F451149
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 474 | 205 | 948 | 323 |
Family's Representative Sequence
| Representative Sequence | 3300005545|Ga0070695_100000473|Ga0070695_10000047312 |
| Length | 343 |
| Sequence | VSQLFPVVMLTHADTLTAMDEALQQAVLWREVGRRVAVATVVATRRSAPRPVGSKLVVAESGELAGSVSGGCVESDVVLAAQEVLAGGPPRLLTYGITDEMAFGIGLPCGGEIDVFVEELTEAERPEVTLTVVAGEGVGERLHDSELEQSARRRGLSHVIELEDRTVLADVSAPPPRLFVYGAVDTAEALCRAAKLLGWRTVVADARGSFATPERIPSADELLLLWPDEALAHVQPDLGTAVIVLTHDDKFDLPLIRGALAGDAFYIGWIGSRRNQERRRGLLREEGLTDDELDRISGPSGLDIGAGTPSETAVSILGEILAVRAGRTGGRLKDAKTRIHAPL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 28 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 34 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 35 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 36 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 37 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 38 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 56 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 60 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 94 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 95 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 96 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 97 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 98 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 99 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 100 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 101 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 102 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 103 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 104 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 105 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 106 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 107 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 108 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 109 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 110 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 111 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 112 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 113 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 114 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 115 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 116 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 117 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 118 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 119 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 120 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 121 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 122 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 123 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 124 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 125 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 126 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 127 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 128 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 180 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 181 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 182 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 183 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 184 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 185 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 188 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 189 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 190 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 191 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 192 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 204 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 205 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.58 |
| Metatranscriptomes | 0.42 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.21 |
| Nodule | 0 |
| Rhizoplane | 7.59 |
| Rhizosphere | 91.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070695_100000473 | 3300005545 | Bacteria | 20860 |
| 2 | Ga0070658_10074484 | 3300005327 | Bacteria | 2784 |
| 3 | Ga0070683_100002828 | 3300005329 | Bacteria | 13892 |
| 4 | Ga0070683_100025640 | 3300005329 | Bacteria | 5297 |
