F451149

General Info

Members Datasets Scaffolds Average Seq Length
474 205 948 323

Family's Representative Sequence

Representative Sequence 3300005545|Ga0070695_100000473|Ga0070695_10000047312
Length 343
Sequence VSQLFPVVMLTHADTLTAMDEALQQAVLWREVGRRVAVATVVATRRSAPRPVGSKLVVAESGELAGSVSGGCVESDVVLAAQEVLAGGPPRLLTYGITDEMAFGIGLPCGGEIDVFVEELTEAERPEVTLTVVAGEGVGERLHDSELEQSARRRGLSHVIELEDRTVLADVSAPPPRLFVYGAVDTAEALCRAAKLLGWRTVVADARGSFATPERIPSADELLLLWPDEALAHVQPDLGTAVIVLTHDDKFDLPLIRGALAGDAFYIGWIGSRRNQERRRGLLREEGLTDDELDRISGPSGLDIGAGTPSETAVSILGEILAVRAGRTGGRLKDAKTRIHAPL

Samples

Sample ID Description Type Environment
1 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
98 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
101 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
137 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
146 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
162 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
204 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 7.59
Rhizosphere 91.98
Stem 0
Stem Tuber 0
Unclassified 2.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070695_100000473 3300005545 Bacteria 20860
2 Ga0070658_10074484 3300005327 Bacteria 2784
3 Ga0070683_100002828 3300005329 Bacteria 13892
4 Ga0070683_100025640 3300005329 Bacteria 5297
5 Ga0070683_100245687 3300005329 Bacteria 1702
6 Ga0068869_100048003 3300005334 Bacteria 3085
7 Ga0070682_100108639 3300005337 Bacteria 1845
8 Ga0068868_100002705 3300005338 Bacteria 12301
9 Ga0068868_100060100 3300005338 Bacteria 3008
10 Ga0070660_100008364 3300005339 Bacteria 7234
11 Ga0070660_100247484 3300005339 Bacteria 1453
12 Ga0070671_100044120 3300005355 Bacteria 3705
13 Ga0070671_100158140 3300005355 Bacteria 1915
14 Ga0070659_100014891 3300005366 Bacteria 5816
15 Ga0070709_10025558 3300005434 Bacteria 3490
16 Ga0070714_100018735 3300005435 Bacteria 5631
17 Ga0070714_100021378 3300005435 Bacteria 5295
18 Ga0070714_100027937 3300005435 Bacteria 4676
19 Ga0070714_100051045 3300005435 Bacteria 3526
20 Ga0070714_100123035 3300005435 Bacteria 2310
21 Ga0070714_100320309 3300005435 Bacteria 1450
22 Ga0070714_100322586 3300005435 Bacteria 1445
23 Ga0070713_100033053 3300005436 Bacteria 4140
24 Ga0070710_10000749 3300005437 Bacteria 15464
25 Ga0070710_10032136 3300005437 Bacteria 2840
26 Ga0070710_10169160 3300005437 Unclassified 1361
27 Ga0070711_100092753 3300005439 Bacteria 2180
28 Ga0070708_100391145 3300005445 Unclassified 1311
29 Ga0070678_100116553 3300005456 Bacteria 2099
30 Ga0070681_10038876 3300005458 Bacteria 4770
31 Ga0070681_10073993 3300005458 Bacteria 3368
32 Ga0070681_10101434 3300005458 Bacteria 2823
33 Ga0070681_10306765 3300005458 Bacteria 1497
34 Ga0070706_100207877 3300005467 Bacteria 1828
35 Ga0070707_100001390 3300005468 Bacteria 23809
36 Ga0070707_100052248 3300005468 Bacteria 3918
37 Ga0070679_100075956 3300005530 Bacteria 3349
38 Ga0070679_100103480 3300005530 Bacteria 2833
39 Ga0070684_100008701 3300005535 Bacteria 7957
40 Ga0070686_100085349 3300005544 Bacteria 2100
41 Ga0068855_100025514 3300005563 Bacteria 7070
42 Ga0068855_100050771 3300005563 Bacteria 4886
43 Ga0068854_100326721 3300005578 Bacteria 1248
44 Ga0068856_100015933 3300005614 Bacteria 7267
45 Ga0068856_100218579 3300005614 Bacteria 1921
46 Ga0068856_100354075 3300005614 Bacteria 1487
47 Ga0068852_100144705 3300005616 Unclassified 2204
48 Ga0068852_100438679 3300005616 Bacteria 1291
49 Ga0068858_100030172 3300005842 Bacteria 5036
50 Ga0070717_10004911 3300006028 Bacteria 9726
51 Ga0070717_10021542 3300006028 Bacteria 5080
52 Ga0070717_10087460 3300006028 Bacteria 2624
53 Ga0070717_10106418 3300006028 Bacteria 2388
54 Ga0070715_10001093 3300006163 Bacteria 7687
55 Ga0070716_100050176 3300006173 Bacteria 2367
56 Ga0070716_100073517 3300006173 Bacteria 2017
57 Ga0070716_100187776 3300006173 Bacteria 1363
58 Ga0070712_100170221 3300006175 Bacteria 1689
59 Ga0097621_100196167 3300006237 Bacteria 1750
60 Ga0097621_100263676 3300006237 Bacteria 1512
61 Ga0068871_100590779 3300006358 Bacteria 1009
62 Ga0075433_10178567 3300006852 Bacteria 1889
63 Ga0075434_100006835 3300006871 Bacteria 10500
64 Ga0075434_100009588 3300006871 Bacteria 9039
65 Ga0068865_100070097 3300006881 Bacteria 2483
66 Ga0075436_100374361 3300006914 Bacteria 1029
67 Ga0075435_100000638 3300007076 Bacteria 21553
68 Ga0075435_100126599 3300007076 Bacteria 2135
69 Ga0105240_10011632 3300009093 Bacteria 12237
70 Ga0105240_10155851 3300009093 Bacteria 2716
71 Ga0111539_10027558 3300009094 Bacteria 6940
72 Ga0111539_10132141 3300009094 Bacteria 2923
73 Ga0105245_10035413 3300009098 Bacteria 4430
74 Ga0105245_10207287 3300009098 Bacteria 1885
75 Ga0105247_10014238 3300009101 Bacteria 4773
76 Ga0105243_10112239 3300009148 Bacteria 2283
77 Ga0105241_10153836 3300009174 Bacteria 1884
78 Ga0105248_10026521 3300009177 Bacteria 6446
79 Ga0105248_10445359 3300009177 Bacteria 1459
