F451170

General Info

Members Datasets Scaffolds Average Seq Length
474 295 466 395

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10047267|Ga0105238_100472672
Length 465
Sequence MQKANRSDHNFSLGQSVAHPYLSREPFCGGAAMESHMTEIAQAARSTTSPAELSPVMASPMITWRTPVVIILCGCLIALLGFGPRSAFGFFLTPMSQANGWGRDVFALAFALQNLLWGVGQPFAGAIADRFGMVRVLSVGALLYAAGLALMAYTTSPVALQVTAGVLVGFGLSGCSFNLVIAAFGKLLSERYRMLAIGAGTAAGSFGQFLFAPFGVALIDNVGWQHALLVFGSLLLLIVPLSLALATQPNAPGASAAGKPQSQSLTSALGEAFGHRSYVLLVFGFFTCGFQLAFITLHLPSYLIDRGLSAQVGGWTLATIGLFNIIGSISVSWLANYFPRRYLLATNYFLRAVFIAAFVLLPASTVTTLLFGAGMGLLWLSTVPPTSSLVSLMFGTRWLATLYGFAFFSHQVGGFLGAWMGGVLYERTGSYDIVWWLAVFFGIVSALINLPIEEKPVLRAAPAAA

Samples

Sample ID Description Type Environment
1 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
2 2842694124 Methylopila sp. R-72369 Isolate Unclassified
3 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
4 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
121 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
122 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
123 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
137 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
138 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
139 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
142 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
143 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
144 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
148 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
158 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
159 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
160 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
161 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
172 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
173 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
185 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
186 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
187 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
190 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
191 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
232 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
233 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
259 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
260 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
261 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
262 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
263 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
264 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
267 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
268 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
275 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
277 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
278 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
279 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
280 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
281 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
282 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
283 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
284 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
285 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
286 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
287 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
288 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
289 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
290 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
291 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
292 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
293 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
294 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.13
Nodule 0
Rhizoplane 8.02
Rhizosphere 79.32
Stem 0
Stem Tuber 0
Unclassified 2.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10018656 3300005328 Bacteria 3847
2 Ga0070683_100113215 3300005329 Bacteria 2561
3 Ga0070683_100220661 3300005329 Bacteria 1802
4 Ga0070690_100060123 3300005330 Bacteria 2445
5 Ga0070670_100026175 3300005331 Bacteria 5021
6 Ga0070677_10019441 3300005333 Bacteria 2460
7 Ga0068869_100044587 3300005334 Bacteria 3189
8 Ga0070680_100002488 3300005336 Bacteria 13650
9 Ga0070682_100005035 3300005337 Bacteria 7343
10 Ga0070689_100032546 3300005340 Bacteria 3967
11 Ga0070689_100080150 3300005340 Bacteria 2562
12 Ga0070661_100017848 3300005344 Bacteria 5037
13 Ga0070674_100005859 3300005356 Bacteria 7146
14 Ga0070674_100013176 3300005356 Bacteria 5103
15 Ga0070673_100045005 3300005364 Bacteria 3420
16 Ga0070659_100033378 3300005366 Bacteria 3997
17 Ga0070709_10033335 3300005434 Bacteria 3113
18 Ga0070710_10037970 3300005437 Bacteria 2643
19 Ga0070705_100049044 3300005440 Bacteria 2450
20 Ga0070700_100050754 3300005441 Bacteria 2579
21 Ga0070708_100021231 3300005445 Bacteria 5487
22 Ga0070678_100002106 3300005456 Bacteria 10790
23 Ga0070678_100020597 3300005456 Bacteria 4329
24 Ga0070662_100080164 3300005457 Bacteria 2430
25 Ga0070662_100186559 3300005457 Bacteria 1637
26 Ga0070681_10006157 3300005458 Bacteria 11654
27 Ga0068867_100069212 3300005459 Bacteria 2636
28 Ga0070706_100185773 3300005467 Bacteria 1942
29 Ga0070698_100192918 3300005471 Bacteria 1974
30 Ga0070699_100017015 3300005518 Bacteria 6243
31 Ga0070679_100002767 3300005530 Bacteria 15943
32 Ga0070697_100067756 3300005536 Bacteria 2920
33 Ga0068853_100009417 3300005539 Bacteria 7870
34 Ga0070672_100026162 3300005543 Bacteria 4337
35 Ga0070686_100016768 3300005544 Bacteria 4266
36 Ga0070704_100011561 3300005549 Bacteria 5416
37 Ga0068857_100142366 3300005577 Bacteria 2168
38 Ga0068856_100202241 3300005614 Bacteria 2001
39 Ga0068859_100044150 3300005617 Bacteria 4479
40 Ga0068866_10050562 3300005718 Bacteria 2111
41 Ga0068870_10048111 3300005840 Bacteria 2244
42 Ga0068858_100043124 3300005842 Bacteria 4183
43 Ga0068860_100149758 3300005843 Bacteria 2246
44 Ga0081455_10002467 3300005937 Bacteria 22008
45 Ga0081455_10007391 3300005937 Bacteria 11574
46 Ga0081455_10021494 3300005937 Bacteria 6053
47 Ga0081455_10071708 3300005937 Bacteria 2870
48 Ga0081538_10001155 3300005981 Bacteria 27898
49 Ga0081538_10015356 3300005981 Bacteria 5934
50 Ga0081538_10036177 3300005981 Bacteria 3227
51 Ga0081540_1004578 3300005983 Bacteria 10474
52 Ga0081539_10000932 3300005985 Bacteria 54871
53 Ga0070717_10001777 3300006028 Bacteria 15035
54 Ga0075365_10068207 3300006038 Bacteria 2389
55 Ga0075363_100010413 3300006048 Bacteria 4416
56 Ga0075363_100012213 3300006048 Bacteria 4134
57 Ga0075364_10010988 3300006051 Bacteria 5490
58 Ga0075364_10035768 3300006051 Bacteria 3210
59 Ga0075364_10074864 3300006051 Bacteria 2233
60 Ga0075432_10003155 3300006058 Bacteria 5565
61 Ga0070715_10005663 3300006163 Bacteria 4186
62 Ga0070716_100008517 3300006173 Bacteria 5091
63 Ga0075362_10005054 3300006177 Bacteria 4792
64 Ga0075369_10074319 3300006186 Bacteria 1499
65 Ga0075366_10017974 3300006195 Bacteria 4079
66 Ga0075366_10030814 3300006195 Bacteria 3154
67 Ga0097621_100044616 3300006237 Bacteria 3577
68 Ga0075370_10015759 3300006353 Bacteria 4054