| 5 | Ga0070683_100245687 | 3300005329 | Bacteria | 1702 |
| 6 | Ga0068869_100048003 | 3300005334 | Bacteria | 3085 |
| 7 | Ga0070682_100108639 | 3300005337 | Bacteria | 1845 |
| 8 | Ga0068868_100002705 | 3300005338 | Bacteria | 12301 |
| 9 | Ga0068868_100060100 | 3300005338 | Bacteria | 3008 |
| 10 | Ga0070660_100008364 | 3300005339 | Bacteria | 7234 |
| 11 | Ga0070660_100247484 | 3300005339 | Bacteria | 1453 |
| 12 | Ga0070671_100044120 | 3300005355 | Bacteria | 3705 |
| 13 | Ga0070671_100158140 | 3300005355 | Bacteria | 1915 |
| 14 | Ga0070659_100014891 | 3300005366 | Bacteria | 5816 |
| 15 | Ga0070709_10025558 | 3300005434 | Bacteria | 3490 |
| 16 | Ga0070714_100018735 | 3300005435 | Bacteria | 5631 |
| 17 | Ga0070714_100021378 | 3300005435 | Bacteria | 5295 |
| 18 | Ga0070714_100027937 | 3300005435 | Bacteria | 4676 |
| 19 | Ga0070714_100051045 | 3300005435 | Bacteria | 3526 |
| 20 | Ga0070714_100123035 | 3300005435 | Bacteria | 2310 |
| 21 | Ga0070714_100320309 | 3300005435 | Bacteria | 1450 |
| 22 | Ga0070714_100322586 | 3300005435 | Bacteria | 1445 |
| 23 | Ga0070713_100033053 | 3300005436 | Bacteria | 4140 |
| 24 | Ga0070710_10000749 | 3300005437 | Bacteria | 15464 |
| 25 | Ga0070710_10032136 | 3300005437 | Bacteria | 2840 |
| 26 | Ga0070710_10169160 | 3300005437 | Unclassified | 1361 |
| 27 | Ga0070711_100092753 | 3300005439 | Bacteria | 2180 |
| 28 | Ga0070708_100391145 | 3300005445 | Unclassified | 1311 |
| 29 | Ga0070678_100116553 | 3300005456 | Bacteria | 2099 |
| 30 | Ga0070681_10038876 | 3300005458 | Bacteria | 4770 |
| 31 | Ga0070681_10073993 | 3300005458 | Bacteria | 3368 |
| 32 | Ga0070681_10101434 | 3300005458 | Bacteria | 2823 |
| 33 | Ga0070681_10306765 | 3300005458 | Bacteria | 1497 |
| 34 | Ga0070706_100207877 | 3300005467 | Bacteria | 1828 |
| 35 | Ga0070707_100001390 | 3300005468 | Bacteria | 23809 |
| 36 | Ga0070707_100052248 | 3300005468 | Bacteria | 3918 |
| 37 | Ga0070679_100075956 | 3300005530 | Bacteria | 3349 |
| 38 | Ga0070679_100103480 | 3300005530 | Bacteria | 2833 |
| 39 | Ga0070684_100008701 | 3300005535 | Bacteria | 7957 |
| 40 | Ga0070686_100085349 | 3300005544 | Bacteria | 2100 |
| 41 | Ga0068855_100025514 | 3300005563 | Bacteria | 7070 |
| 42 | Ga0068855_100050771 | 3300005563 | Bacteria | 4886 |
| 43 | Ga0068854_100326721 | 3300005578 | Bacteria | 1248 |
| 44 | Ga0068856_100015933 | 3300005614 | Bacteria | 7267 |
| 45 | Ga0068856_100218579 | 3300005614 | Bacteria | 1921 |
| 46 | Ga0068856_100354075 | 3300005614 | Bacteria | 1487 |
| 47 | Ga0068852_100144705 | 3300005616 | Unclassified | 2204 |
| 48 | Ga0068852_100438679 | 3300005616 | Bacteria | 1291 |
| 49 | Ga0068858_100030172 | 3300005842 | Bacteria | 5036 |
| 50 | Ga0070717_10004911 | 3300006028 | Bacteria | 9726 |
| 51 | Ga0070717_10021542 | 3300006028 | Bacteria | 5080 |
| 52 | Ga0070717_10087460 | 3300006028 | Bacteria | 2624 |
| 53 | Ga0070717_10106418 | 3300006028 | Bacteria | 2388 |
| 54 | Ga0070715_10001093 | 3300006163 | Bacteria | 7687 |
| 55 | Ga0070716_100050176 | 3300006173 | Bacteria | 2367 |
| 56 | Ga0070716_100073517 | 3300006173 | Bacteria | 2017 |
| 57 | Ga0070716_100187776 | 3300006173 | Bacteria | 1363 |
| 58 | Ga0070712_100170221 | 3300006175 | Bacteria | 1689 |
| 59 | Ga0097621_100196167 | 3300006237 | Bacteria | 1750 |
| 60 | Ga0097621_100263676 | 3300006237 | Bacteria | 1512 |
| 61 | Ga0068871_100590779 | 3300006358 | Bacteria | 1009 |
| 62 | Ga0075433_10178567 | 3300006852 | Bacteria | 1889 |
| 63 | Ga0075434_100006835 | 3300006871 | Bacteria | 10500 |
| 64 | Ga0075434_100009588 | 3300006871 | Bacteria | 9039 |
| 65 | Ga0068865_100070097 | 3300006881 | Bacteria | 2483 |
| 66 | Ga0075436_100374361 | 3300006914 | Bacteria | 1029 |
| 67 | Ga0075435_100000638 | 3300007076 | Bacteria | 21553 |
| 68 | Ga0075435_100126599 | 3300007076 | Bacteria | 2135 |
| 69 | Ga0105240_10011632 | 3300009093 | Bacteria | 12237 |
| 70 | Ga0105240_10155851 | 3300009093 | Bacteria | 2716 |
| 71 | Ga0111539_10027558 | 3300009094 | Bacteria | 6940 |
| 72 | Ga0111539_10132141 | 3300009094 | Bacteria | 2923 |
| 73 | Ga0105245_10035413 | 3300009098 | Bacteria | 4430 |
| 74 | Ga0105245_10207287 | 3300009098 | Bacteria | 1885 |
| 75 | Ga0105247_10014238 | 3300009101 | Bacteria | 4773 |
| 76 | Ga0105243_10112239 | 3300009148 | Bacteria | 2283 |
| 77 | Ga0105241_10153836 | 3300009174 | Bacteria | 1884 |