80 Ga0105237_10216654 3300009545 Bacteria 1914
81 Ga0105238_10029554 3300009551 Bacteria 5583
82 Ga0105238_10458543 3300009551 Bacteria 1272
83 Ga0105239_10063332 3300010375 Bacteria 4060
84 Ga0105239_10458817 3300010375 Bacteria 1446
85 Ga0105246_10065202 3300011119 Bacteria 2546
86 Ga0157369_10023518 3300013105 Bacteria 6863
87 Ga0157369_10102991 3300013105 Bacteria 3040
88 Ga0157369_10365223 3300013105 Bacteria 1498
89 Ga0157374_10027776 3300013296 Bacteria 5109
90 Ga0163162_10184153 3300013306 Bacteria 2215
91 Ga0157372_10004242 3300013307 Bacteria 15325
92 Ga0157372_10028264 3300013307 Bacteria 6120
93 Ga0157372_10248229 3300013307 Bacteria 2066
94 Ga0157375_10134098 3300013308 Bacteria 2598
95 Ga0182008_10026609 3300014497 Bacteria 2933
96 Ga0157377_10010816 3300014745 Bacteria 4530
97 Ga0157379_10325847 3300014968 Bacteria 1403
98 Ga0157376_10375974 3300014969 Bacteria 1367
99 Ga0206356_10967524 3300020070 Bacteria 3502
100 Ga0206353_10599600 3300020082 Bacteria 4061
101 Ga0207692_10050019 3300025898 Bacteria 2111
102 Ga0207692_10068970 3300025898 Bacteria 1856
103 Ga0207688_10005463 3300025901 Bacteria 6909
104 Ga0207699_10001898 3300025906 Bacteria 9840
105 Ga0207699_10052688 3300025906 Bacteria 2410
106 Ga0207705_10045086 3300025909 Bacteria 3169
107 Ga0207684_10057069 3300025910 Bacteria 3313
108 Ga0207654_10258535 3300025911 Bacteria 1170
109 Ga0207707_10030989 3300025912 Bacteria 4678
110 Ga0207707_10091127 3300025912 Bacteria 2664
111 Ga0207707_10169463 3300025912 Bacteria 1908
112 Ga0207695_10013024 3300025913 Bacteria 9935
113 Ga0207695_10203209 3300025913 Bacteria 1895
114 Ga0207671_10110940 3300025914 Bacteria 2087
115 Ga0207693_10004412 3300025915 Bacteria 11894
116 Ga0207693_10151380 3300025915 Bacteria 1825
117 Ga0207663_10039777 3300025916 Bacteria 2852
118 Ga0207660_10157441 3300025917 Bacteria 1750
119 Ga0207660_10304741 3300025917 Bacteria 1269
120 Ga0207657_10001500 3300025919 Bacteria 24976
121 Ga0207657_10008387 3300025919 Bacteria 10491
122 Ga0207657_10035104 3300025919 Bacteria 4501
123 Ga0207657_10048086 3300025919 Bacteria 3725
124 Ga0207649_10190677 3300025920 Bacteria 1441
125 Ga0207652_10220412 3300025921 Bacteria 1709
126 Ga0207652_10264171 3300025921 Bacteria 1552
127 Ga0207646_10001697 3300025922 Bacteria 26787
128 Ga0207646_10072212 3300025922 Bacteria 3083
129 Ga0207687_10001441 3300025927 Bacteria 16269
130 Ga0207700_10084494 3300025928 Bacteria 2488
131 Ga0207700_10252796 3300025928 Bacteria 1506
132 Ga0207700_10307063 3300025928 Bacteria 1371
133 Ga0207664_10005211 3300025929 Bacteria 8864
134 Ga0207664_10006342 3300025929 Bacteria 8126
135 Ga0207664_10039460 3300025929 Bacteria 3666
136 Ga0207664_10056848 3300025929 Bacteria 3108
137 Ga0207664_10067111 3300025929 Bacteria 2877
138 Ga0207664_10079973 3300025929 Bacteria 2655
139 Ga0207664_10096020 3300025929 Bacteria 2439
140 Ga0207664_10186919 3300025929 Bacteria 1782
141 Ga0207664_10224235 3300025929 Unclassified 1631
142 Ga0207690_10006970 3300025932 Bacteria 6699
143 Ga0207690_10340506 3300025932 Bacteria 1183
144 Ga0207709_10339642 3300025935 Bacteria 1130
145 Ga0207665_10034469 3300025939 Bacteria 3358
146 Ga0207665_10094503 3300025939 Bacteria 2077
147 Ga0207665_10099991 3300025939 Bacteria 2023
148 Ga0207711_10071968 3300025941 Bacteria 3002
149 Ga0207689_10043871 3300025942 Bacteria 3697
150 Ga0207661_10012797 3300025944 Bacteria 6112
151 Ga0207661_10077521 3300025944 Bacteria 2733
152 Ga0207667_10012444 3300025949 Bacteria 9804
153 Ga0207640_10083355 3300025981 Bacteria 2192
154 Ga0207677_10005694 3300026023 Bacteria 6777
155 Ga0207708_10075145 3300026075 Bacteria 2590
156 Ga0207674_10395434 3300026116 Bacteria 1336
157 Ga0207683_10010391 3300026121 Bacteria 7939
158 Ga0207683_10145351 3300026121 Bacteria 2138
159 Ga0207698_10144044 3300026142 Bacteria 2058
160 Ga0207428_10169350 3300027907 Bacteria 1655
161 Ga0265323_10057037 3300028653 Bacteria 1368
162 Ga0265338_10000634 3300028800 Bacteria 60990
163 Ga0265338_10003841 3300028800 Bacteria 20854
164 Ga0265338_10009445 3300028800 Bacteria 11623
165 Ga0265313_10071870 3300031595 Bacteria 1591
166 Ga0373944_0014418 3300035089 Bacteria 2206
167 Ga0373923_0036103 3300035111 Bacteria 2016
168 Ga0373936_0050387 3300035113 Bacteria 1684
169 Ga0373936_0089784 3300035113 Bacteria 1287
170 Ga0373953_0034863 3300035117 Bacteria 1975
171 Ga0373956_0032830 3300035119 Bacteria 2280
172 Ga0373943_0002749 3300035170 Bacteria 8008
173 Ga0373943_0126264 3300035170 Bacteria 1364
174 Ga0373946_0017477 3300035171 Bacteria 2744
175 Ga0373955_0080316 3300035172 Bacteria 1842
176 Ga0373924_0043909 3300035410 Bacteria 1837
177 Ga0373927_0027693 3300035695 Bacteria 3700
178 Ga0373947_0013415 3300035725 Bacteria 4694
179 Ga0373937_0000749 3300036401 Bacteria 28028
180 Ga0373937_0015175 3300036401 Bacteria 6807
181 Ga0373925_0108268 3300037068 Bacteria 2144
182 Ga0395900_0705946 3300037418 Bacteria 942