69 Ga0075370_10033294 3300006353 Bacteria 2885
70 Ga0075370_10069489 3300006353 Bacteria 2013
71 Ga0075428_100001293 3300006844 Bacteria 26605
72 Ga0075428_100004262 3300006844 Bacteria 15739
73 Ga0075428_100025459 3300006844 Bacteria 6549
74 Ga0075430_100001054 3300006846 Bacteria 21797
75 Ga0075431_100000262 3300006847 Bacteria 40447
76 Ga0075431_100345946 3300006847 Bacteria 1496
77 Ga0075433_10003469 3300006852 Bacteria 12175
78 Ga0075433_10006064 3300006852 Bacteria 9525
79 Ga0075434_100004788 3300006871 Bacteria 12258
80 Ga0075434_100024511 3300006871 Bacteria 5897
81 Ga0075434_100194384 3300006871 Bacteria 2049
82 Ga0075429_100000098 3300006880 Bacteria 47888
83 Ga0075429_100004109 3300006880 Bacteria 12455
84 Ga0075429_100018168 3300006880 Bacteria 6085
85 Ga0097620_100044148 3300006931 Bacteria 4479
86 Ga0075435_100053357 3300007076 Bacteria 3260
87 Ga0075435_100075144 3300007076 Bacteria 2766
88 Ga0075435_100075609 3300007076 Bacteria 2759
89 Ga0099794_10010846 3300007265 Bacteria 3882
90 Ga0111539_10000148 3300009094 Bacteria 79887
91 Ga0111539_10001671 3300009094 Bacteria 29561
92 Ga0111539_10004453 3300009094 Bacteria 18309
93 Ga0111539_10089802 3300009094 Bacteria 3611
94 Ga0105245_10023851 3300009098 Bacteria 5370
95 Ga0105245_10072920 3300009098 Bacteria 3120
96 Ga0114129_10000142 3300009147 Bacteria 75322
97 Ga0114129_10105531 3300009147 Bacteria 3893
98 Ga0114129_10322147 3300009147 Bacteria 2054
99 Ga0105241_10037172 3300009174 Bacteria 3667
100 Ga0105242_10083255 3300009176 Bacteria 2679
101 Ga0105242_10110340 3300009176 Bacteria 2343
102 Ga0105242_10235982 3300009176 Bacteria 1641
103 Ga0105237_10062593 3300009545 Bacteria 3720
104 Ga0105238_10047267 3300009551 Bacteria 4341
105 Ga0105249_10001468 3300009553 Bacteria 20685
106 Ga0105249_10150903 3300009553 Bacteria 2237
107 Ga0105246_10083633 3300011119 Bacteria 2281
108 Ga0157370_10021860 3300013104 Bacteria 6372
109 Ga0157374_10172830 3300013296 Bacteria 2108
110 Ga0157378_10023666 3300013297 Bacteria 5402
111 Ga0157372_10007314 3300013307 Bacteria 11753
112 Ga0157376_10032384 3300014969 Bacteria 4197
113 Ga0157376_10171564 3300014969 Bacteria 1976
114 Ga0209564_1000503 3300025295 Bacteria 64437
115 Ga0209564_1010724 3300025295 Bacteria 4182
116 Ga0209758_1000997 3300025297 Bacteria 37703
117 Ga0207682_10004647 3300025893 Bacteria 5706
118 Ga0207710_10006576 3300025900 Bacteria 4957
119 Ga0207688_10057967 3300025901 Bacteria 2178
120 Ga0207685_10001959 3300025905 Bacteria 4560
121 Ga0207643_10067053 3300025908 Bacteria 2059
122 Ga0207684_10029116 3300025910 Bacteria 4704
123 Ga0207707_10026061 3300025912 Bacteria 5112
124 Ga0207693_10026982 3300025915 Bacteria 4543
125 Ga0207663_10110214 3300025916 Bacteria 1867
126 Ga0207657_10029530 3300025919 Bacteria 4989
127 Ga0207652_10005736 3300025921 Bacteria 10075
128 Ga0207659_10148441 3300025926 Bacteria 1828
129 Ga0207687_10064134 3300025927 Bacteria 2604
130 Ga0207700_10000953 3300025928 Bacteria 16664
131 Ga0207700_10241939 3300025928 Bacteria 1538
132 Ga0207690_10043090 3300025932 Bacteria 2968
133 Ga0207686_10109615 3300025934 Bacteria 1859
134 Ga0207670_10024364 3300025936 Bacteria 3781
135 Ga0207669_10007724 3300025937 Bacteria 5003
136 Ga0207669_10017807 3300025937 Bacteria 3655
137 Ga0207669_10102904 3300025937 Bacteria 1893
138 Ga0207665_10002924 3300025939 Bacteria 11440
139 Ga0207665_10060869 3300025939 Bacteria 2558
140 Ga0207691_10008976 3300025940 Bacteria 9590
141 Ga0207691_10255008 3300025940 Bacteria 1513
142 Ga0207711_10055218 3300025941 Bacteria 3410
143 Ga0207711_10121557 3300025941 Bacteria 2332
144 Ga0207689_10028371 3300025942 Bacteria 4683
145 Ga0207661_10021285 3300025944 Bacteria 4858
146 Ga0207661_10111521 3300025944 Bacteria 2314
147 Ga0207712_10001257 3300025961 Bacteria 17520
148 Ga0207712_10139094 3300025961 Bacteria 1861
149 Ga0207703_10058166 3300026035 Bacteria 3154
150 Ga0207639_10027143 3300026041 Bacteria 4167
151 Ga0207678_10033053 3300026067 Bacteria 4508
152 Ga0207678_10088596 3300026067 Bacteria 2645
153 Ga0207678_10093036 3300026067 Bacteria 2576
154 Ga0207708_10030427 3300026075 Bacteria 4093
155 Ga0207708_10165681 3300026075 Bacteria 1747
156 Ga0207648_10093578 3300026089 Bacteria 2628
157 Ga0207648_10138210 3300026089 Bacteria 2147
158 Ga0207674_10021321 3300026116 Bacteria 6981
159 Ga0207674_10104320 3300026116 Bacteria 2813
160 Ga0207675_100225571 3300026118 Bacteria 1806
161 Ga0207683_10004551 3300026121 Bacteria 11950
162 Ga0207683_10004853 3300026121 Bacteria 11578
163 Ga0209588_1007543 3300027671 Bacteria 3203
164 Ga0207428_10000137 3300027907 Bacteria 98535
165 Ga0207428_10001096 3300027907 Bacteria 29476
166 Ga0207428_10004444 3300027907 Bacteria 13326
167 Ga0268266_10074758 3300028379 Bacteria 2942
168 Ga0268265_10091652 3300028380 Bacteria 2431
169 Ga0265318_10017411 3300028577 Bacteria 2950
170 Ga0307511_10000103 3300030521 Bacteria 75234
171 Ga0265330_10072670 3300031235 Bacteria 1487
172 Ga0265332_10021100 3300031238 Bacteria 2878
173 Ga0265320_10011326 3300031240 Bacteria 5252
174 Ga0265325_10000264 3300031241 Bacteria 37210
175 Ga0265325_10009459 3300031241 Bacteria 5687
176 Ga0265325_10046419 3300031241 Bacteria 2253
177 Ga0265325_10049928 3300031241 Bacteria 2156
178 Ga0265340_10011739 3300031247 Bacteria 4648
179 Ga0265313_10000326 3300031595 Bacteria 51836
180 Ga0265313_10019078 3300031595 Bacteria 3832
181 Ga0265314_10021297 3300031711 Bacteria 4989
182 Ga0265342_10012718 3300031712 Bacteria 5689
183 Ga0265342_10058739 3300031712 Bacteria 2273
184 Ga0307410_10012224 3300031852 Bacteria 4953
185 Ga0307407_10079851 3300031903 Unclassified 1975
186 Ga0307409_100127575 3300031995 Unclassified 2167
187 Ga0307409_100242541 3300031995 Bacteria 1642
188 Ga0307415_100135389 3300032126 Unclassified 1873
189 Ga0307415_100255441 3300032126 Bacteria 1427
190 Ga0373926_0000678 3300035083 Bacteria 9360
191 Ga0373934_0023003 3300035086 Bacteria 2407
192 Ga0373934_0028494 3300035086 Bacteria 2177
193 Ga0373940_0009757 3300035088 Bacteria 2240
194 Ga0373944_0004415 3300035089 Bacteria 3661
195 Ga0373944_0005168 3300035089 Bacteria 3430
196 Ga0373949_0006178 3300035090 Bacteria 2647
197 Ga0373923_0006334 3300035111 Bacteria 4083
198 Ga0373923_0023560 3300035111 Bacteria 2423
199 Ga0373936_0013209 3300035113 Bacteria 3150
200 Ga0373936_0016791 3300035113 Bacteria 2817
201 Ga0373939_0002506 3300035114 Bacteria 4327
202 Ga0373954_0013043 3300035118 Bacteria 3699
203 Ga0373956_0016910 3300035119 Bacteria 3067
204 Ga0373956_0091029 3300035119 Bacteria 1407
205 Ga0373957_0034882 3300035120 Bacteria 1866
206 Ga0373943_0030787 3300035170 Bacteria 2542
207 Ga0373943_0115179 3300035170 Bacteria 1423
208 Ga0373955_0142739 3300035172 Bacteria 1405
209 Ga0373942_0034676 3300035207 Bacteria 1351
210 Ga0373924_0089890 3300035410 Bacteria 1313
211 Ga0373931_0001808 3300035691 Bacteria 9310
212 Ga0373931_0005943 3300035691 Bacteria 5676
213 Ga0373931_0019608 3300035691 Bacteria 3378
214 Ga0373935_0005030 3300035692 Bacteria 7784
215 Ga0373927_0006141 3300035695 Bacteria 8216
216 Ga0373927_0038738 3300035695 Bacteria 3094
217 Ga0373927_0124037 3300035695 Bacteria 1686