| 78 | Ga0105248_10026521 | 3300009177 | Bacteria | 6446 |
| 79 | Ga0105248_10445359 | 3300009177 | Bacteria | 1459 |
| 80 | Ga0105237_10216654 | 3300009545 | Bacteria | 1914 |
| 81 | Ga0105238_10029554 | 3300009551 | Bacteria | 5583 |
| 82 | Ga0105238_10458543 | 3300009551 | Bacteria | 1272 |
| 83 | Ga0105239_10063332 | 3300010375 | Bacteria | 4060 |
| 84 | Ga0105239_10458817 | 3300010375 | Bacteria | 1446 |
| 85 | Ga0105246_10065202 | 3300011119 | Bacteria | 2546 |
| 86 | Ga0157369_10023518 | 3300013105 | Bacteria | 6863 |
| 87 | Ga0157369_10102991 | 3300013105 | Bacteria | 3040 |
| 88 | Ga0157369_10365223 | 3300013105 | Bacteria | 1498 |
| 89 | Ga0157374_10027776 | 3300013296 | Bacteria | 5109 |
| 90 | Ga0163162_10184153 | 3300013306 | Bacteria | 2215 |
| 91 | Ga0157372_10004242 | 3300013307 | Bacteria | 15325 |
| 92 | Ga0157372_10028264 | 3300013307 | Bacteria | 6120 |
| 93 | Ga0157372_10248229 | 3300013307 | Bacteria | 2066 |
| 94 | Ga0157375_10134098 | 3300013308 | Bacteria | 2598 |
| 95 | Ga0182008_10026609 | 3300014497 | Bacteria | 2933 |
| 96 | Ga0157377_10010816 | 3300014745 | Bacteria | 4530 |
| 97 | Ga0157379_10325847 | 3300014968 | Bacteria | 1403 |
| 98 | Ga0157376_10375974 | 3300014969 | Bacteria | 1367 |
| 99 | Ga0206356_10967524 | 3300020070 | Bacteria | 3502 |
| 100 | Ga0206353_10599600 | 3300020082 | Bacteria | 4061 |
| 101 | Ga0207692_10050019 | 3300025898 | Bacteria | 2111 |
| 102 | Ga0207692_10068970 | 3300025898 | Bacteria | 1856 |
| 103 | Ga0207688_10005463 | 3300025901 | Bacteria | 6909 |
| 104 | Ga0207699_10001898 | 3300025906 | Bacteria | 9840 |
| 105 | Ga0207699_10052688 | 3300025906 | Bacteria | 2410 |
| 106 | Ga0207705_10045086 | 3300025909 | Bacteria | 3169 |
| 107 | Ga0207684_10057069 | 3300025910 | Bacteria | 3313 |
| 108 | Ga0207654_10258535 | 3300025911 | Bacteria | 1170 |
| 109 | Ga0207707_10030989 | 3300025912 | Bacteria | 4678 |
| 110 | Ga0207707_10091127 | 3300025912 | Bacteria | 2664 |
| 111 | Ga0207707_10169463 | 3300025912 | Bacteria | 1908 |
| 112 | Ga0207695_10013024 | 3300025913 | Bacteria | 9935 |
| 113 | Ga0207695_10203209 | 3300025913 | Bacteria | 1895 |
| 114 | Ga0207671_10110940 | 3300025914 | Bacteria | 2087 |
| 115 | Ga0207693_10004412 | 3300025915 | Bacteria | 11894 |
| 116 | Ga0207693_10151380 | 3300025915 | Bacteria | 1825 |
| 117 | Ga0207663_10039777 | 3300025916 | Bacteria | 2852 |
| 118 | Ga0207660_10157441 | 3300025917 | Bacteria | 1750 |
| 119 | Ga0207660_10304741 | 3300025917 | Bacteria | 1269 |
| 120 | Ga0207657_10001500 | 3300025919 | Bacteria | 24976 |
| 121 | Ga0207657_10008387 | 3300025919 | Bacteria | 10491 |
| 122 | Ga0207657_10035104 | 3300025919 | Bacteria | 4501 |
| 123 | Ga0207657_10048086 | 3300025919 | Bacteria | 3725 |
| 124 | Ga0207649_10190677 | 3300025920 | Bacteria | 1441 |
| 125 | Ga0207652_10220412 | 3300025921 | Bacteria | 1709 |
| 126 | Ga0207652_10264171 | 3300025921 | Bacteria | 1552 |
| 127 | Ga0207646_10001697 | 3300025922 | Bacteria | 26787 |
| 128 | Ga0207646_10072212 | 3300025922 | Bacteria | 3083 |
| 129 | Ga0207687_10001441 | 3300025927 | Bacteria | 16269 |
| 130 | Ga0207700_10084494 | 3300025928 | Bacteria | 2488 |
| 131 | Ga0207700_10252796 | 3300025928 | Bacteria | 1506 |
| 132 | Ga0207700_10307063 | 3300025928 | Bacteria | 1371 |
| 133 | Ga0207664_10005211 | 3300025929 | Bacteria | 8864 |
| 134 | Ga0207664_10006342 | 3300025929 | Bacteria | 8126 |
| 135 | Ga0207664_10039460 | 3300025929 | Bacteria | 3666 |
| 136 | Ga0207664_10056848 | 3300025929 | Bacteria | 3108 |
| 137 | Ga0207664_10067111 | 3300025929 | Bacteria | 2877 |
| 138 | Ga0207664_10079973 | 3300025929 | Bacteria | 2655 |
| 139 | Ga0207664_10096020 | 3300025929 | Bacteria | 2439 |
| 140 | Ga0207664_10186919 | 3300025929 | Bacteria | 1782 |
| 141 | Ga0207664_10224235 | 3300025929 | Unclassified | 1631 |
| 142 | Ga0207690_10006970 | 3300025932 | Bacteria | 6699 |
| 143 | Ga0207690_10340506 | 3300025932 | Bacteria | 1183 |
| 144 | Ga0207709_10339642 | 3300025935 | Bacteria | 1130 |
| 145 | Ga0207665_10034469 | 3300025939 | Bacteria | 3358 |
| 146 | Ga0207665_10094503 | 3300025939 | Bacteria | 2077 |
| 147 | Ga0207665_10099991 | 3300025939 | Bacteria | 2023 |
| 148 | Ga0207711_10071968 | 3300025941 | Bacteria | 3002 |
| 149 | Ga0207689_10043871 | 3300025942 | Bacteria | 3697 |