183 Ga0395898_0016479 3300037466 Bacteria 7559
184 Ga0395905_0243994 3300037471 Bacteria 1678
185 Ga0395901_0018271 3300038443 Bacteria 7159
186 Ga0436363_1197225 3300039450 Bacteria 1528
187 Ga0466969_0009696 3300044656 Bacteria 5105
188 Ga0466966_0011285 3300044684 Bacteria 5929
189 Ga0466966_0039274 3300044684 Bacteria 3049
190 Ga0466961_0048295 3300044693 Bacteria 2720
191 Ga0466961_0089184 3300044693 Bacteria 1948
192 Ga0466961_0134655 3300044693 Bacteria 1548
193 Ga0466963_0000509 3300044694 Bacteria 18145
194 Ga0466963_0001597 3300044694 Bacteria 12314
195 Ga0466963_0002118 3300044694 Bacteria 10974
196 Ga0466963_0002515 3300044694 Bacteria 10261
197 Ga0466963_0002832 3300044694 Bacteria 9778
198 Ga0466963_0003519 3300044694 Bacteria 8990
199 Ga0466963_0006150 3300044694 Bacteria 7085
200 Ga0466963_0008397 3300044694 Bacteria 6187
201 Ga0466963_0011746 3300044694 Bacteria 5339
202 Ga0466963_0016609 3300044694 Bacteria 4580
203 Ga0466963_0038812 3300044694 Bacteria 3116
204 Ga0466963_0060453 3300044694 Bacteria 2530
205 Ga0466963_0069365 3300044694 Bacteria 2369
206 Ga0466963_0079581 3300044694 Bacteria 2217
207 Ga0466963_0086371 3300044694 Bacteria 2131
208 Ga0466963_0133620 3300044694 Bacteria 1715
209 Ga0466963_0172117 3300044694 Bacteria 1510
210 Ga0466964_0000410 3300044706 Bacteria 12964
211 Ga0466964_0005945 3300044706 Bacteria 4545
212 Ga0466964_0029283 3300044706 Bacteria 2173
213 Ga0466964_0109264 3300044706 Bacteria 1231
214 Ga0466971_0000934 3300044719 Bacteria 11989
215 Ga0466971_0048181 3300044719 Bacteria 1916
216 Ga0466968_0007968 3300044735 Bacteria 4046
217 Ga0466968_0009625 3300044735 Bacteria 3721
218 Ga0466968_0025286 3300044735 Bacteria 2431
219 Ga0466968_0131509 3300044735 Bacteria 1139
220 Ga0466970_0047079 3300044765 Bacteria 2297
221 Ga0466970_0093465 3300044765 Bacteria 1634
222 Ga0466970_0160624 3300044765 Bacteria 1243
223 Ga0466957_0000407 3300044842 Bacteria 21025
224 Ga0466957_0015410 3300044842 Bacteria 4466
225 Ga0466957_0019958 3300044842 Bacteria 3943
226 Ga0466957_0037146 3300044842 Bacteria 2932
227 Ga0466957_0058954 3300044842 Bacteria 2352
228 Ga0466957_0094781 3300044842 Bacteria 1874
229 Ga0466960_0010587 3300044901 Bacteria 3833
230 Ga0466960_0046358 3300044901 Bacteria 2081
231 Ga0466959_0000954 3300045049 Bacteria 17196
232 Ga0466959_0004817 3300045049 Bacteria 9115
233 Ga0466959_0004867 3300045049 Bacteria 9085
234 Ga0466959_0217639 3300045049 Unclassified 1325
235 Ga0466958_0001863 3300045836 Bacteria 10294
236 Ga0466958_0002628 3300045836 Bacteria 9087
237 Ga0466958_0005988 3300045836 Bacteria 6583
238 Ga0466958_0013151 3300045836 Bacteria 4706
239 Ga0466958_0015030 3300045836 Bacteria 4428
240 Ga0466958_0016791 3300045836 Bacteria 4221
241 Ga0466958_0018159 3300045836 Bacteria 4077
242 Ga0466958_0089866 3300045836 Bacteria 1899
243 Ga0466958_0232734 3300045836 Bacteria 1177
244 Ga0466967_0000297 3300045976 Bacteria 22234
245 Ga0466967_0005309 3300045976 Bacteria 8896
246 Ga0466967_0009346 3300045976 Bacteria 7267
247 Ga0466967_0010505 3300045976 Bacteria 6950
248 Ga0466967_0012741 3300045976 Bacteria 6455
249 Ga0466967_0013215 3300045976 Bacteria 6367
250 Ga0466967_0014505 3300045976 Bacteria 6141
251 Ga0466967_0078887 3300045976 Bacteria 2967
252 Ga0466967_0099103 3300045976 Bacteria 2661
253 Ga0466967_0100017 3300045976 Bacteria 2649
254 Ga0466967_0135888 3300045976 Bacteria 2286
255 Ga0466967_0152368 3300045976 Bacteria 2162
256 Ga0466967_0154430 3300045976 Bacteria 2148
257 Ga0466967_0170510 3300045976 Bacteria 2047
258 Ga0466967_0213503 3300045976 Bacteria 1831
259 Ga0466967_0224722 3300045976 Bacteria 1785
260 Ga0466967_0227298 3300045976 Bacteria 1775
261 Ga0466967_0238330 3300045976 Bacteria 1734
262 Ga0495592_0000728 3300046454 Bacteria 23022
263 Ga0495592_0004738 3300046454 Bacteria 9983
264 Ga0495592_0042525 3300046454 Bacteria 3402
265 Ga0495592_0200695 3300046454 Bacteria 1346
266 Ga0495603_0009878 3300046455 Bacteria 5776
267 Ga0495603_0217824 3300046455 Unclassified 1102
268 Ga0495629_0023322 3300046459 Bacteria 4410
269 Ga0495629_0047954 3300046459 Bacteria 2995
270 Ga0495629_0091876 3300046459 Bacteria 2118
271 Ga0495629_0121653 3300046459 Unclassified 1818
272 Ga0495641_0012232 3300046461 Bacteria 4816
273 Ga0495641_0026781 3300046461 Bacteria 2810
274 Ga0495641_0030688 3300046461 Bacteria 2574
275 Ga0495651_0000699 3300046462 Bacteria 26062
276 Ga0495651_0044646 3300046462 Bacteria 3434
277 Ga0495651_0080924 3300046462 Bacteria 2453
278 Ga0495651_0211225 3300046462 Bacteria 1350
279 Ga0495653_0001005 3300046463 Bacteria 21756
280 Ga0495653_0003907 3300046463 Bacteria 12046
281 Ga0495653_0020859 3300046463 Bacteria 5308
282 Ga0495653_0070529 3300046463 Bacteria 2615
283 Ga0495653_0139579 3300046463 Bacteria 1706
284 Ga0495653_0145955 3300046463 Bacteria 1658
285 Ga0495580_0034887 3300046472 Bacteria 3619