218 Ga0373947_0012549 3300035725 Bacteria 4859
219 Ga0373947_0077932 3300035725 Bacteria 2045
220 Ga0373937_0000886 3300036401 Bacteria 25663
221 Ga0373937_0007052 3300036401 Bacteria 9702
222 Ga0373937_0131593 3300036401 Bacteria 2336
223 Ga0373925_0020390 3300037068 Bacteria 4825
224 Ga0373925_0028016 3300037068 Bacteria 4126
225 Ga0436364_0937429 3300037853 Bacteria 3211
226 Ga0436365_0787487 3300039437 Bacteria 3965
227 Ga0436365_0985041 3300039437 Bacteria 4865
228 Ga0436363_0546384 3300039450 Bacteria 2705
229 Ga0451791_0854514 3300041451 Bacteria 2785
230 Ga0439443_001382 3300042003 Bacteria 2649
231 Ga0439459_0016036 3300042438 Bacteria 1380
232 Ga0439460_0008533 3300042461 Bacteria 2590
233 Ga0466966_0002836 3300044684 Bacteria 11409
234 Ga0466968_0039713 3300044735 Bacteria 1982
235 Ga0466957_0084928 3300044842 Bacteria 1976
236 Ga0466960_0008973 3300044901 Bacteria 4111
237 Ga0451576_0060431 3300045051 Bacteria 3954
238 Ga0495617_005058 3300046452 Bacteria 4726
239 Ga0495592_0019734 3300046454 Bacteria 5127
240 Ga0495603_0001962 3300046455 Bacteria 12136
241 Ga0495603_0033791 3300046455 Bacteria 3076
242 Ga0495603_0113837 3300046455 Bacteria 1577
243 Ga0495629_0000900 3300046459 Bacteria 23863
244 Ga0495629_0006873 3300046459 Bacteria 8396
245 Ga0495641_0007778 3300046461 Bacteria 6637
246 Ga0495641_0016404 3300046461 Bacteria 3904
247 Ga0495651_0006630 3300046462 Bacteria 8844
248 Ga0495653_0024639 3300046463 Bacteria 4844
249 Ga0495580_0048650 3300046472 Bacteria 3001
250 Ga0495582_0003483 3300046473 Bacteria 8863
251 Ga0495582_0019557 3300046473 Bacteria 3703
252 Ga0495582_0040453 3300046473 Bacteria 2567
253 Ga0495639_0010420 3300046475 Bacteria 4004
254 Ga0495662_0020655 3300046476 Bacteria 3185
255 Ga0495664_0110787 3300046477 Bacteria 1657
256 Ga0495584_0012631 3300046491 Bacteria 4311
257 Ga0495585_0002877 3300046492 Bacteria 11971
258 Ga0495594_0003494 3300046499 Bacteria 8101
259 Ga0495594_0016497 3300046499 Bacteria 3891
260 Ga0495594_0174578 3300046499 Bacteria 1223
261 Ga0495607_0026237 3300046501 Bacteria 3617
262 Ga0495628_0008997 3300046516 Bacteria 8545
263 Ga0495628_0171316 3300046516 Bacteria 1646
264 Ga0495644_0001026 3300046523 Bacteria 11635
265 Ga0495644_0074319 3300046523 Bacteria 1278
266 Ga0495663_0008690 3300046525 Bacteria 2817
267 Ga0495666_0004367 3300046526 Bacteria 7139
268 Ga0495642_0105349 3300046528 Bacteria 1203
269 Ga0495640_0017590 3300046533 Bacteria 5322
270 Ga0495640_0032861 3300046533 Bacteria 3692
271 Ga0495640_0057146 3300046533 Bacteria 2663
272 Ga0495640_0165592 3300046533 Bacteria 1414
273 Ga0495598_0014386 3300046537 Bacteria 1978
274 Ga0495621_0003751 3300046539 Bacteria 4211
275 Ga0495622_0001456 3300046557 Bacteria 11922
276 Ga0495633_0017789 3300046558 Bacteria 3623
277 Ga0495633_0029983 3300046558 Bacteria 2644
278 Ga0495667_0023398 3300046559 Bacteria 4162
279 Ga0495656_0001889 3300046615 Bacteria 6904
280 Ga0495656_0002563 3300046615 Bacteria 6055
281 Ga0495656_0065109 3300046615 Bacteria 1602
282 Ga0495634_0010838 3300046642 Bacteria 6665
283 Ga0495611_0008388 3300046648 Bacteria 4376
284 Ga0495588_0007943 3300046674 Bacteria 4850
285 Ga0495599_0034546 3300046678 Bacteria 3176
286 Ga0495599_0039055 3300046678 Bacteria 2982
287 Ga0495647_0010604 3300046681 Bacteria 3140
288 Ga0495658_0001428 3300046683 Bacteria 12563
289 Ga0495658_0007167 3300046683 Bacteria 5508
290 Ga0495658_0022108 3300046683 Bacteria 3360
291 Ga0495669_0003460 3300046684 Bacteria 6508
292 Ga0495613_0006101 3300046689 Bacteria 9015
293 Ga0495613_0064542 3300046689 Bacteria 2677
294 Ga0495613_0123256 3300046689 Bacteria 1860
295 Ga0495624_0018366 3300046690 Bacteria 4676
296 Ga0495649_0053411 3300046694 Bacteria 2187
297 Ga0495600_0008743 3300046809 Bacteria 6231
298 Ga0495581_0012004 3300047315 Bacteria 5011
299 Ga0495581_0022194 3300047315 Bacteria 3678
300 Ga0495581_0064810 3300047315 Bacteria 2111
301 Ga0495604_0010004 3300047317 Bacteria 7508
302 Ga0495604_0169649 3300047317 Bacteria 1536
303 Ga0495672_0069631 3300047320 Bacteria 1997
304 Ga0495676_0040704 3300047321 Bacteria 3832
305 Ga0495676_0068347 3300047321 Bacteria 2745
306 Ga0495680_0012055 3300047322 Bacteria 7628
307 Ga0495680_0018600 3300047322 Bacteria 5891
308 Ga0495685_009663 3300047447 Bacteria 3228
309 Ga0495684_0023656 3300047471 Bacteria 4724
310 Ga0495684_0116464 3300047471 Bacteria 2014
311 Ga0495593_0001262 3300047673 Bacteria 14851
312 Ga0495602_0160447 3300048088 Bacteria 1756
313 Ga0496100_0020939 3300048903 Bacteria 3930
314 Ga0496100_0288491 3300048903 Bacteria 1225
315 Ga0496101_0018061 3300048904 Bacteria 4790
316 Ga0496101_0111853 3300048904 Bacteria 2056
317 Ga0496101_0312886 3300048904 Bacteria 1231
318 Ga0496102_0050732 3300048905 Bacteria 3779
319 Ga0496103_0008938 3300048906 Bacteria 5940
320 Ga0496104_0054430 3300048907 Bacteria 3782
321 Ga0496104_0107105 3300048907 Bacteria 2679
322 Ga0496104_0205545 3300048907 Bacteria 1881
323 Ga0496104_0287289 3300048907 Bacteria 1557
324 Ga0496105_0080947 3300048908 Bacteria 2682
325 Ga0496105_0084652 3300048908 Bacteria 2619
326 Ga0496106_0084684 3300048909 Bacteria 2439
327 Ga0496107_0002421 3300048910 Bacteria 12088
328 Ga0496108_0004510 3300048911 Bacteria 11214
329 Ga0496108_0027188 3300048911 Bacteria 4721
330 Ga0496108_0038043 3300048911 Bacteria 4008
331 Ga0496109_0004202 3300048912 Bacteria 12009
332 Ga0496109_0009259 3300048912 Bacteria 8389
333 Ga0496109_0032556 3300048912 Bacteria 4686
334 Ga0496110_0001998 3300048913 Bacteria 15178
335 Ga0496110_0007372 3300048913 Bacteria 8779
336 Ga0496110_0051118 3300048913 Bacteria 3631
337 Ga0496110_0146801 3300048913 Bacteria 2134
338 Ga0496110_0168546 3300048913 Bacteria 1986
339 Ga0496111_0000832 3300048914 Bacteria 16629
340 Ga0496111_0018071 3300048914 Bacteria 4878
341 Ga0496111_0032928 3300048914 Bacteria 3696
342 Ga0496111_0172724 3300048914 Bacteria 1606
343 Ga0496111_0181557 3300048914 Bacteria 1564
344 Ga0496112_0004919 3300048915 Bacteria 11433
345 Ga0496112_0073108 3300048915 Bacteria 3389
346 Ga0496113_0096960 3300048916 Bacteria 2280
347 Ga0496114_0334705 3300048917 Bacteria 1338
348 Ga0496115_0103811 3300048918 Bacteria 2332
349 Ga0496116_0001614 3300048919 Bacteria 24796
350 Ga0496120_0005359 3300048923 Bacteria 10263
351 Ga0496125_0005590 3300048928 Bacteria 13889
352 Ga0496126_0015074 3300048929 Bacteria 7792
353 Ga0501031_0006759 3300049568 Bacteria 7481
354 Ga0501033_0194968 3300049570 Bacteria 1448
355 Ga0501034_0000229 3300049571 Bacteria 105030
356 Ga0501034_0128148 3300049571 Bacteria 2522
357 Ga0501034_0346575 3300049571 Bacteria 1414
358 Ga0501036_0043625 3300049572 Bacteria 3798
359 Ga0501036_0117614 3300049572 Bacteria 2245
360 Ga0501036_0160034 3300049572 Bacteria 1898
361 Ga0501037_0017425 3300049573 Bacteria 5287
362 Ga0501037_0226230 3300049573 Bacteria 1314
363 Ga0501038_0161649 3300049574 Bacteria 1819
364 Ga0501039_0039819 3300049575 Bacteria 3629
365 Ga0501039_0145503 3300049575 Bacteria 1862
366 Ga0501046_0131490 3300049580 Bacteria 1898
367 Ga0501047_0020124 3300049581 Bacteria 6407
368 Ga0501047_0348665 3300049581 Bacteria 1317
369 Ga0501048_0062336 3300049582 Bacteria 2639
370 Ga0501068_0017026 3300049584 Bacteria 4200