| 150 | Ga0207661_10012797 | 3300025944 | Bacteria | 6112 |
| 151 | Ga0207661_10077521 | 3300025944 | Bacteria | 2733 |
| 152 | Ga0207667_10012444 | 3300025949 | Bacteria | 9804 |
| 153 | Ga0207640_10083355 | 3300025981 | Bacteria | 2192 |
| 154 | Ga0207677_10005694 | 3300026023 | Bacteria | 6777 |
| 155 | Ga0207708_10075145 | 3300026075 | Bacteria | 2590 |
| 156 | Ga0207674_10395434 | 3300026116 | Bacteria | 1336 |
| 157 | Ga0207683_10010391 | 3300026121 | Bacteria | 7939 |
| 158 | Ga0207683_10145351 | 3300026121 | Bacteria | 2138 |
| 159 | Ga0207698_10144044 | 3300026142 | Bacteria | 2058 |
| 160 | Ga0207428_10169350 | 3300027907 | Bacteria | 1655 |
| 161 | Ga0265323_10057037 | 3300028653 | Bacteria | 1368 |
| 162 | Ga0265338_10000634 | 3300028800 | Bacteria | 60990 |
| 163 | Ga0265338_10003841 | 3300028800 | Bacteria | 20854 |
| 164 | Ga0265338_10009445 | 3300028800 | Bacteria | 11623 |
| 165 | Ga0265313_10071870 | 3300031595 | Bacteria | 1591 |
| 166 | Ga0373944_0014418 | 3300035089 | Bacteria | 2206 |
| 167 | Ga0373923_0036103 | 3300035111 | Bacteria | 2016 |
| 168 | Ga0373936_0050387 | 3300035113 | Bacteria | 1684 |
| 169 | Ga0373936_0089784 | 3300035113 | Bacteria | 1287 |
| 170 | Ga0373953_0034863 | 3300035117 | Bacteria | 1975 |
| 171 | Ga0373956_0032830 | 3300035119 | Bacteria | 2280 |
| 172 | Ga0373943_0002749 | 3300035170 | Bacteria | 8008 |
| 173 | Ga0373943_0126264 | 3300035170 | Bacteria | 1364 |
| 174 | Ga0373946_0017477 | 3300035171 | Bacteria | 2744 |
| 175 | Ga0373955_0080316 | 3300035172 | Bacteria | 1842 |
| 176 | Ga0373924_0043909 | 3300035410 | Bacteria | 1837 |
| 177 | Ga0373927_0027693 | 3300035695 | Bacteria | 3700 |
| 178 | Ga0373947_0013415 | 3300035725 | Bacteria | 4694 |
| 179 | Ga0373937_0000749 | 3300036401 | Bacteria | 28028 |
| 180 | Ga0373937_0015175 | 3300036401 | Bacteria | 6807 |
| 181 | Ga0373925_0108268 | 3300037068 | Bacteria | 2144 |
| 182 | Ga0395900_0705946 | 3300037418 | Bacteria | 942 |
| 183 | Ga0395898_0016479 | 3300037466 | Bacteria | 7559 |
| 184 | Ga0395905_0243994 | 3300037471 | Bacteria | 1678 |
| 185 | Ga0395901_0018271 | 3300038443 | Bacteria | 7159 |
| 186 | Ga0436363_1197225 | 3300039450 | Bacteria | 1528 |
| 187 | Ga0466969_0009696 | 3300044656 | Bacteria | 5105 |
| 188 | Ga0466966_0011285 | 3300044684 | Bacteria | 5929 |
| 189 | Ga0466966_0039274 | 3300044684 | Bacteria | 3049 |
| 190 | Ga0466961_0048295 | 3300044693 | Bacteria | 2720 |
| 191 | Ga0466961_0089184 | 3300044693 | Bacteria | 1948 |
| 192 | Ga0466961_0134655 | 3300044693 | Bacteria | 1548 |
| 193 | Ga0466963_0000509 | 3300044694 | Bacteria | 18145 |
| 194 | Ga0466963_0001597 | 3300044694 | Bacteria | 12314 |
| 195 | Ga0466963_0002118 | 3300044694 | Bacteria | 10974 |
| 196 | Ga0466963_0002515 | 3300044694 | Bacteria | 10261 |
| 197 | Ga0466963_0002832 | 3300044694 | Bacteria | 9778 |
| 198 | Ga0466963_0003519 | 3300044694 | Bacteria | 8990 |
| 199 | Ga0466963_0006150 | 3300044694 | Bacteria | 7085 |
| 200 | Ga0466963_0008397 | 3300044694 | Bacteria | 6187 |
| 201 | Ga0466963_0011746 | 3300044694 | Bacteria | 5339 |
| 202 | Ga0466963_0016609 | 3300044694 | Bacteria | 4580 |
| 203 | Ga0466963_0038812 | 3300044694 | Bacteria | 3116 |
| 204 | Ga0466963_0060453 | 3300044694 | Bacteria | 2530 |
| 205 | Ga0466963_0069365 | 3300044694 | Bacteria | 2369 |
| 206 | Ga0466963_0079581 | 3300044694 | Bacteria | 2217 |
| 207 | Ga0466963_0086371 | 3300044694 | Bacteria | 2131 |
| 208 | Ga0466963_0133620 | 3300044694 | Bacteria | 1715 |
| 209 | Ga0466963_0172117 | 3300044694 | Bacteria | 1510 |
| 210 | Ga0466964_0000410 | 3300044706 | Bacteria | 12964 |
| 211 | Ga0466964_0005945 | 3300044706 | Bacteria | 4545 |
| 212 | Ga0466964_0029283 | 3300044706 | Bacteria | 2173 |
| 213 | Ga0466964_0109264 | 3300044706 | Bacteria | 1231 |
| 214 | Ga0466971_0000934 | 3300044719 | Bacteria | 11989 |
| 215 | Ga0466971_0048181 | 3300044719 | Bacteria | 1916 |
| 216 | Ga0466968_0007968 | 3300044735 | Bacteria | 4046 |
| 217 | Ga0466968_0009625 | 3300044735 | Bacteria | 3721 |
| 218 | Ga0466968_0025286 | 3300044735 | Bacteria | 2431 |
| 219 | Ga0466968_0131509 | 3300044735 | Bacteria | 1139 |
| 220 | Ga0466970_0047079 | 3300044765 | Bacteria | 2297 |
| 221 | Ga0466970_0093465 | 3300044765 | Bacteria | 1634 |
| 222 | Ga0466970_0160624 | 3300044765 | Bacteria | 1243 |