286 Ga0495580_0039038 3300046472 Bacteria 3397
287 Ga0495580_0161196 3300046472 Bacteria 1552
288 Ga0495582_0036284 3300046473 Bacteria 2712
289 Ga0495582_0037977 3300046473 Bacteria 2649
290 Ga0495582_0078936 3300046473 Bacteria 1827
291 Ga0495639_0004120 3300046475 Bacteria 6230
292 Ga0495662_0001154 3300046476 Bacteria 13002
293 Ga0495662_0009125 3300046476 Bacteria 4867
294 Ga0495662_0020845 3300046476 Bacteria 3170
295 Ga0495664_0002268 3300046477 Bacteria 10310
296 Ga0495664_0003678 3300046477 Bacteria 8360
297 Ga0495585_0045453 3300046492 Bacteria 2451
298 Ga0495594_0013265 3300046499 Bacteria 4300
299 Ga0495608_0005259 3300046511 Bacteria 9248
300 Ga0495608_0023808 3300046511 Bacteria 4191
301 Ga0495608_0077780 3300046511 Bacteria 2159
302 Ga0495618_0000821 3300046514 Bacteria 21621
303 Ga0495618_0007687 3300046514 Bacteria 6518
304 Ga0495618_0042278 3300046514 Bacteria 2872
305 Ga0495618_0164225 3300046514 Bacteria 1414
306 Ga0495628_0001050 3300046516 Bacteria 25288
307 Ga0495628_0084666 3300046516 Bacteria 2460
308 Ga0495628_0102528 3300046516 Bacteria 2207
309 Ga0495630_0015918 3300046517 Bacteria 5497
310 Ga0495630_0026091 3300046517 Bacteria 4324
311 Ga0495630_0053526 3300046517 Bacteria 3022
312 Ga0495630_0060603 3300046517 Bacteria 2841
313 Ga0495630_0136113 3300046517 Bacteria 1866
314 Ga0495630_0164057 3300046517 Bacteria 1691
315 Ga0495644_0063915 3300046523 Bacteria 1383
316 Ga0495666_0002626 3300046526 Bacteria 8945
317 Ga0495666_0004962 3300046526 Bacteria 6735
318 Ga0495652_0000187 3300046529 Bacteria 70410
319 Ga0495652_0069181 3300046529 Bacteria 2955
320 Ga0495652_0306288 3300046529 Bacteria 1153
321 Ga0495665_0000405 3300046531 Bacteria 21950
322 Ga0495665_0054699 3300046531 Bacteria 2108
323 Ga0495640_0024398 3300046533 Bacteria 4399
324 Ga0495640_0078185 3300046533 Bacteria 2204
325 Ga0495640_0094950 3300046533 Bacteria 1963
326 Ga0495640_0139456 3300046533 Bacteria 1564
327 Ga0495640_0231360 3300046533 Bacteria 1162
328 Ga0495586_0016992 3300046535 Bacteria 3870
329 Ga0495586_0116801 3300046535 Bacteria 1488
330 Ga0495587_0000467 3300046536 Bacteria 28207
331 Ga0495587_0098839 3300046536 Bacteria 1682
332 Ga0495645_0000700 3300046543 Bacteria 22971
333 Ga0495645_0017353 3300046543 Bacteria 5156
334 Ga0495645_0064892 3300046543 Bacteria 2641
335 Ga0495645_0206619 3300046543 Bacteria 1328
336 Ga0495667_0021720 3300046559 Bacteria 4331
337 Ga0495667_0095360 3300046559 Bacteria 1926
338 Ga0495667_0135165 3300046559 Unclassified 1590
339 Ga0495667_0157032 3300046559 Bacteria 1463
340 Ga0495656_0002093 3300046615 Bacteria 6589
341 Ga0495634_0057900 3300046642 Bacteria 2585
342 Ga0495634_0070838 3300046642 Bacteria 2297
343 Ga0495634_0125287 3300046642 Bacteria 1642
344 Ga0495635_0008970 3300046663 Bacteria 6982
345 Ga0495635_0088678 3300046663 Bacteria 2116
346 Ga0495661_0108355 3300046665 Bacteria 1552
347 Ga0495657_0002882 3300046675 Bacteria 14276
348 Ga0495657_0007202 3300046675 Bacteria 8625
349 Ga0495657_0257379 3300046675 Bacteria 1049
350 Ga0495599_0000333 3300046678 Bacteria 28098
351 Ga0495599_0010821 3300046678 Bacteria 5592
352 Ga0495599_0122220 3300046678 Bacteria 1618
353 Ga0495623_0000045 3300046679 Bacteria 76108
354 Ga0495623_0080327 3300046679 Bacteria 2019
355 Ga0495623_0112238 3300046679 Bacteria 1651
356 Ga0495646_0001574 3300046680 Bacteria 13601
357 Ga0495646_0094012 3300046680 Bacteria 1727
358 Ga0495647_0013452 3300046681 Bacteria 2835
359 Ga0495647_0017771 3300046681 Bacteria 2521
360 Ga0495647_0023463 3300046681 Bacteria 2237
361 Ga0495658_0014768 3300046683 Bacteria 3994
362 Ga0495658_0099920 3300046683 Unclassified 1730
363 Ga0495658_0100900 3300046683 Bacteria 1723
364 Ga0495658_0174016 3300046683 Bacteria 1333
365 Ga0495658_0202675 3300046683 Unclassified 1237
366 Ga0495613_0010049 3300046689 Bacteria 7030
367 Ga0495613_0062957 3300046689 Bacteria 2714
368 Ga0495613_0081687 3300046689 Bacteria 2347
369 Ga0495613_0241376 3300046689 Bacteria 1263
370 Ga0495624_0003744 3300046690 Bacteria 11238
371 Ga0495624_0014145 3300046690 Bacteria 5423
372 Ga0495624_0098323 3300046690 Bacteria 1802
373 Ga0495624_0266645 3300046690 Bacteria 1034
374 Ga0495600_0003464 3300046809 Bacteria 9282
375 Ga0495600_0042097 3300046809 Bacteria 2977
376 Ga0495600_0123316 3300046809 Bacteria 1685
377 Ga0495581_0005247 3300047315 Bacteria 7495
378 Ga0495581_0026778 3300047315 Bacteria 3342
379 Ga0495581_0032532 3300047315 Bacteria 3020
380 Ga0495581_0040671 3300047315 Bacteria 2689
381 Ga0495604_0000221 3300047317 Bacteria 52090
382 Ga0495674_0016676 3300047319 Bacteria 6853
383 Ga0495674_0026366 3300047319 Bacteria 5317
384 Ga0495674_0067286 3300047319 Bacteria 3104
385 Ga0495674_0076921 3300047319 Bacteria 2870
386 Ga0495674_0142095 3300047319 Bacteria 2017
387 Ga0495676_0018992 3300047321 Bacteria 6053
388 Ga0495676_0175670 3300047321 Bacteria 1504
389 Ga0495676_0175950 3300047321 Bacteria 1503