371 Ga0501068_0185977 3300049584 Bacteria 1314
372 Ga0501070_0032213 3300049586 Bacteria 4387
373 Ga0501070_0240337 3300049586 Bacteria 1482
374 Ga0501070_0291316 3300049586 Bacteria 1330
375 Ga0501071_0050830 3300049587 Bacteria 2986
376 Ga0501071_0101752 3300049587 Bacteria 2118
377 Ga0501072_0002326 3300049588 Bacteria 14257
378 Ga0501072_0011295 3300049588 Bacteria 6821
379 Ga0501073_0011823 3300049589 Bacteria 6372
380 Ga0501073_0071729 3300049589 Bacteria 2412
381 Ga0501074_0042835 3300049590 Bacteria 3275
382 Ga0501074_0127014 3300049590 Bacteria 1824
383 Ga0501076_0051409 3300049592 Bacteria 3262
384 Ga0501077_0068243 3300049593 Bacteria 2254
385 Ga0501077_0146306 3300049593 Bacteria 1499
386 Ga0501079_0271584 3300049741 Bacteria 1325
387 Ga0501080_0043438 3300049742 Bacteria 4185
388 Ga0501080_0210772 3300049742 Bacteria 1780
389 Ga0501081_0114271 3300049743 Bacteria 1918
390 Ga0501035_0017088 3300049822 Bacteria 6684
391 Ga0501035_0066636 3300049822 Bacteria 3195
392 Ga0501035_0223166 3300049822 Bacteria 1608
393 Ga0501044_0163289 3300049823 Bacteria 2202
394 Ga0501044_0360773 3300049823 Bacteria 1371
395 nmdc:mga03683_99577_c1 3300050489 Bacteria 1276
396 nmdc:mga03n38_8107_c1 3300050490 Bacteria 3751
397 nmdc:mga00v17_23989_c1 3300050491 Bacteria 3534
398 nmdc:mga00v17_6125_c1 3300050491 Bacteria 6371
399 nmdc:mga00v17_72972_c1 3300050491 Bacteria 2130
400 nmdc:mga0yw44_47510_c1 3300050492 Bacteria 2584
401 nmdc:mga0yw44_56784_c1 3300050492 Bacteria 2387
402 nmdc:mga0k408_100615_c1 3300050493 Bacteria 1704
403 nmdc:mga0k408_10711_c1 3300050493 Bacteria 4968
404 nmdc:mga0k408_110527_c1 3300050493 Bacteria 1624
405 nmdc:mga0k408_3273_c1 3300050493 Bacteria 8571
406 nmdc:mga0k408_51980_c1 3300050493 Bacteria 2374
407 nmdc:mga04h51_39202_c1 3300050495 Bacteria 1538
408 nmdc:mga07m45_131202_c1 3300050496 Bacteria 1450
409 nmdc:mga07m45_4847_c1 3300050496 Bacteria 6619
410 nmdc:mga07m45_52370_c1 3300050496 Bacteria 2304
411 nmdc:mga05p37_222915_c1 3300050507 Bacteria 2275
412 nmdc:mga05p37_265445_c1 3300050507 Bacteria 2053
413 nmdc:mga05p37_66_c1 3300050507 Bacteria 91764
414 nmdc:mga05p37_859_c1 3300050507 Bacteria 34182
415 nmdc:mga09592_15300_c1 3300050508 Bacteria 6267
416 nmdc:mga09592_4987_c1 3300050508 Bacteria 10759
417 nmdc:mga09592_556_c1 3300050508 Bacteria 28326
418 nmdc:mga0qj67_1385_c1 3300050509 Bacteria 16986
419 nmdc:mga0qj67_50730_c1 3300050509 Bacteria 3281
420 nmdc:mga06r32_2037_c1 3300050510 Bacteria 18072
421 nmdc:mga06r32_524_c1 3300050510 Bacteria 33071
422 nmdc:mga08y16_111063_c1 3300050511 Bacteria 2854
423 nmdc:mga08y16_28470_c1 3300050511 Bacteria 5891
424 nmdc:mga08y16_368_c1 3300050511 Bacteria 40832
425 nmdc:mga08y16_88083_c1 3300050511 Bacteria 3235
426 nmdc:mga08y16_8946_c1 3300050511 Bacteria 10516
427 nmdc:mga0n895_109885_c1 3300050512 Bacteria 2772
428 nmdc:mga0n895_14277_c1 3300050512 Bacteria 7207
429 nmdc:mga0n895_329134_c1 3300050512 Bacteria 1548
430 nmdc:mga0n895_43_c1 3300050512 Bacteria 74924
431 nmdc:mga0n895_5157_c1 3300050512 Bacteria 10867
432 nmdc:mga0rr50_141071_c1 3300050513 Bacteria 1939
433 nmdc:mga0rr50_21716_c1 3300050513 Bacteria 4389
434 nmdc:mga0a205_8987_c1 3300050515 Bacteria 8560
435 nmdc:mga0a205_945_c1 3300050515 Bacteria 23974
436 Ga0495601_0047455 3300053077 Bacteria 2704
437 Ga0495601_0165256 3300053077 Bacteria 1446
438 Ga0495612_0004100 3300053078 Bacteria 6040
439 Ga0495595_0002267 3300053084 Bacteria 7489
440 Ga0495619_0000337 3300053085 Bacteria 32903
441 Ga0495619_0002410 3300053085 Bacteria 12281
442 Ga0495619_0099139 3300053085 Bacteria 1981
443 Ga0500646_0000496 3300053090 Bacteria 11528
444 Ga0500583_0006707 3300053092 Bacteria 3986
445 Ga0500566_0000453 3300053094 Bacteria 22761
446 Ga0500566_0110923 3300053094 Bacteria 1491
447 Ga0500641_0011339 3300053096 Bacteria 3234
448 Ga0500595_003436 3300053119 Bacteria 7393
449 Ga0500618_003981 3300053125 Bacteria 4878
450 Ga0500642_0000013 3300053130 Bacteria 197927
451 Ga0500655_001554 3300053133 Bacteria 4349
452 Ga0500559_0000743 3300053136 Bacteria 21395
453 Ga0500577_0014889 3300053142 Bacteria 2417
454 Ga0500586_000728 3300053145 Bacteria 6755
455 Ga0500604_0000391 3300053151 Bacteria 12033
456 Ga0500616_0025450 3300053153 Bacteria 3283
457 Ga0500636_0006602 3300053177 Bacteria 6666
458 Ga0500636_0014393 3300053177 Bacteria 4653
459 Ga0501084_0039004 3300054114 Bacteria 3973
460 Ga0501084_0058288 3300054114 Bacteria 3231
461 Ga0590074_009543 3300059423 Bacteria 1616
462 Ga0590075_001383 3300059424 Bacteria 6082
463 Ga0590077_000809 3300059426 Bacteria 8076
464 Ga0501082_0001777 3300060353 Bacteria 18962
465 Ga0501082_0075316 3300060353 Bacteria 2908
466 Ga0501082_0198806 3300060353 Bacteria 1744

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025937 Ga0207669_10017807 Ga0207669_100178075 300
2 3300048904 Ga0496101_0312886 Ga0496101_0312886_14_1126 312
3 3300031903 Ga0307407_10079851 Ga0307407_100798512 317
4 3300046499 Ga0495594_0174578 Ga0495594_0174578_29_1069 317
5 3300047321 Ga0495676_0040704 Ga0495676_0040704_20_1060 317
6 3300009176 Ga0105242_10110340 Ga0105242_101103401 319
7 3300046523 Ga0495644_0074319 Ga0495644_0074319_43_1176 319
8 3300050496 nmdc:mga07m45_131202_c1 nmdc:mga07m45_131202_c1_261_1430 324
9 3300005937 Ga0081455_10071708 Ga0081455_100717082 325
10 3300050489 nmdc:mga03683_99577_c1 nmdc:mga03683_99577_c1_156_1256 327
11 3300046558 Ga0495633_0017789 Ga0495633_0017789_2008_3168 328
12 3300046615 Ga0495656_0002563 Ga0495656_0002563_2392_3552 328
13 3300046694 Ga0495649_0053411 Ga0495649_0053411_949_2109 328
14 3300031852 Ga0307410_10012224 Ga0307410_100122242 335
15 3300031995 Ga0307409_100127575 Ga0307409_1001275752 335
16 3300032126 Ga0307415_100135389 Ga0307415_1001353892 335
17 3300006844 Ga0075428_100001293 Ga0075428_10000129320 336
18 3300006880 Ga0075429_100018168 Ga0075429_1000181682 336
19 3300009094 Ga0111539_10004453 Ga0111539_1000445313 336
20 3300039437 Ga0436365_0985041 Ga0436365_0985041_1895_3328 336
21 3300050508 nmdc:mga09592_4987_c1 nmdc:mga09592_4987_c1_5052_6251 336
22 3300026089 Ga0207648_10138210 Ga0207648_101382103 339
23 3300009176 Ga0105242_10235982 Ga0105242_102359821 340
24 3300050493 nmdc:mga0k408_100615_c1 nmdc:mga0k408_100615_c1_504_1664 340
25 3300048903 Ga0496100_0020939 Ga0496100_0020939_296_1459 342
26 3300048917 Ga0496114_0334705 Ga0496114_0334705_23_1186 342
27 3300005518 Ga0070699_100017015 Ga0070699_1000170158 343
28 3300009094 Ga0111539_10001671 Ga0111539_100016716 343
29 3300009147 Ga0114129_10105531 Ga0114129_101055312 343
30 3300050507 nmdc:mga05p37_66_c1 nmdc:mga05p37_66_c1_2820_3980 343
31 3300050508 nmdc:mga09592_15300_c1 nmdc:mga09592_15300_c1_2820_3980 343
32 3300050509 nmdc:mga0qj67_1385_c1 nmdc:mga0qj67_1385_c1_6043_7203 343
33 3300050510 nmdc:mga06r32_2037_c1 nmdc:mga06r32_2037_c1_2165_3325 343
34 3300050511 nmdc:mga08y16_28470_c1 nmdc:mga08y16_28470_c1_2820_3980 343
35 3300050512 nmdc:mga0n895_43_c1 nmdc:mga0n895_43_c1_70407_71567 343
36 3300050513 nmdc:mga0rr50_21716_c1 nmdc:mga0rr50_21716_c1_2860_4020 343
37 3300050515 nmdc:mga0a205_945_c1 nmdc:mga0a205_945_c1_10108_11268 343
38 3300031241 Ga0265325_10009459 Ga0265325_100094592 345