| 223 | Ga0466957_0000407 | 3300044842 | Bacteria | 21025 |
| 224 | Ga0466957_0015410 | 3300044842 | Bacteria | 4466 |
| 225 | Ga0466957_0019958 | 3300044842 | Bacteria | 3943 |
| 226 | Ga0466957_0037146 | 3300044842 | Bacteria | 2932 |
| 227 | Ga0466957_0058954 | 3300044842 | Bacteria | 2352 |
| 228 | Ga0466957_0094781 | 3300044842 | Bacteria | 1874 |
| 229 | Ga0466960_0010587 | 3300044901 | Bacteria | 3833 |
| 230 | Ga0466960_0046358 | 3300044901 | Bacteria | 2081 |
| 231 | Ga0466959_0000954 | 3300045049 | Bacteria | 17196 |
| 232 | Ga0466959_0004817 | 3300045049 | Bacteria | 9115 |
| 233 | Ga0466959_0004867 | 3300045049 | Bacteria | 9085 |
| 234 | Ga0466959_0217639 | 3300045049 | Unclassified | 1325 |
| 235 | Ga0466958_0001863 | 3300045836 | Bacteria | 10294 |
| 236 | Ga0466958_0002628 | 3300045836 | Bacteria | 9087 |
| 237 | Ga0466958_0005988 | 3300045836 | Bacteria | 6583 |
| 238 | Ga0466958_0013151 | 3300045836 | Bacteria | 4706 |
| 239 | Ga0466958_0015030 | 3300045836 | Bacteria | 4428 |
| 240 | Ga0466958_0016791 | 3300045836 | Bacteria | 4221 |
| 241 | Ga0466958_0018159 | 3300045836 | Bacteria | 4077 |
| 242 | Ga0466958_0089866 | 3300045836 | Bacteria | 1899 |
| 243 | Ga0466958_0232734 | 3300045836 | Bacteria | 1177 |
| 244 | Ga0466967_0000297 | 3300045976 | Bacteria | 22234 |
| 245 | Ga0466967_0005309 | 3300045976 | Bacteria | 8896 |
| 246 | Ga0466967_0009346 | 3300045976 | Bacteria | 7267 |
| 247 | Ga0466967_0010505 | 3300045976 | Bacteria | 6950 |
| 248 | Ga0466967_0012741 | 3300045976 | Bacteria | 6455 |
| 249 | Ga0466967_0013215 | 3300045976 | Bacteria | 6367 |
| 250 | Ga0466967_0014505 | 3300045976 | Bacteria | 6141 |
| 251 | Ga0466967_0078887 | 3300045976 | Bacteria | 2967 |
| 252 | Ga0466967_0099103 | 3300045976 | Bacteria | 2661 |
| 253 | Ga0466967_0100017 | 3300045976 | Bacteria | 2649 |
| 254 | Ga0466967_0135888 | 3300045976 | Bacteria | 2286 |
| 255 | Ga0466967_0152368 | 3300045976 | Bacteria | 2162 |
| 256 | Ga0466967_0154430 | 3300045976 | Bacteria | 2148 |
| 257 | Ga0466967_0170510 | 3300045976 | Bacteria | 2047 |
| 258 | Ga0466967_0213503 | 3300045976 | Bacteria | 1831 |
| 259 | Ga0466967_0224722 | 3300045976 | Bacteria | 1785 |
| 260 | Ga0466967_0227298 | 3300045976 | Bacteria | 1775 |
| 261 | Ga0466967_0238330 | 3300045976 | Bacteria | 1734 |
| 262 | Ga0495592_0000728 | 3300046454 | Bacteria | 23022 |
| 263 | Ga0495592_0004738 | 3300046454 | Bacteria | 9983 |
| 264 | Ga0495592_0042525 | 3300046454 | Bacteria | 3402 |
| 265 | Ga0495592_0200695 | 3300046454 | Bacteria | 1346 |
| 266 | Ga0495603_0009878 | 3300046455 | Bacteria | 5776 |
| 267 | Ga0495603_0217824 | 3300046455 | Unclassified | 1102 |
| 268 | Ga0495629_0023322 | 3300046459 | Bacteria | 4410 |
| 269 | Ga0495629_0047954 | 3300046459 | Bacteria | 2995 |
| 270 | Ga0495629_0091876 | 3300046459 | Bacteria | 2118 |
| 271 | Ga0495629_0121653 | 3300046459 | Unclassified | 1818 |
| 272 | Ga0495641_0012232 | 3300046461 | Bacteria | 4816 |
| 273 | Ga0495641_0026781 | 3300046461 | Bacteria | 2810 |
| 274 | Ga0495641_0030688 | 3300046461 | Bacteria | 2574 |
| 275 | Ga0495651_0000699 | 3300046462 | Bacteria | 26062 |
| 276 | Ga0495651_0044646 | 3300046462 | Bacteria | 3434 |
| 277 | Ga0495651_0080924 | 3300046462 | Bacteria | 2453 |
| 278 | Ga0495651_0211225 | 3300046462 | Bacteria | 1350 |
| 279 | Ga0495653_0001005 | 3300046463 | Bacteria | 21756 |
| 280 | Ga0495653_0003907 | 3300046463 | Bacteria | 12046 |
| 281 | Ga0495653_0020859 | 3300046463 | Bacteria | 5308 |
| 282 | Ga0495653_0070529 | 3300046463 | Bacteria | 2615 |
| 283 | Ga0495653_0139579 | 3300046463 | Bacteria | 1706 |
| 284 | Ga0495653_0145955 | 3300046463 | Bacteria | 1658 |
| 285 | Ga0495580_0034887 | 3300046472 | Bacteria | 3619 |
| 286 | Ga0495580_0039038 | 3300046472 | Bacteria | 3397 |
| 287 | Ga0495580_0161196 | 3300046472 | Bacteria | 1552 |
| 288 | Ga0495582_0036284 | 3300046473 | Bacteria | 2712 |
| 289 | Ga0495582_0037977 | 3300046473 | Bacteria | 2649 |
| 290 | Ga0495582_0078936 | 3300046473 | Bacteria | 1827 |
| 291 | Ga0495639_0004120 | 3300046475 | Bacteria | 6230 |
| 292 | Ga0495662_0001154 | 3300046476 | Bacteria | 13002 |
| 293 | Ga0495662_0009125 | 3300046476 | Bacteria | 4867 |
| 294 | Ga0495662_0020845 | 3300046476 | Bacteria | 3170 |
| 295 | Ga0495664_0002268 | 3300046477 | Bacteria | 10310 |