390 Ga0495676_0260771 3300047321 Bacteria 1179
391 Ga0495680_0007245 3300047322 Bacteria 10217
392 Ga0495680_0029574 3300047322 Bacteria 4486
393 Ga0495680_0035189 3300047322 Bacteria 4035
394 Ga0495680_0137982 3300047322 Bacteria 1786
395 Ga0495680_0322829 3300047322 Bacteria 1080
396 Ga0495675_0000301 3300047444 Bacteria 35499
397 Ga0495675_0117367 3300047444 Bacteria 1659
398 Ga0495684_0002557 3300047471 Bacteria 14477
399 Ga0495684_0012054 3300047471 Bacteria 6667
400 Ga0495684_0052286 3300047471 Bacteria 3117
401 Ga0495593_0014070 3300047673 Bacteria 4553
402 Ga0495602_0000515 3300048088 Bacteria 36065
403 Ga0495602_0044533 3300048088 Bacteria 4024
404 Ga0495602_0106805 3300048088 Bacteria 2284
405 Ga0495614_0005381 3300048089 Bacteria 5775
406 Ga0495614_0009448 3300048089 Bacteria 4311
407 Ga0496100_0005026 3300048903 Bacteria 7077
408 Ga0496100_0050436 3300048903 Bacteria 2696
409 Ga0496101_0041466 3300048904 Bacteria 3282
410 Ga0496101_0044394 3300048904 Bacteria 3180
411 Ga0496101_0067865 3300048904 Bacteria 2605
412 Ga0496101_0163803 3300048904 Bacteria 1706
413 Ga0496102_0102833 3300048905 Bacteria 2656
414 Ga0496102_0167455 3300048905 Bacteria 2068
415 Ga0496103_0168618 3300048906 Bacteria 1405
416 Ga0496104_0001804 3300048907 Bacteria 18557
417 Ga0496104_0018020 3300048907 Bacteria 6438
418 Ga0496104_0106596 3300048907 Bacteria 2685
419 Ga0496105_0064569 3300048908 Bacteria 3020
420 Ga0496105_0091323 3300048908 Bacteria 2514
421 Ga0496106_0008135 3300048909 Bacteria 7745
422 Ga0496107_0035929 3300048910 Bacteria 3553
423 Ga0496107_0036744 3300048910 Bacteria 3513
424 Ga0496107_0087462 3300048910 Bacteria 2275
425 Ga0496108_0038344 3300048911 Bacteria 3991
426 Ga0496108_0063998 3300048911 Bacteria 3097
427 Ga0496108_0169715 3300048911 Bacteria 1887
428 Ga0496109_0006259 3300048912 Bacteria 10010
429 Ga0496109_0021836 3300048912 Bacteria 5665
430 Ga0496109_0054836 3300048912 Bacteria 3635
431 Ga0496109_0145867 3300048912 Bacteria 2214
432 Ga0496110_0432212 3300048913 Bacteria 1200
433 Ga0496111_0001118 3300048914 Bacteria 14861
434 Ga0496112_0005722 3300048915 Bacteria 10802
435 Ga0496112_0509774 3300048915 Unclassified 1138
436 Ga0496114_0000875 3300048917 Bacteria 22544
437 Ga0496114_0028305 3300048917 Bacteria 4597
438 Ga0496114_0396461 3300048917 Bacteria 1222
439 Ga0496115_0003970 3300048918 Bacteria 10672
440 Ga0496115_0029540 3300048918 Bacteria 4305
441 Ga0496115_0053091 3300048918 Bacteria 3252
442 Ga0496115_0060972 3300048918 Bacteria 3040
443 Ga0501067_0012836 3300049583 Bacteria 4639
444 Ga0501067_0023474 3300049583 Bacteria 3419
445 Ga0501067_0065015 3300049583 Bacteria 2019
446 Ga0501069_0026095 3300049585 Bacteria 3198
447 Ga0501069_0175246 3300049585 Bacteria 1238
448 nmdc:mga05p37_66000_c1 3300050507 Bacteria 4452
449 nmdc:mga08y16_110353_c1 3300050511 Bacteria 2864
450 nmdc:mga0n895_2163_c1 3300050512 Bacteria 15185
451 nmdc:mga0n895_846_c1 3300050512 Bacteria 21994
452 nmdc:mga0rr50_4981_c1 3300050513 Bacteria 7868
453 nmdc:mga0a205_208882_c1 3300050515 Bacteria 1841
454 Ga0495601_0000835 3300053077 Bacteria 16726
455 Ga0495601_0003505 3300053077 Bacteria 9010
456 Ga0495601_0004502 3300053077 Bacteria 8055
457 Ga0495601_0007124 3300053077 Bacteria 6552
458 Ga0495601_0027795 3300053077 Bacteria 3499
459 Ga0495612_0013141 3300053078 Bacteria 3333
460 Ga0495612_0014967 3300053078 Bacteria 3111
461 Ga0495612_0061706 3300053078 Bacteria 1553
462 Ga0495595_0020015 3300053084 Bacteria 2909
463 Ga0495595_0028351 3300053084 Bacteria 2500
464 Ga0495619_0008401 3300053085 Bacteria 6530
465 Ga0495619_0053200 3300053085 Bacteria 2677
466 Ga0495619_0070495 3300053085 Bacteria 2337
467 Ga0495619_0070560 3300053085 Bacteria 2336
468 Ga0495619_0094878 3300053085 Bacteria 2024
469 Ga0500566_0022821 3300053094 Bacteria 3675
470 Ga0466962_0001729 3300061719 Bacteria 10265
471 Ga0466962_0007815 3300061719 Bacteria 5126
472 Ga0466962_0018277 3300061719 Bacteria 3372
473 Ga0466962_0068804 3300061719 Bacteria 1691
474 Ga0530510_0101770 3300061734 Bacteria 2101
475 Ga0070695_100000473
476 Ga0070658_10074484
477 Ga0070683_100002828
478 Ga0070683_100025640
479 Ga0070683_100245687
480 Ga0068869_100048003
481 Ga0070682_100108639
482 Ga0068868_100002705
483 Ga0068868_100060100
484 Ga0070660_100008364
485 Ga0070660_100247484
486 Ga0070671_100044120
487 Ga0070671_100158140
488 Ga0070659_100014891
489 Ga0070709_10025558
490 Ga0070714_100018735
491 Ga0070714_100021378
492 Ga0070714_100027937
493 Ga0070714_100051045
494 Ga0070714_100123035
495 Ga0070714_100320309
496 Ga0070714_100322586
497 Ga0070713_100033053
498 Ga0070710_10000749
499 Ga0070710_10032136
500 Ga0070710_10169160
501 Ga0070711_100092753
502 Ga0070708_100391145
503 Ga0070678_100116553
504 Ga0070681_10038876
505 Ga0070681_10073993
506 Ga0070681_10101434
507 Ga0070681_10306765
508 Ga0070706_100207877
509 Ga0070707_100001390
510 Ga0070707_100052248
511 Ga0070679_100075956