39 3300049593 Ga0501077_0146306 Ga0501077_0146306_108_1385 346
40 3300005356 Ga0070674_100013176 Ga0070674_1000131763 347
41 3300011119 Ga0105246_10083633 Ga0105246_100836331 347
42 3300014969 Ga0157376_10171564 Ga0157376_101715643 347
43 3300025934 Ga0207686_10109615 Ga0207686_101096152 347
44 3300026067 Ga0207678_10033053 Ga0207678_100330534 347
45 3300046455 Ga0495603_0113837 Ga0495603_0113837_143_1369 347
46 3300006048 Ga0075363_100012213 Ga0075363_1000122132 348
47 3300006051 Ga0075364_10035768 Ga0075364_100357682 348
48 3300006195 Ga0075366_10017974 Ga0075366_100179744 348
49 3300006353 Ga0075370_10033294 Ga0075370_100332943 348
50 3300026067 Ga0207678_10088596 Ga0207678_100885963 348
51 3300026075 Ga0207708_10165681 Ga0207708_101656812 348
52 3300035695 Ga0373927_0038738 Ga0373927_0038738_1266_2513 348
53 3300035725 Ga0373947_0077932 Ga0373947_0077932_629_1876 348
54 3300046473 Ga0495582_0040453 Ga0495582_0040453_135_1382 348
55 3300046683 Ga0495658_0007167 Ga0495658_0007167_748_1995 348
56 3300046689 Ga0495613_0123256 Ga0495613_0123256_376_1623 348
57 3300047315 Ga0495581_0064810 Ga0495581_0064810_766_2013 348
58 3300048913 Ga0496110_0146801 Ga0496110_0146801_327_1529 348
59 3300048913 Ga0496110_0168546 Ga0496110_0168546_472_1623 348
60 3300048914 Ga0496111_0172724 Ga0496111_0172724_93_1295 348
61 3300048914 Ga0496111_0181557 Ga0496111_0181557_82_1233 348
62 3300059424 Ga0590075_001383 Ga0590075_001383_81_1304 348
63 3300046533 Ga0495640_0017590 Ga0495640_0017590_48_1181 349
64 3300046684 Ga0495669_0003460 Ga0495669_0003460_571_1770 349
65 3300035119 Ga0373956_0091029 Ga0373956_0091029_132_1382 350
66 3300035120 Ga0373957_0034882 Ga0373957_0034882_381_1631 350
67 3300035172 Ga0373955_0142739 Ga0373955_0142739_16_1266 350
68 3300035207 Ga0373942_0034676 Ga0373942_0034676_53_1246 350
69 3300035691 Ga0373931_0005943 Ga0373931_0005943_2746_3939 350
70 3300036401 Ga0373937_0000886 Ga0373937_0000886_12385_13635 350
71 3300050491 nmdc:mga00v17_72972_c1 nmdc:mga00v17_72972_c1_768_2063 350
72 3300050493 nmdc:mga0k408_51980_c1 nmdc:mga0k408_51980_c1_750_2045 350
73 3300005340 Ga0070689_100080150 Ga0070689_1000801502 351
74 3300026116 Ga0207674_10104320 Ga0207674_101043203 351
75 3300045051 Ga0451576_0060431 Ga0451576_0060431_1764_2963 351
76 3300049571 Ga0501034_0346575 Ga0501034_0346575_47_1288 351
77 3300049572 Ga0501036_0043625 Ga0501036_0043625_2445_3686 351
78 3300049573 Ga0501037_0017425 Ga0501037_0017425_3215_4456 351
79 3300049574 Ga0501038_0161649 Ga0501038_0161649_137_1378 351
80 3300049581 Ga0501047_0348665 Ga0501047_0348665_63_1304 351
81 3300049584 Ga0501068_0017026 Ga0501068_0017026_666_1907 351
82 3300049586 Ga0501070_0240337 Ga0501070_0240337_173_1414 351
83 3300049589 Ga0501073_0071729 Ga0501073_0071729_1015_2256 351
84 3300049590 Ga0501074_0127014 Ga0501074_0127014_29_1270 351
85 3300049741 Ga0501079_0271584 Ga0501079_0271584_68_1309 351
86 3300049742 Ga0501080_0210772 Ga0501080_0210772_224_1465 351
87 3300049822 Ga0501035_0017088 Ga0501035_0017088_4299_5534 351
88 3300049822 Ga0501035_0223166 Ga0501035_0223166_41_1282 351
89 3300049823 Ga0501044_0163289 Ga0501044_0163289_442_1683 351
90 3300005617 Ga0068859_100044150 Ga0068859_1000441502 352
91 3300006931 Ga0097620_100044148 Ga0097620_1000441487 352
92 3300027907 Ga0207428_10004444 Ga0207428_100044447 352
93 3300044901 Ga0466960_0008973 Ga0466960_0008973_2609_3802 352
94 3300049575 Ga0501039_0145503 Ga0501039_0145503_46_1287 352
95 3300050511 nmdc:mga08y16_8946_c1 nmdc:mga08y16_8946_c1_6001_7200 352
96 3300050512 nmdc:mga0n895_329134_c1 nmdc:mga0n895_329134_c1_265_1410 353
97 3300005981 Ga0081538_10036177 Ga0081538_100361772 355
98 3300035695 Ga0373927_0124037 Ga0373927_0124037_318_1565 355
99 3300049572 Ga0501036_0117614 Ga0501036_0117614_419_1606 356
100 3300049580 Ga0501046_0131490 Ga0501046_0131490_406_1593 356
101 3300049582 Ga0501048_0062336 Ga0501048_0062336_746_1933 356
102 3300049587 Ga0501071_0101752 Ga0501071_0101752_371_1558 356
103 3300049592 Ga0501076_0051409 Ga0501076_0051409_1397_2584 356
104 3300049743 Ga0501081_0114271 Ga0501081_0114271_373_1560 356
105 3300035410 Ga0373924_0089890 Ga0373924_0089890_134_1294 357
106 3300036401 Ga0373937_0007052 Ga0373937_0007052_6407_7564 357
107 3300037853 Ga0436364_0937429 Ga0436364_0937429_1004_2248 357
108 3300046528 Ga0495642_0105349 Ga0495642_0105349_13_1173 357
109 3300047321 Ga0495676_0068347 Ga0495676_0068347_1293_2453 357
110 3300048923 Ga0496120_0005359 Ga0496120_0005359_22_1182 357
111 3300049572 Ga0501036_0160034 Ga0501036_0160034_26_1183 357
112 3300007265 Ga0099794_10010846 Ga0099794_100108462 358
113 3300027671 Ga0209588_1007543 Ga0209588_10075432 358
114 3300046678 Ga0495599_0039055 Ga0495599_0039055_1804_2964 358
115 3300048904 Ga0496101_0111853 Ga0496101_0111853_882_2042 358
116 3300049575 Ga0501039_0039819 Ga0501039_0039819_721_1950 358
117 3300050495 nmdc:mga04h51_39202_c1 nmdc:mga04h51_39202_c1_157_1350 358
118 3300050507 nmdc:mga05p37_222915_c1 nmdc:mga05p37_222915_c1_200_1360 358
119 3300050512 nmdc:mga0n895_109885_c1 nmdc:mga0n895_109885_c1_207_1367 358
120 3300053094 Ga0500566_0000453 Ga0500566_0000453_18668_19918 358
121 3300053130 Ga0500642_0000013 Ga0500642_0000013_114540_115793 358
122 3300053177 Ga0500636_0006602 Ga0500636_0006602_685_1935 358
123 3300059423 Ga0590074_009543 Ga0590074_009543_321_1580 358
124 3300059426 Ga0590077_000809 Ga0590077_000809_2835_4094 358
125 3300005718 Ga0068866_10050562 Ga0068866_100505622 359
126 3300025295 Ga0209564_1010724 Ga0209564_10107244 359
127 3300031241 Ga0265325_10049928 Ga0265325_100499282 359
128 3300031247 Ga0265340_10011739 Ga0265340_100117392 359
129 3300031712 Ga0265342_10012718 Ga0265342_100127183 359
130 3300032126 Ga0307415_100255441 Ga0307415_1002554411 359
131 3300048903 Ga0496100_0288491 Ga0496100_0288491_18_1187 359
132 3300048919 Ga0496116_0001614 Ga0496116_0001614_7881_9134 359
133 3300049589 Ga0501073_0011823 Ga0501073_0011823_2761_3993 360
134 3300049590 Ga0501074_0042835 Ga0501074_0042835_1119_2459 360
135 3300053125 Ga0500618_003981 Ga0500618_003981_178_1446 360
136 3300053136 Ga0500559_0000743 Ga0500559_0000743_9881_11179 360
137 3300005981 Ga0081538_10001155 Ga0081538_100011557 361
138 3300028577 Ga0265318_10017411 Ga0265318_100174112 361
139 3300031712 Ga0265342_10058739 Ga0265342_100587392 361
140 3300039450 Ga0436363_0546384 Ga0436363_0546384_1345_2601 361
141 3300048929 Ga0496126_0015074 Ga0496126_0015074_5713_6963 361
142 3300009098 Ga0105245_10072920 Ga0105245_100729202 362
143 3300031241 Ga0265325_10000264 Ga0265325_1000026423 362
144 3300053145 Ga0500586_000728 Ga0500586_000728_5319_6608 362
145 3300041451 Ga0451791_0854514 Ga0451791_0854514_811_2022 363
146 3300046516 Ga0495628_0171316 Ga0495628_0171316_33_1214 363
147 3300047317 Ga0495604_0169649 Ga0495604_0169649_21_1202 363
148 3300048918 Ga0496115_0103811 Ga0496115_0103811_423_1823 363
149 3300048928 Ga0496125_0005590 Ga0496125_0005590_6116_7360 363
150 3300053077 Ga0495601_0047455 Ga0495601_0047455_866_2047 363
151 3300006186 Ga0075369_10074319 Ga0075369_100743192 364
152 3300048088 Ga0495602_0160447 Ga0495602_0160447_213_1397 364