| 296 | Ga0495664_0003678 | 3300046477 | Bacteria | 8360 |
| 297 | Ga0495585_0045453 | 3300046492 | Bacteria | 2451 |
| 298 | Ga0495594_0013265 | 3300046499 | Bacteria | 4300 |
| 299 | Ga0495608_0005259 | 3300046511 | Bacteria | 9248 |
| 300 | Ga0495608_0023808 | 3300046511 | Bacteria | 4191 |
| 301 | Ga0495608_0077780 | 3300046511 | Bacteria | 2159 |
| 302 | Ga0495618_0000821 | 3300046514 | Bacteria | 21621 |
| 303 | Ga0495618_0007687 | 3300046514 | Bacteria | 6518 |
| 304 | Ga0495618_0042278 | 3300046514 | Bacteria | 2872 |
| 305 | Ga0495618_0164225 | 3300046514 | Bacteria | 1414 |
| 306 | Ga0495628_0001050 | 3300046516 | Bacteria | 25288 |
| 307 | Ga0495628_0084666 | 3300046516 | Bacteria | 2460 |
| 308 | Ga0495628_0102528 | 3300046516 | Bacteria | 2207 |
| 309 | Ga0495630_0015918 | 3300046517 | Bacteria | 5497 |
| 310 | Ga0495630_0026091 | 3300046517 | Bacteria | 4324 |
| 311 | Ga0495630_0053526 | 3300046517 | Bacteria | 3022 |
| 312 | Ga0495630_0060603 | 3300046517 | Bacteria | 2841 |
| 313 | Ga0495630_0136113 | 3300046517 | Bacteria | 1866 |
| 314 | Ga0495630_0164057 | 3300046517 | Bacteria | 1691 |
| 315 | Ga0495644_0063915 | 3300046523 | Bacteria | 1383 |
| 316 | Ga0495666_0002626 | 3300046526 | Bacteria | 8945 |
| 317 | Ga0495666_0004962 | 3300046526 | Bacteria | 6735 |
| 318 | Ga0495652_0000187 | 3300046529 | Bacteria | 70410 |
| 319 | Ga0495652_0069181 | 3300046529 | Bacteria | 2955 |
| 320 | Ga0495652_0306288 | 3300046529 | Bacteria | 1153 |
| 321 | Ga0495665_0000405 | 3300046531 | Bacteria | 21950 |
| 322 | Ga0495665_0054699 | 3300046531 | Bacteria | 2108 |
| 323 | Ga0495640_0024398 | 3300046533 | Bacteria | 4399 |
| 324 | Ga0495640_0078185 | 3300046533 | Bacteria | 2204 |
| 325 | Ga0495640_0094950 | 3300046533 | Bacteria | 1963 |
| 326 | Ga0495640_0139456 | 3300046533 | Bacteria | 1564 |
| 327 | Ga0495640_0231360 | 3300046533 | Bacteria | 1162 |
| 328 | Ga0495586_0016992 | 3300046535 | Bacteria | 3870 |
| 329 | Ga0495586_0116801 | 3300046535 | Bacteria | 1488 |
| 330 | Ga0495587_0000467 | 3300046536 | Bacteria | 28207 |
| 331 | Ga0495587_0098839 | 3300046536 | Bacteria | 1682 |
| 332 | Ga0495645_0000700 | 3300046543 | Bacteria | 22971 |
| 333 | Ga0495645_0017353 | 3300046543 | Bacteria | 5156 |
| 334 | Ga0495645_0064892 | 3300046543 | Bacteria | 2641 |
| 335 | Ga0495645_0206619 | 3300046543 | Bacteria | 1328 |
| 336 | Ga0495667_0021720 | 3300046559 | Bacteria | 4331 |
| 337 | Ga0495667_0095360 | 3300046559 | Bacteria | 1926 |
| 338 | Ga0495667_0135165 | 3300046559 | Unclassified | 1590 |
| 339 | Ga0495667_0157032 | 3300046559 | Bacteria | 1463 |
| 340 | Ga0495656_0002093 | 3300046615 | Bacteria | 6589 |
| 341 | Ga0495634_0057900 | 3300046642 | Bacteria | 2585 |
| 342 | Ga0495634_0070838 | 3300046642 | Bacteria | 2297 |
| 343 | Ga0495634_0125287 | 3300046642 | Bacteria | 1642 |
| 344 | Ga0495635_0008970 | 3300046663 | Bacteria | 6982 |
| 345 | Ga0495635_0088678 | 3300046663 | Bacteria | 2116 |
| 346 | Ga0495661_0108355 | 3300046665 | Bacteria | 1552 |
| 347 | Ga0495657_0002882 | 3300046675 | Bacteria | 14276 |
| 348 | Ga0495657_0007202 | 3300046675 | Bacteria | 8625 |
| 349 | Ga0495657_0257379 | 3300046675 | Bacteria | 1049 |
| 350 | Ga0495599_0000333 | 3300046678 | Bacteria | 28098 |
| 351 | Ga0495599_0010821 | 3300046678 | Bacteria | 5592 |
| 352 | Ga0495599_0122220 | 3300046678 | Bacteria | 1618 |
| 353 | Ga0495623_0000045 | 3300046679 | Bacteria | 76108 |
| 354 | Ga0495623_0080327 | 3300046679 | Bacteria | 2019 |
| 355 | Ga0495623_0112238 | 3300046679 | Bacteria | 1651 |
| 356 | Ga0495646_0001574 | 3300046680 | Bacteria | 13601 |
| 357 | Ga0495646_0094012 | 3300046680 | Bacteria | 1727 |
| 358 | Ga0495647_0013452 | 3300046681 | Bacteria | 2835 |
| 359 | Ga0495647_0017771 | 3300046681 | Bacteria | 2521 |
| 360 | Ga0495647_0023463 | 3300046681 | Bacteria | 2237 |
| 361 | Ga0495658_0014768 | 3300046683 | Bacteria | 3994 |
| 362 | Ga0495658_0099920 | 3300046683 | Unclassified | 1730 |
| 363 | Ga0495658_0100900 | 3300046683 | Bacteria | 1723 |
| 364 | Ga0495658_0174016 | 3300046683 | Bacteria | 1333 |
| 365 | Ga0495658_0202675 | 3300046683 | Unclassified | 1237 |
| 366 | Ga0495613_0010049 | 3300046689 | Bacteria | 7030 |
| 367 | Ga0495613_0062957 | 3300046689 | Bacteria | 2714 |