512 Ga0070679_100103480
513 Ga0070684_100008701
514 Ga0070686_100085349
515 Ga0068855_100025514
516 Ga0068855_100050771
517 Ga0068854_100326721
518 Ga0068856_100015933
519 Ga0068856_100218579
520 Ga0068856_100354075
521 Ga0068852_100144705
522 Ga0068852_100438679
523 Ga0068858_100030172
524 Ga0070717_10004911
525 Ga0070717_10021542
526 Ga0070717_10087460
527 Ga0070717_10106418
528 Ga0070715_10001093
529 Ga0070716_100050176
530 Ga0070716_100073517
531 Ga0070716_100187776
532 Ga0070712_100170221
533 Ga0097621_100196167
534 Ga0097621_100263676
535 Ga0068871_100590779
536 Ga0075433_10178567
537 Ga0075434_100006835
538 Ga0075434_100009588
539 Ga0068865_100070097
540 Ga0075436_100374361
541 Ga0075435_100000638
542 Ga0075435_100126599
543 Ga0105240_10011632
544 Ga0105240_10155851
545 Ga0111539_10027558
546 Ga0111539_10132141
547 Ga0105245_10035413
548 Ga0105245_10207287
549 Ga0105247_10014238
550 Ga0105243_10112239
551 Ga0105241_10153836
552 Ga0105248_10026521
553 Ga0105248_10445359
554 Ga0105237_10216654
555 Ga0105238_10029554
556 Ga0105238_10458543
557 Ga0105239_10063332
558 Ga0105239_10458817
559 Ga0105246_10065202
560 Ga0157369_10023518
561 Ga0157369_10102991
562 Ga0157369_10365223
563 Ga0157374_10027776
564 Ga0163162_10184153
565 Ga0157372_10004242
566 Ga0157372_10028264
567 Ga0157372_10248229
568 Ga0157375_10134098
569 Ga0182008_10026609
570 Ga0157377_10010816
571 Ga0157379_10325847
572 Ga0157376_10375974
573 Ga0206356_10967524
574 Ga0206353_10599600
575 Ga0207692_10050019
576 Ga0207692_10068970
577 Ga0207688_10005463
578 Ga0207699_10001898
579 Ga0207699_10052688
580 Ga0207705_10045086
581 Ga0207684_10057069
582 Ga0207654_10258535
583 Ga0207707_10030989
584 Ga0207707_10091127
585 Ga0207707_10169463
586 Ga0207695_10013024
587 Ga0207695_10203209
588 Ga0207671_10110940
589 Ga0207693_10004412
590 Ga0207693_10151380
591 Ga0207663_10039777
592 Ga0207660_10157441
593 Ga0207660_10304741
594 Ga0207657_10001500
595 Ga0207657_10008387
596 Ga0207657_10035104
597 Ga0207657_10048086
598 Ga0207649_10190677
599 Ga0207652_10220412
600 Ga0207652_10264171
601 Ga0207646_10001697
602 Ga0207646_10072212
603 Ga0207687_10001441
604 Ga0207700_10084494
605 Ga0207700_10252796
606 Ga0207700_10307063
607 Ga0207664_10005211
608 Ga0207664_10006342
609 Ga0207664_10039460
610 Ga0207664_10056848
611 Ga0207664_10067111
612 Ga0207664_10079973
613 Ga0207664_10096020
614 Ga0207664_10186919
615 Ga0207664_10224235
616 Ga0207690_10006970
617 Ga0207690_10340506
618 Ga0207709_10339642
619 Ga0207665_10034469
620 Ga0207665_10094503
621 Ga0207665_10099991
622 Ga0207711_10071968
623 Ga0207689_10043871
624 Ga0207661_10012797
625 Ga0207661_10077521
626 Ga0207667_10012444
627 Ga0207640_10083355
628 Ga0207677_10005694
629 Ga0207708_10075145
630 Ga0207674_10395434
631 Ga0207683_10010391
632 Ga0207683_10145351
633 Ga0207698_10144044
634 Ga0207428_10169350
635 Ga0265323_10057037
636 Ga0265338_10000634
637 Ga0265338_10003841
638 Ga0265338_10009445
639 Ga0265313_10071870
640 Ga0373944_0014418
641 Ga0373923_0036103
642 Ga0373936_0050387
643 Ga0373936_0089784
644 Ga0373953_0034863
645 Ga0373956_0032830
646 Ga0373943_0002749
647 Ga0373943_0126264
648 Ga0373946_0017477
649 Ga0373955_0080316
650 Ga0373924_0043909
651 Ga0373927_0027693
652 Ga0373947_0013415
653 Ga0373937_0000749
654 Ga0373937_0015175
655 Ga0373925_0108268
656 Ga0395900_0705946
657 Ga0395898_0016479
658 Ga0395905_0243994
659 Ga0395901_0018271
660 Ga0436363_1197225
661 Ga0466969_0009696
662 Ga0466966_0011285
663 Ga0466966_0039274
664 Ga0466961_0048295
665 Ga0466961_0089184
666 Ga0466961_0134655
667 Ga0466963_0000509
668 Ga0466963_0001597
669 Ga0466963_0002118
670 Ga0466963_0002515
671 Ga0466963_0002832
672 Ga0466963_0003519
673 Ga0466963_0006150
674 Ga0466963_0008397
675 Ga0466963_0011746
676 Ga0466963_0016609
677 Ga0466963_0038812
678 Ga0466963_0060453
679 Ga0466963_0069365
680 Ga0466963_0079581
681 Ga0466963_0086371
682 Ga0466963_0133620
683 Ga0466963_0172117
684 Ga0466964_0000410
685 Ga0466964_0005945
686 Ga0466964_0029283
687 Ga0466964_0109264
688 Ga0466971_0000934
689 Ga0466971_0048181
690 Ga0466968_0007968
691 Ga0466968_0009625
692 Ga0466968_0025286
693 Ga0466968_0131509
694 Ga0466970_0047079
695 Ga0466970_0093465
696 Ga0466970_0160624
697 Ga0466957_0000407
698 Ga0466957_0015410
699 Ga0466957_0019958
700 Ga0466957_0037146
701 Ga0466957_0058954
702 Ga0466957_0094781
703 Ga0466960_0010587
704 Ga0466960_0046358
705 Ga0466959_0000954
706 Ga0466959_0004817
707 Ga0466959_0004867
708 Ga0466959_0217639
709 Ga0466958_0001863
710 Ga0466958_0002628
711 Ga0466958_0005988
712 Ga0466958_0013151
713 Ga0466958_0015030
714 Ga0466958_0016791
715 Ga0466958_0018159
716 Ga0466958_0089866
717 Ga0466958_0232734
718 Ga0466967_0000297
719 Ga0466967_0005309
720 Ga0466967_0009346
721 Ga0466967_0010505
722 Ga0466967_0012741
723 Ga0466967_0013215
724 Ga0466967_0014505
725 Ga0466967_0078887
726 Ga0466967_0099103
727 Ga0466967_0100017