153 3300053085 Ga0495619_0099139 Ga0495619_0099139_146_1330 364
154 3300053119 Ga0500595_003436 Ga0500595_003436_3712_4950 364
155 3300030521 Ga0307511_10000103 Ga0307511_1000010351 365
156 3300035170 Ga0373943_0115179 Ga0373943_0115179_161_1402 365
157 3300046533 Ga0495640_0165592 Ga0495640_0165592_218_1399 365
158 3300053090 Ga0500646_0000496 Ga0500646_0000496_4228_5442 365
159 3300053092 Ga0500583_0006707 Ga0500583_0006707_848_2062 365
160 3300053133 Ga0500655_001554 Ga0500655_001554_136_1350 365
161 3300053151 Ga0500604_0000391 Ga0500604_0000391_3644_4858 365
162 3300005333 Ga0070677_10019441 Ga0070677_100194412 366
163 3300005356 Ga0070674_100005859 Ga0070674_1000058596 366
164 3300005364 Ga0070673_100045005 Ga0070673_1000450052 366
165 3300005456 Ga0070678_100020597 Ga0070678_1000205973 366
166 3300005459 Ga0068867_100069212 Ga0068867_1000692122 366
167 3300005543 Ga0070672_100026162 Ga0070672_1000261623 366
168 3300005840 Ga0068870_10048111 Ga0068870_100481112 366
169 3300005981 Ga0081538_10015356 Ga0081538_100153563 366
170 3300006237 Ga0097621_100044616 Ga0097621_1000446163 366
171 3300014969 Ga0157376_10032384 Ga0157376_100323844 366
172 3300025893 Ga0207682_10004647 Ga0207682_100046475 366
173 3300025908 Ga0207643_10067053 Ga0207643_100670531 366
174 3300025937 Ga0207669_10007724 Ga0207669_100077242 366
175 3300025940 Ga0207691_10008976 Ga0207691_100089765 366
176 3300026089 Ga0207648_10093578 Ga0207648_100935782 366
177 3300026118 Ga0207675_100225571 Ga0207675_1002255711 366
178 3300026121 Ga0207683_10004551 Ga0207683_100045513 366
179 3300035691 Ga0373931_0019608 Ga0373931_0019608_639_1898 366
180 3300046539 Ga0495621_0003751 Ga0495621_0003751_2192_3442 366
181 3300046615 Ga0495656_0065109 Ga0495656_0065109_99_1349 366
182 3300047447 Ga0495685_009663 Ga0495685_009663_64_1314 366
183 3300048907 Ga0496104_0107105 Ga0496104_0107105_604_1863 366
184 3300053177 Ga0500636_0014393 Ga0500636_0014393_2813_4108 366
185 3300005614 Ga0068856_100202241 Ga0068856_1002022411 367
186 3300006195 Ga0075366_10030814 Ga0075366_100308141 367
187 3300006353 Ga0075370_10015759 Ga0075370_100157591 367
188 3300006847 Ga0075431_100345946 Ga0075431_1003459462 367
189 3300046477 Ga0495664_0110787 Ga0495664_0110787_236_1477 367
190 3300048904 Ga0496101_0018061 Ga0496101_0018061_2238_3482 367
191 3300048905 Ga0496102_0050732 Ga0496102_0050732_750_1994 367
192 3300048906 Ga0496103_0008938 Ga0496103_0008938_1536_2780 367
193 3300048907 Ga0496104_0054430 Ga0496104_0054430_1172_2416 367
194 3300048910 Ga0496107_0002421 Ga0496107_0002421_1690_2934 367
195 3300048911 Ga0496108_0027188 Ga0496108_0027188_3085_4329 367
196 3300048912 Ga0496109_0004202 Ga0496109_0004202_1796_3040 367
197 3300048913 Ga0496110_0007372 Ga0496110_0007372_4346_5590 367
198 3300048914 Ga0496111_0018071 Ga0496111_0018071_506_1750 367
199 3300048915 Ga0496112_0004919 Ga0496112_0004919_2322_3566 367
200 3300050493 nmdc:mga0k408_10711_c1 nmdc:mga0k408_10711_c1_398_1636 367
201 3300050496 nmdc:mga07m45_4847_c1 nmdc:mga07m45_4847_c1_3535_4773 367
202 3300050496 nmdc:mga07m45_52370_c1 nmdc:mga07m45_52370_c1_926_2176 367
203 3300050511 nmdc:mga08y16_111063_c1 nmdc:mga08y16_111063_c1_1261_2457 367
204 3300009147 Ga0114129_10322147 Ga0114129_103221472 368
205 3300035111 Ga0373923_0023560 Ga0373923_0023560_56_1246 368
206 3300050507 nmdc:mga05p37_265445_c1 nmdc:mga05p37_265445_c1_573_1793 368
207 iso_pu_bacteria 2842694124 2842695826 368
208 3300006844 Ga0075428_100004262 Ga0075428_1000042623 369
209 3300006847 Ga0075431_100000262 Ga0075431_10000026226 369
210 3300006880 Ga0075429_100004109 Ga0075429_1000041094 369
211 3300009094 Ga0111539_10000148 Ga0111539_1000014829 369
212 3300009147 Ga0114129_10000142 Ga0114129_1000014240 369
213 3300027907 Ga0207428_10001096 Ga0207428_100010965 369
214 3300044735 Ga0466968_0039713 Ga0466968_0039713_41_1288 369
215 3300048907 Ga0496104_0287289 Ga0496104_0287289_59_1303 369
216 3300048909 Ga0496106_0084684 Ga0496106_0084684_1134_2378 369
217 3300048911 Ga0496108_0004510 Ga0496108_0004510_1039_2283 369
218 3300048912 Ga0496109_0009259 Ga0496109_0009259_469_1713 369
219 3300048913 Ga0496110_0001998 Ga0496110_0001998_4934_6178 369
220 3300048914 Ga0496111_0000832 Ga0496111_0000832_3134_4378 369
221 3300048916 Ga0496113_0096960 Ga0496113_0096960_1019_2263 369
222 3300050507 nmdc:mga05p37_859_c1 nmdc:mga05p37_859_c1_17233_18474 369
223 3300050508 nmdc:mga09592_556_c1 nmdc:mga09592_556_c1_18159_19400 369
224 3300050509 nmdc:mga0qj67_50730_c1 nmdc:mga0qj67_50730_c1_1703_2944 369
225 3300050510 nmdc:mga06r32_524_c1 nmdc:mga06r32_524_c1_20881_22122 369
226 3300050511 nmdc:mga08y16_368_c1 nmdc:mga08y16_368_c1_13489_14730 369
227 3300053096 Ga0500641_0011339 Ga0500641_0011339_1066_2322 369
228 3300006058 Ga0075432_10003155 Ga0075432_100031552 370
229 3300006844 Ga0075428_100025459 Ga0075428_1000254595 370
230 3300006846 Ga0075430_100001054 Ga0075430_1000010545 370
231 3300006852 Ga0075433_10003469 Ga0075433_1000346910 370
232 3300006871 Ga0075434_100004788 Ga0075434_1000047882 370
233 3300006880 Ga0075429_100000098 Ga0075429_1000000986 370
234 3300007076 Ga0075435_100075144 Ga0075435_1000751442 370
235 3300027907 Ga0207428_10000137 Ga0207428_1000013712 370
236 3300031238 Ga0265332_10021100 Ga0265332_100211002 370
237 3300005457 Ga0070662_100080164 Ga0070662_1000801641 371
238 3300042438 Ga0439459_0016036 Ga0439459_0016036_119_1324 371
239 3300049588 Ga0501072_0002326 Ga0501072_0002326_7238_8470 371
240 3300060353 Ga0501082_0075316 Ga0501082_0075316_1579_2811 371
241 3300009098 Ga0105245_10023851 Ga0105245_100238513 372
242 3300025901 Ga0207688_10057967 Ga0207688_100579673 372
243 3300025940 Ga0207691_10255008 Ga0207691_102550081 372
244 3300044842 Ga0466957_0084928 Ga0466957_0084928_240_1526 373
245 3300035086 Ga0373934_0028494 Ga0373934_0028494_746_1984 374
246 3300035113 Ga0373936_0013209 Ga0373936_0013209_1700_2938 374
247 3300005336 Ga0070680_100002488 Ga0070680_1000024884 375
248 3300005337 Ga0070682_100005035 Ga0070682_1000050356 375
249 3300005366 Ga0070659_100033378 Ga0070659_1000333783 375
250 3300005445 Ga0070708_100021231 Ga0070708_1000212312 375
251 3300005458 Ga0070681_10006157 Ga0070681_100061578 375
252 3300005467 Ga0070706_100185773 Ga0070706_1001857732 375
253 3300005530 Ga0070679_100002767 Ga0070679_1000027674 375
254 3300005536 Ga0070697_100067756 Ga0070697_1000677562 375
255 3300005539 Ga0068853_100009417 Ga0068853_1000094172 375
256 3300005577 Ga0068857_100142366 Ga0068857_1001423662 375
257 3300013104 Ga0157370_10021860 Ga0157370_100218603 375
258 3300013307 Ga0157372_10007314 Ga0157372_100073144 375
259 3300025295 Ga0209564_1000503 Ga0209564_100050329 375
260 3300025910 Ga0207684_10029116 Ga0207684_100291162 375
261 3300025912 Ga0207707_10026061 Ga0207707_100260613 375
262 3300025921 Ga0207652_10005736 Ga0207652_100057366 375
263 3300025932 Ga0207690_10043090 Ga0207690_100430903 375
264 3300026041 Ga0207639_10027143 Ga0207639_100271432 375
265 3300026116 Ga0207674_10021321 Ga0207674_100213216 375
266 3300005549 Ga0070704_100011561 Ga0070704_1000115613 376
267 3300009553 Ga0105249_10001468 Ga0105249_1000146819 376
268 3300025939 Ga0207665_10060869 Ga0207665_100608692 376