| 368 | Ga0495613_0081687 | 3300046689 | Bacteria | 2347 |
| 369 | Ga0495613_0241376 | 3300046689 | Bacteria | 1263 |
| 370 | Ga0495624_0003744 | 3300046690 | Bacteria | 11238 |
| 371 | Ga0495624_0014145 | 3300046690 | Bacteria | 5423 |
| 372 | Ga0495624_0098323 | 3300046690 | Bacteria | 1802 |
| 373 | Ga0495624_0266645 | 3300046690 | Bacteria | 1034 |
| 374 | Ga0495600_0003464 | 3300046809 | Bacteria | 9282 |
| 375 | Ga0495600_0042097 | 3300046809 | Bacteria | 2977 |
| 376 | Ga0495600_0123316 | 3300046809 | Bacteria | 1685 |
| 377 | Ga0495581_0005247 | 3300047315 | Bacteria | 7495 |
| 378 | Ga0495581_0026778 | 3300047315 | Bacteria | 3342 |
| 379 | Ga0495581_0032532 | 3300047315 | Bacteria | 3020 |
| 380 | Ga0495581_0040671 | 3300047315 | Bacteria | 2689 |
| 381 | Ga0495604_0000221 | 3300047317 | Bacteria | 52090 |
| 382 | Ga0495674_0016676 | 3300047319 | Bacteria | 6853 |
| 383 | Ga0495674_0026366 | 3300047319 | Bacteria | 5317 |
| 384 | Ga0495674_0067286 | 3300047319 | Bacteria | 3104 |
| 385 | Ga0495674_0076921 | 3300047319 | Bacteria | 2870 |
| 386 | Ga0495674_0142095 | 3300047319 | Bacteria | 2017 |
| 387 | Ga0495676_0018992 | 3300047321 | Bacteria | 6053 |
| 388 | Ga0495676_0175670 | 3300047321 | Bacteria | 1504 |
| 389 | Ga0495676_0175950 | 3300047321 | Bacteria | 1503 |
| 390 | Ga0495676_0260771 | 3300047321 | Bacteria | 1179 |
| 391 | Ga0495680_0007245 | 3300047322 | Bacteria | 10217 |
| 392 | Ga0495680_0029574 | 3300047322 | Bacteria | 4486 |
| 393 | Ga0495680_0035189 | 3300047322 | Bacteria | 4035 |
| 394 | Ga0495680_0137982 | 3300047322 | Bacteria | 1786 |
| 395 | Ga0495680_0322829 | 3300047322 | Bacteria | 1080 |
| 396 | Ga0495675_0000301 | 3300047444 | Bacteria | 35499 |
| 397 | Ga0495675_0117367 | 3300047444 | Bacteria | 1659 |
| 398 | Ga0495684_0002557 | 3300047471 | Bacteria | 14477 |
| 399 | Ga0495684_0012054 | 3300047471 | Bacteria | 6667 |
| 400 | Ga0495684_0052286 | 3300047471 | Bacteria | 3117 |
| 401 | Ga0495593_0014070 | 3300047673 | Bacteria | 4553 |
| 402 | Ga0495602_0000515 | 3300048088 | Bacteria | 36065 |
| 403 | Ga0495602_0044533 | 3300048088 | Bacteria | 4024 |
| 404 | Ga0495602_0106805 | 3300048088 | Bacteria | 2284 |
| 405 | Ga0495614_0005381 | 3300048089 | Bacteria | 5775 |
| 406 | Ga0495614_0009448 | 3300048089 | Bacteria | 4311 |
| 407 | Ga0496100_0005026 | 3300048903 | Bacteria | 7077 |
| 408 | Ga0496100_0050436 | 3300048903 | Bacteria | 2696 |
| 409 | Ga0496101_0041466 | 3300048904 | Bacteria | 3282 |
| 410 | Ga0496101_0044394 | 3300048904 | Bacteria | 3180 |
| 411 | Ga0496101_0067865 | 3300048904 | Bacteria | 2605 |
| 412 | Ga0496101_0163803 | 3300048904 | Bacteria | 1706 |
| 413 | Ga0496102_0102833 | 3300048905 | Bacteria | 2656 |
| 414 | Ga0496102_0167455 | 3300048905 | Bacteria | 2068 |
| 415 | Ga0496103_0168618 | 3300048906 | Bacteria | 1405 |
| 416 | Ga0496104_0001804 | 3300048907 | Bacteria | 18557 |
| 417 | Ga0496104_0018020 | 3300048907 | Bacteria | 6438 |
| 418 | Ga0496104_0106596 | 3300048907 | Bacteria | 2685 |
| 419 | Ga0496105_0064569 | 3300048908 | Bacteria | 3020 |
| 420 | Ga0496105_0091323 | 3300048908 | Bacteria | 2514 |
| 421 | Ga0496106_0008135 | 3300048909 | Bacteria | 7745 |
| 422 | Ga0496107_0035929 | 3300048910 | Bacteria | 3553 |
| 423 | Ga0496107_0036744 | 3300048910 | Bacteria | 3513 |
| 424 | Ga0496107_0087462 | 3300048910 | Bacteria | 2275 |
| 425 | Ga0496108_0038344 | 3300048911 | Bacteria | 3991 |
| 426 | Ga0496108_0063998 | 3300048911 | Bacteria | 3097 |
| 427 | Ga0496108_0169715 | 3300048911 | Bacteria | 1887 |
| 428 | Ga0496109_0006259 | 3300048912 | Bacteria | 10010 |
| 429 | Ga0496109_0021836 | 3300048912 | Bacteria | 5665 |
| 430 | Ga0496109_0054836 | 3300048912 | Bacteria | 3635 |
| 431 | Ga0496109_0145867 | 3300048912 | Bacteria | 2214 |
| 432 | Ga0496110_0432212 | 3300048913 | Bacteria | 1200 |
| 433 | Ga0496111_0001118 | 3300048914 | Bacteria | 14861 |
| 434 | Ga0496112_0005722 | 3300048915 | Bacteria | 10802 |
| 435 | Ga0496112_0509774 | 3300048915 | Unclassified | 1138 |
| 436 | Ga0496114_0000875 | 3300048917 | Bacteria | 22544 |
| 437 | Ga0496114_0028305 | 3300048917 | Bacteria | 4597 |
| 438 | Ga0496114_0396461 | 3300048917 | Bacteria | 1222 |
| 439 | Ga0496115_0003970 | 3300048918 | Bacteria | 10672 |
| 440 | Ga0496115_0029540 | 3300048918 | Bacteria | 4305 |