728 Ga0466967_0135888
729 Ga0466967_0152368
730 Ga0466967_0154430
731 Ga0466967_0170510
732 Ga0466967_0213503
733 Ga0466967_0224722
734 Ga0466967_0227298
735 Ga0466967_0238330
736 Ga0495592_0000728
737 Ga0495592_0004738
738 Ga0495592_0042525
739 Ga0495592_0200695
740 Ga0495603_0009878
741 Ga0495603_0217824
742 Ga0495629_0023322
743 Ga0495629_0047954
744 Ga0495629_0091876
745 Ga0495629_0121653
746 Ga0495641_0012232
747 Ga0495641_0026781
748 Ga0495641_0030688
749 Ga0495651_0000699
750 Ga0495651_0044646
751 Ga0495651_0080924
752 Ga0495651_0211225
753 Ga0495653_0001005
754 Ga0495653_0003907
755 Ga0495653_0020859
756 Ga0495653_0070529
757 Ga0495653_0139579
758 Ga0495653_0145955
759 Ga0495580_0034887
760 Ga0495580_0039038
761 Ga0495580_0161196
762 Ga0495582_0036284
763 Ga0495582_0037977
764 Ga0495582_0078936
765 Ga0495639_0004120
766 Ga0495662_0001154
767 Ga0495662_0009125
768 Ga0495662_0020845
769 Ga0495664_0002268
770 Ga0495664_0003678
771 Ga0495585_0045453
772 Ga0495594_0013265
773 Ga0495608_0005259
774 Ga0495608_0023808
775 Ga0495608_0077780
776 Ga0495618_0000821
777 Ga0495618_0007687
778 Ga0495618_0042278
779 Ga0495618_0164225
780 Ga0495628_0001050
781 Ga0495628_0084666
782 Ga0495628_0102528
783 Ga0495630_0015918
784 Ga0495630_0026091
785 Ga0495630_0053526
786 Ga0495630_0060603
787 Ga0495630_0136113
788 Ga0495630_0164057
789 Ga0495644_0063915
790 Ga0495666_0002626
791 Ga0495666_0004962
792 Ga0495652_0000187
793 Ga0495652_0069181
794 Ga0495652_0306288
795 Ga0495665_0000405
796 Ga0495665_0054699
797 Ga0495640_0024398
798 Ga0495640_0078185
799 Ga0495640_0094950
800 Ga0495640_0139456
801 Ga0495640_0231360
802 Ga0495586_0016992
803 Ga0495586_0116801
804 Ga0495587_0000467
805 Ga0495587_0098839
806 Ga0495645_0000700
807 Ga0495645_0017353
808 Ga0495645_0064892
809 Ga0495645_0206619
810 Ga0495667_0021720
811 Ga0495667_0095360
812 Ga0495667_0135165
813 Ga0495667_0157032
814 Ga0495656_0002093
815 Ga0495634_0057900
816 Ga0495634_0070838
817 Ga0495634_0125287
818 Ga0495635_0008970
819 Ga0495635_0088678
820 Ga0495661_0108355
821 Ga0495657_0002882
822 Ga0495657_0007202
823 Ga0495657_0257379
824 Ga0495599_0000333
825 Ga0495599_0010821
826 Ga0495599_0122220
827 Ga0495623_0000045
828 Ga0495623_0080327
829 Ga0495623_0112238
830 Ga0495646_0001574
831 Ga0495646_0094012
832 Ga0495647_0013452
833 Ga0495647_0017771
834 Ga0495647_0023463
835 Ga0495658_0014768
836 Ga0495658_0099920
837 Ga0495658_0100900
838 Ga0495658_0174016
839 Ga0495658_0202675
840 Ga0495613_0010049
841 Ga0495613_0062957
842 Ga0495613_0081687
843 Ga0495613_0241376
844 Ga0495624_0003744
845 Ga0495624_0014145
846 Ga0495624_0098323
847 Ga0495624_0266645
848 Ga0495600_0003464
849 Ga0495600_0042097
850 Ga0495600_0123316
851 Ga0495581_0005247
852 Ga0495581_0026778
853 Ga0495581_0032532
854 Ga0495581_0040671
855 Ga0495604_0000221
856 Ga0495674_0016676
857 Ga0495674_0026366
858 Ga0495674_0067286
859 Ga0495674_0076921
860 Ga0495674_0142095
861 Ga0495676_0018992
862 Ga0495676_0175670
863 Ga0495676_0175950
864 Ga0495676_0260771
865 Ga0495680_0007245
866 Ga0495680_0029574
867 Ga0495680_0035189
868 Ga0495680_0137982
869 Ga0495680_0322829
870 Ga0495675_0000301
871 Ga0495675_0117367
872 Ga0495684_0002557
873 Ga0495684_0012054
874 Ga0495684_0052286
875 Ga0495593_0014070
876 Ga0495602_0000515
877 Ga0495602_0044533
878 Ga0495602_0106805
879 Ga0495614_0005381
880 Ga0495614_0009448
881 Ga0496100_0005026
882 Ga0496100_0050436
883 Ga0496101_0041466
884 Ga0496101_0044394
885 Ga0496101_0067865
886 Ga0496101_0163803
887 Ga0496102_0102833
888 Ga0496102_0167455
889 Ga0496103_0168618
890 Ga0496104_0001804
891 Ga0496104_0018020
892 Ga0496104_0106596
893 Ga0496105_0064569
894 Ga0496105_0091323
895 Ga0496106_0008135
896 Ga0496107_0035929
897 Ga0496107_0036744
898 Ga0496107_0087462
899 Ga0496108_0038344
900 Ga0496108_0063998
901 Ga0496108_0169715
902 Ga0496109_0006259
903 Ga0496109_0021836
904 Ga0496109_0054836
905 Ga0496109_0145867
906 Ga0496110_0432212
907 Ga0496111_0001118
908 Ga0496112_0005722
909 Ga0496112_0509774
910 Ga0496114_0000875
911 Ga0496114_0028305
912 Ga0496114_0396461
913 Ga0496115_0003970
914 Ga0496115_0029540
915 Ga0496115_0053091
916 Ga0496115_0060972
917 Ga0501067_0012836
918 Ga0501067_0023474
919 Ga0501067_0065015
920 Ga0501069_0026095
921 Ga0501069_0175246
922 nmdc:mga05p37_66000_c1
923 nmdc:mga08y16_110353_c1
924 nmdc:mga0n895_2163_c1
925 nmdc:mga0n895_846_c1
926 nmdc:mga0rr50_4981_c1
927 nmdc:mga0a205_208882_c1
928 Ga0495601_0000835
929 Ga0495601_0003505
930 Ga0495601_0004502
931 Ga0495601_0007124
932 Ga0495601_0027795
933 Ga0495612_0013141
934 Ga0495612_0014967
935 Ga0495612_0061706
936 Ga0495595_0020015
937 Ga0495595_0028351
938 Ga0495619_0008401
939 Ga0495619_0053200
940 Ga0495619_0070495
941 Ga0495619_0070560
942 Ga0495619_0094878
943 Ga0500566_0022821
944 Ga0466962_0001729
945 Ga0466962_0007815
946 Ga0466962_0018277
947 Ga0466962_0068804
948 Ga0530510_0101770