269 3300025961 Ga0207712_10001257 Ga0207712_100012574 376
270 3300035113 Ga0373936_0016791 Ga0373936_0016791_1193_2419 376
271 3300035119 Ga0373956_0016910 Ga0373956_0016910_1115_2359 376
272 3300046516 Ga0495628_0008997 Ga0495628_0008997_5752_6996 376
273 3300046526 Ga0495666_0004367 Ga0495666_0004367_3768_5012 376
274 3300025928 Ga0207700_10241939 Ga0207700_102419391 377
275 3300049587 Ga0501071_0050830 Ga0501071_0050830_406_1635 378
276 3300049588 Ga0501072_0011295 Ga0501072_0011295_284_1513 378
277 3300049593 Ga0501077_0068243 Ga0501077_0068243_197_1426 378
278 3300054114 Ga0501084_0039004 Ga0501084_0039004_282_1511 378
279 3300054114 Ga0501084_0058288 Ga0501084_0058288_531_1781 378
280 3300035086 Ga0373934_0023003 Ga0373934_0023003_320_1588 379
281 3300036401 Ga0373937_0000886 Ga0373937_0000886_11104_12372 379
282 3300047471 Ga0495684_0116464 Ga0495684_0116464_324_1592 379
283 3300005329 Ga0070683_100220661 Ga0070683_1002206612 380
284 3300005471 Ga0070698_100192918 Ga0070698_1001929182 380
285 3300005937 Ga0081455_10007391 Ga0081455_100073918 380
286 3300005983 Ga0081540_1004578 Ga0081540_100457814 380
287 3300013297 Ga0157378_10023666 Ga0157378_100236665 380
288 3300046642 Ga0495634_0010838 Ga0495634_0010838_5196_6437 380
289 3300005340 Ga0070689_100032546 Ga0070689_1000325463 381
290 3300006353 Ga0075370_10069489 Ga0075370_100694892 381
291 3300009094 Ga0111539_10089802 Ga0111539_100898023 381
292 3300025936 Ga0207670_10024364 Ga0207670_100243643 381
293 3300028380 Ga0268265_10091652 Ga0268265_100916521 381
294 3300048907 Ga0496104_0205545 Ga0496104_0205545_176_1411 381
295 3300050493 nmdc:mga0k408_110527_c1 nmdc:mga0k408_110527_c1_81_1325 381
296 3300050511 nmdc:mga08y16_88083_c1 nmdc:mga08y16_88083_c1_1744_2991 381
297 3300053142 Ga0500577_0014889 Ga0500577_0014889_845_2089 381
298 iso_pu_bacteria 2602042107 2603857701 381
299 iso_pu_bacteria 2857524615 2857527072 381
300 iso_pu_bacteria 2919073203 2919078185 381
301 3300005334 Ga0068869_100044587 Ga0068869_1000445873 382
302 3300005985 Ga0081539_10000932 Ga0081539_1000093258 382
303 3300006048 Ga0075363_100010413 Ga0075363_1000104134 382
304 3300006051 Ga0075364_10010988 Ga0075364_100109885 382
305 3300006177 Ga0075362_10005054 Ga0075362_100050543 382
306 3300025942 Ga0207689_10028371 Ga0207689_100283714 382
307 3300031595 Ga0265313_10000326 Ga0265313_1000032630 382
308 3300035089 Ga0373944_0004415 Ga0373944_0004415_1415_2653 382
309 3300035118 Ga0373954_0013043 Ga0373954_0013043_1102_2340 382
310 3300042003 Ga0439443_001382 Ga0439443_001382_609_1856 382
311 3300042461 Ga0439460_0008533 Ga0439460_0008533_789_2036 382
312 3300046452 Ga0495617_005058 Ga0495617_005058_2255_3493 382
313 3300046455 Ga0495603_0033791 Ga0495603_0033791_1660_2898 382
314 3300046462 Ga0495651_0006630 Ga0495651_0006630_5635_6873 382
315 3300046463 Ga0495653_0024639 Ga0495653_0024639_1067_2305 382
316 3300046476 Ga0495662_0020655 Ga0495662_0020655_1708_2946 382
317 3300046491 Ga0495584_0012631 Ga0495584_0012631_2522_3760 382
318 3300046492 Ga0495585_0002877 Ga0495585_0002877_1997_3235 382
319 3300046499 Ga0495594_0016497 Ga0495594_0016497_2624_3862 382
320 3300046501 Ga0495607_0026237 Ga0495607_0026237_1762_3000 382
321 3300046523 Ga0495644_0001026 Ga0495644_0001026_1381_2619 382
322 3300046525 Ga0495663_0008690 Ga0495663_0008690_659_1897 382
323 3300046533 Ga0495640_0057146 Ga0495640_0057146_239_1477 382
324 3300046537 Ga0495598_0014386 Ga0495598_0014386_603_1841 382
325 3300046557 Ga0495622_0001456 Ga0495622_0001456_3780_5018 382
326 3300046558 Ga0495633_0029983 Ga0495633_0029983_750_1988 382
327 3300046559 Ga0495667_0023398 Ga0495667_0023398_1274_2512 382
328 3300046615 Ga0495656_0001889 Ga0495656_0001889_2774_4012 382
329 3300046648 Ga0495611_0008388 Ga0495611_0008388_2134_3372 382
330 3300046674 Ga0495588_0007943 Ga0495588_0007943_1674_2912 382
331 3300046681 Ga0495647_0010604 Ga0495647_0010604_836_2074 382
332 3300046683 Ga0495658_0022108 Ga0495658_0022108_84_1322 382
333 3300046690 Ga0495624_0018366 Ga0495624_0018366_1929_3167 382
334 3300046809 Ga0495600_0008743 Ga0495600_0008743_3339_4577 382
335 3300047317 Ga0495604_0010004 Ga0495604_0010004_3731_4969 382
336 3300047322 Ga0495680_0012055 Ga0495680_0012055_1719_2957 382
337 3300047471 Ga0495684_0023656 Ga0495684_0023656_1777_3015 382
338 3300050490 nmdc:mga03n38_8107_c1 nmdc:mga03n38_8107_c1_1742_2989 382
339 3300050491 nmdc:mga00v17_23989_c1 nmdc:mga00v17_23989_c1_1995_3242 382
340 3300050493 nmdc:mga0k408_3273_c1 nmdc:mga0k408_3273_c1_173_1420 382
341 3300053078 Ga0495612_0004100 Ga0495612_0004100_2720_3955 382
342 3300053084 Ga0495595_0002267 Ga0495595_0002267_4311_5549 382
343 3300053085 Ga0495619_0002410 Ga0495619_0002410_7842_9080 382
344 3300053094 Ga0500566_0110923 Ga0500566_0110923_76_1314 382
345 3300025297 Ga0209758_1000997 Ga0209758_100099716 383
346 3300025937 Ga0207669_10102904 Ga0207669_101029042 383
347 3300025941 Ga0207711_10121557 Ga0207711_101215572 383
348 3300025944 Ga0207661_10021285 Ga0207661_100212853 383
349 3300031247 Ga0265340_10011739 Ga0265340_100117393 383
350 3300031712 Ga0265342_10012718 Ga0265342_100127182 383
351 3300039437 Ga0436365_0787487 Ga0436365_0787487_2638_3885 383
352 3300049588 Ga0501072_0002326 Ga0501072_0002326_8506_9756 383
353 3300050492 nmdc:mga0yw44_47510_c1 nmdc:mga0yw44_47510_c1_1264_2544 383
354 3300060353 Ga0501082_0001777 Ga0501082_0001777_13554_14825 383
355 3300060353 Ga0501082_0198806 Ga0501082_0198806_114_1361 383
356 3300009551 Ga0105238_10047267 Ga0105238_100472672 384
357 3300031235 Ga0265330_10072670 Ga0265330_100726701 384
358 3300031240 Ga0265320_10011326 Ga0265320_100113262 384
359 3300031241 Ga0265325_10046419 Ga0265325_100464192 384
360 3300031595 Ga0265313_10019078 Ga0265313_100190783 384
361 3300031711 Ga0265314_10021297 Ga0265314_100212973 384
362 3300031995 Ga0307409_100242541 Ga0307409_1002425411 384
363 3300035083 Ga0373926_0000678 Ga0373926_0000678_1227_2471 384
364 3300035111 Ga0373923_0006334 Ga0373923_0006334_1062_2306 384
365 3300036401 Ga0373937_0131593 Ga0373937_0131593_936_2180 384
366 3300046454 Ga0495592_0019734 Ga0495592_0019734_1736_2980 384
367 3300046459 Ga0495629_0000900 Ga0495629_0000900_6381_7634 384
368 3300046461 Ga0495641_0016404 Ga0495641_0016404_1256_2500 384
369 3300046473 Ga0495582_0019557 Ga0495582_0019557_1538_2782 384
370 3300046475 Ga0495639_0010420 Ga0495639_0010420_652_1896 384
371 3300046533 Ga0495640_0032861 Ga0495640_0032861_1829_3073 384
372 3300046678 Ga0495599_0034546 Ga0495599_0034546_1694_2938 384
373 3300046689 Ga0495613_0064542 Ga0495613_0064542_126_1370 384
374 3300047315 Ga0495581_0012004 Ga0495581_0012004_2226_3470 384
375 3300049570 Ga0501033_0194968 Ga0501033_0194968_158_1396 384
376 3300049571 Ga0501034_0128148 Ga0501034_0128148_766_2004 384
377 3300049573 Ga0501037_0226230 Ga0501037_0226230_58_1296 384
378 3300049584 Ga0501068_0185977 Ga0501068_0185977_37_1275 384
379 3300049586 Ga0501070_0291316 Ga0501070_0291316_69_1307 384
380 3300049742 Ga0501080_0043438 Ga0501080_0043438_519_1757 384
381 3300049823 Ga0501044_0360773 Ga0501044_0360773_42_1280 384
382 3300053077 Ga0495601_0165256 Ga0495601_0165256_173_1417 384
383 3300005434 Ga0070709_10033335 Ga0070709_100333352 385
