_32_163_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9472 54 180 3.30.479.30
ID Description Score Start End GO Terms
AF-A0A846LG18-F1-model_v4 deleted 0.9778 23 157
AF-A0A2X3UNQ9-F1-model_v4 Spfh domain/band 7 family protein 0.9764 86 166
AF-A0A7J6QKN0-F1-model_v4 HIR complex subunit 0.958 24 150
AF-A0A7S2G8N9-F1-model_v4 Band 7 domain-containing protein 0.9465 30 152
AF-A0A846LG18-F1-model_v4 deleted 0.9435 23 157

Map