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13478

XdhC_C

XdhC Rossmann domain

178

320

0.99

PF02625

XdhC_CoxI

XdhC and CoxI family

29

96

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sf0-assembly2.cif.gz_C-2 crystal structure of ancestral flavin-containing monooxygenase (fmo) 2 in the presence of nadp+ 0.8716 161 190
6sem-assembly2.cif.gz_A crystal structure of ancestral flavin-containing monooxygenase (fmo) 2 0.8567 161 191
4k7z-assembly1.cif.gz_A-2 crystal structure of the c136(42)a/c141(47)a double mutant of tn501 mera in complex with nadp and hg2+ 0.856 159 190
4h2n-assembly1.cif.gz_A crystal structure of mhpco, y270f mutant 0.8374 160 189
3alm-assembly2.cif.gz_B crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase, mutant c294a 0.8366 160 189
ID Description Score Start End Superfamily
2we7A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9306 164 309 3.40.50.720
2we7A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8898 164 309 3.40.50.720
af_Q46808_105_253_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8851 163 309 3.40.50.720
af_P77183_179_306_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8781 163 309 3.40.50.720
af_Q9EQ76_1_173_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8677 160 190 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A6G2LJD5-F1-model_v4 deleted 0.9559 159 260
AF-A0A4Q5T957-F1-model_v4 XshC-Cox1-family protein 0.9433 160 309
AF-A0A250VU92-F1-model_v4 XdhC Rossmann domain-containing protein 0.9385 164 294
AF-A0A7Y3B781-F1-model_v4 XdhC family protein 0.9368 159 311
AF-A0A537VRG9-F1-model_v4 XdhC family protein 0.9353 180 308

Map