384 3300005937 Ga0081455_10002467 Ga0081455_1000246719 385
385 3300005937 Ga0081455_10021494 Ga0081455_100214944 385
386 3300006038 Ga0075365_10068207 Ga0075365_100682072 385
387 3300006051 Ga0075364_10074864 Ga0075364_100748642 385
388 3300006852 Ga0075433_10006064 Ga0075433_100060644 385
389 3300006871 Ga0075434_100024511 Ga0075434_1000245115 385
390 3300037068 Ga0373925_0028016 Ga0373925_0028016_743_2002 385
391 3300047320 Ga0495672_0069631 Ga0495672_0069631_442_1692 385
392 3300049571 Ga0501034_0000229 Ga0501034_0000229_87311_88555 385
393 3300050491 nmdc:mga00v17_6125_c1 nmdc:mga00v17_6125_c1_545_1795 385
394 3300050492 nmdc:mga0yw44_56784_c1 nmdc:mga0yw44_56784_c1_654_1904 385
395 3300050512 nmdc:mga0n895_14277_c1 nmdc:mga0n895_14277_c1_740_1981 385
396 3300050512 nmdc:mga0n895_5157_c1 nmdc:mga0n895_5157_c1_4487_5746 385
397 3300050515 nmdc:mga0a205_8987_c1 nmdc:mga0a205_8987_c1_1329_2588 385
398 3300053153 Ga0500616_0025450 Ga0500616_0025450_36_1298 385
399 3300044684 Ga0466966_0002836 Ga0466966_0002836_5608_6870 386
400 3300005328 Ga0070676_10018656 Ga0070676_100186562 387
401 3300005329 Ga0070683_100113215 Ga0070683_1001132152 387
402 3300005330 Ga0070690_100060123 Ga0070690_1000601232 387
403 3300005331 Ga0070670_100026175 Ga0070670_1000261752 387
404 3300005344 Ga0070661_100017848 Ga0070661_1000178484 387
405 3300005437 Ga0070710_10037970 Ga0070710_100379701 387
406 3300005440 Ga0070705_100049044 Ga0070705_1000490442 387
407 3300005441 Ga0070700_100050754 Ga0070700_1000507542 387
408 3300005456 Ga0070678_100002106 Ga0070678_1000021064 387
409 3300005457 Ga0070662_100186559 Ga0070662_1001865591 387
410 3300005544 Ga0070686_100016768 Ga0070686_1000167682 387
411 3300005842 Ga0068858_100043124 Ga0068858_1000431243 387
412 3300005843 Ga0068860_100149758 Ga0068860_1001497582 387
413 3300006028 Ga0070717_10001777 Ga0070717_1000177710 387
414 3300006163 Ga0070715_10005663 Ga0070715_100056632 387
415 3300006173 Ga0070716_100008517 Ga0070716_1000085175 387
416 3300006871 Ga0075434_100194384 Ga0075434_1001943842 387
417 3300007076 Ga0075435_100053357 Ga0075435_1000533572 387
418 3300007076 Ga0075435_100075609 Ga0075435_1000756092 387
419 3300009174 Ga0105241_10037172 Ga0105241_100371723 387
420 3300009176 Ga0105242_10083255 Ga0105242_100832552 387
421 3300009545 Ga0105237_10062593 Ga0105237_100625932 387
422 3300009553 Ga0105249_10150903 Ga0105249_101509032 387
423 3300013296 Ga0157374_10172830 Ga0157374_101728302 387
424 3300025900 Ga0207710_10006576 Ga0207710_100065761 387
425 3300025905 Ga0207685_10001959 Ga0207685_100019592 387
426 3300025915 Ga0207693_10026982 Ga0207693_100269825 387
427 3300025916 Ga0207663_10110214 Ga0207663_101102142 387
428 3300025919 Ga0207657_10029530 Ga0207657_100295303 387
429 3300025926 Ga0207659_10148441 Ga0207659_101484411 387
430 3300025927 Ga0207687_10064134 Ga0207687_100641342 387
431 3300025928 Ga0207700_10000953 Ga0207700_100009537 387
432 3300025939 Ga0207665_10002924 Ga0207665_100029246 387
433 3300025941 Ga0207711_10055218 Ga0207711_100552182 387
434 3300025944 Ga0207661_10111521 Ga0207661_101115212 387
435 3300025961 Ga0207712_10139094 Ga0207712_101390942 387
436 3300026035 Ga0207703_10058166 Ga0207703_100581662 387
437 3300026067 Ga0207678_10093036 Ga0207678_100930362 387
438 3300026075 Ga0207708_10030427 Ga0207708_100304273 387
439 3300026121 Ga0207683_10004853 Ga0207683_100048536 387
440 3300028379 Ga0268266_10074758 Ga0268266_100747582 387
441 3300035088 Ga0373940_0009757 Ga0373940_0009757_515_1846 387
442 3300035089 Ga0373944_0005168 Ga0373944_0005168_2042_3373 387
443 3300035090 Ga0373949_0006178 Ga0373949_0006178_19_1266 387
444 3300035114 Ga0373939_0002506 Ga0373939_0002506_2467_3798 387
445 3300035170 Ga0373943_0030787 Ga0373943_0030787_764_2095 387
446 3300035691 Ga0373931_0001808 Ga0373931_0001808_1100_2431 387
447 3300035692 Ga0373935_0005030 Ga0373935_0005030_5712_7043 387
448 3300035695 Ga0373927_0006141 Ga0373927_0006141_1820_3151 387
449 3300035725 Ga0373947_0012549 Ga0373947_0012549_1273_2604 387
450 3300037068 Ga0373925_0020390 Ga0373925_0020390_1874_3205 387
451 3300046455 Ga0495603_0001962 Ga0495603_0001962_5939_7270 387
452 3300046459 Ga0495629_0006873 Ga0495629_0006873_5990_7321 387
453 3300046461 Ga0495641_0007778 Ga0495641_0007778_825_2156 387
454 3300046472 Ga0495580_0048650 Ga0495580_0048650_549_1880 387
455 3300046473 Ga0495582_0003483 Ga0495582_0003483_2777_4108 387
456 3300046499 Ga0495594_0003494 Ga0495594_0003494_6561_7892 387
457 3300046683 Ga0495658_0001428 Ga0495658_0001428_8155_9486 387
458 3300046689 Ga0495613_0006101 Ga0495613_0006101_2460_3791 387
459 3300047315 Ga0495581_0022194 Ga0495581_0022194_1148_2479 387
460 3300047322 Ga0495680_0018600 Ga0495680_0018600_2127_3458 387
461 3300047673 Ga0495593_0001262 Ga0495593_0001262_7304_8635 387
462 3300048908 Ga0496105_0080947 Ga0496105_0080947_966_2297 387
463 3300048908 Ga0496105_0084652 Ga0496105_0084652_944_2275 387
464 3300048911 Ga0496108_0038043 Ga0496108_0038043_967_2298 387
465 3300048912 Ga0496109_0032556 Ga0496109_0032556_1416_2747 387
466 3300048913 Ga0496110_0051118 Ga0496110_0051118_2280_3611 387
467 3300048914 Ga0496111_0032928 Ga0496111_0032928_1705_3036 387
468 3300048915 Ga0496112_0073108 Ga0496112_0073108_411_1742 387
469 3300049568 Ga0501031_0006759 Ga0501031_0006759_3443_4834 387
470 3300049581 Ga0501047_0020124 Ga0501047_0020124_490_1881 387
471 3300049586 Ga0501070_0032213 Ga0501070_0032213_125_1516 387
472 3300049822 Ga0501035_0066636 Ga0501035_0066636_139_1530 387
473 3300050513 nmdc:mga0rr50_141071_c1 nmdc:mga0rr50_141071_c1_275_1606 387
474 3300053085 Ga0495619_0000337 Ga0495619_0000337_20122_21453 387

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

72

418

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dwi-assembly1.cif.gz_A molecular mechanism of sialic acid transport mediated by sialin 0.8135 17 374
7yub-assembly1.cif.gz_R s1p-bound human spns2 0.7983 16 374
8hpk-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form 0.7929 16 377
7yuf-assembly1.cif.gz_R apo human spns2 0.7865 17 374
6e9n-assembly2.cif.gz_B e. coli d-galactonate:proton symporter in the inward open form 0.7861 18 377
ID Description Score Start End Superfamily
af_Q5NC32_11_193_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9202 18 200 1.20.1250.20
af_F1QW16_40_223_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9172 18 201 1.20.1250.20
af_F1QY19_12_199_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.914 18 205 1.20.1250.20
af_Q9VWJ1_16_227_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9099 19 199 1.20.1250.20
af_A0A1L1SUI3_3_201_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9088 19 200 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A136QAF0-F1-model_v4 deleted 0.9338 18 242
AF-A0A2D6SHZ8-F1-model_v4 MFS transporter 0.9247 18 194 GO:0016020
GO:0022857
AF-A0A136QAF0-F1-model_v4 deleted 0.8875 18 242
AF-A0A4Q3CV13-F1-model_v4 MFS transporter 0.8778 21 255 GO:0016020
GO:0022857
AF-A0A353DBH9-F1-model_v4 MFS transporter 0.8766 18 202 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
79.98 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map