| 441 | Ga0496115_0053091 | 3300048918 | Bacteria | 3252 |
| 442 | Ga0496115_0060972 | 3300048918 | Bacteria | 3040 |
| 443 | Ga0501067_0012836 | 3300049583 | Bacteria | 4639 |
| 444 | Ga0501067_0023474 | 3300049583 | Bacteria | 3419 |
| 445 | Ga0501067_0065015 | 3300049583 | Bacteria | 2019 |
| 446 | Ga0501069_0026095 | 3300049585 | Bacteria | 3198 |
| 447 | Ga0501069_0175246 | 3300049585 | Bacteria | 1238 |
| 448 | nmdc:mga05p37_66000_c1 | 3300050507 | Bacteria | 4452 |
| 449 | nmdc:mga08y16_110353_c1 | 3300050511 | Bacteria | 2864 |
| 450 | nmdc:mga0n895_2163_c1 | 3300050512 | Bacteria | 15185 |
| 451 | nmdc:mga0n895_846_c1 | 3300050512 | Bacteria | 21994 |
| 452 | nmdc:mga0rr50_4981_c1 | 3300050513 | Bacteria | 7868 |
| 453 | nmdc:mga0a205_208882_c1 | 3300050515 | Bacteria | 1841 |
| 454 | Ga0495601_0000835 | 3300053077 | Bacteria | 16726 |
| 455 | Ga0495601_0003505 | 3300053077 | Bacteria | 9010 |
| 456 | Ga0495601_0004502 | 3300053077 | Bacteria | 8055 |
| 457 | Ga0495601_0007124 | 3300053077 | Bacteria | 6552 |
| 458 | Ga0495601_0027795 | 3300053077 | Bacteria | 3499 |
| 459 | Ga0495612_0013141 | 3300053078 | Bacteria | 3333 |
| 460 | Ga0495612_0014967 | 3300053078 | Bacteria | 3111 |
| 461 | Ga0495612_0061706 | 3300053078 | Bacteria | 1553 |
| 462 | Ga0495595_0020015 | 3300053084 | Bacteria | 2909 |
| 463 | Ga0495595_0028351 | 3300053084 | Bacteria | 2500 |
| 464 | Ga0495619_0008401 | 3300053085 | Bacteria | 6530 |
| 465 | Ga0495619_0053200 | 3300053085 | Bacteria | 2677 |
| 466 | Ga0495619_0070495 | 3300053085 | Bacteria | 2337 |
| 467 | Ga0495619_0070560 | 3300053085 | Bacteria | 2336 |
| 468 | Ga0495619_0094878 | 3300053085 | Bacteria | 2024 |
| 469 | Ga0500566_0022821 | 3300053094 | Bacteria | 3675 |
| 470 | Ga0466962_0001729 | 3300061719 | Bacteria | 10265 |
| 471 | Ga0466962_0007815 | 3300061719 | Bacteria | 5126 |
| 472 | Ga0466962_0018277 | 3300061719 | Bacteria | 3372 |
| 473 | Ga0466962_0068804 | 3300061719 | Bacteria | 1691 |
| 474 | Ga0530510_0101770 | 3300061734 | Bacteria | 2101 |
| 475 | Ga0070695_100000473 | |||
| 476 | Ga0070658_10074484 | |||
| 477 | Ga0070683_100002828 | |||
| 478 | Ga0070683_100025640 | |||
| 479 | Ga0070683_100245687 | |||
| 480 | Ga0068869_100048003 | |||
| 481 | Ga0070682_100108639 | |||
| 482 | Ga0068868_100002705 | |||
| 483 | Ga0068868_100060100 | |||
| 484 | Ga0070660_100008364 | |||
| 485 | Ga0070660_100247484 | |||
| 486 | Ga0070671_100044120 | |||
| 487 | Ga0070671_100158140 | |||
| 488 | Ga0070659_100014891 | |||
| 489 | Ga0070709_10025558 | |||
| 490 | Ga0070714_100018735 | |||
| 491 | Ga0070714_100021378 | |||
| 492 | Ga0070714_100027937 | |||
| 493 | Ga0070714_100051045 | |||
| 494 | Ga0070714_100123035 | |||
| 495 | Ga0070714_100320309 | |||
| 496 | Ga0070714_100322586 | |||
| 497 | Ga0070713_100033053 | |||
| 498 | Ga0070710_10000749 | |||
| 499 | Ga0070710_10032136 | |||
| 500 | Ga0070710_10169160 | |||
| 501 | Ga0070711_100092753 | |||
| 502 | Ga0070708_100391145 | |||
| 503 | Ga0070678_100116553 | |||
| 504 | Ga0070681_10038876 | |||
| 505 | Ga0070681_10073993 | |||
| 506 | Ga0070681_10101434 | |||
| 507 | Ga0070681_10306765 | |||
| 508 | Ga0070706_100207877 | |||
| 509 | Ga0070707_100001390 | |||
| 510 | Ga0070707_100052248 | |||
| 511 | Ga0070679_100075956 | |||
| 512 | Ga0070679_100103480 | |||
| 513 | Ga0070684_100008701 | |||
| 514 | Ga0070686_100085349 | |||
| 515 | Ga0068855_100025514 | |||
| 516 | Ga0068855_100050771 | |||
| 517 | Ga0068854_100326721 | |||
| 518 | Ga0068856_100015933 | |||
| 519 | Ga0068856_100218579 | |||
| 520 | Ga0068856_100354075 | |||
| 521 | Ga0068852_100144705 | |||
| 522 | Ga0068852_100438679 | |||
| 523 | Ga0068858_100030172 | |||
| 524 | Ga0070717_10004911 | |||
| 525 | Ga0070717_10021542 | |||
| 526 | Ga0070717_10087460 | |||
| 527 | Ga0070717_10106418 | |||
| 528 | Ga0070715_10001093 | |||
| 529 | Ga0070716_100050176 | |||
| 530 | Ga0070716_100073517 | |||
| 531 | Ga0070716_100187776 | |||
| 532 | Ga0070712_100170221 | |||
| 533 | Ga0097621_100196167 | |||
| 534 | Ga0097621_100263676 | |||
| 535 | Ga0068871_100590779 | |||
| 536 | Ga0075433_10178567 | |||
| 537 | Ga0075434_100006835 | |||
| 538 | Ga0075434_100009588 | |||
| 539 | Ga0068865_100070097 | |||
| 540 | Ga0075436_100374361 | |||
| 541 | Ga0075435_100000638 | |||
| 542 | Ga0075435_100126599 | |||
| 543 | Ga0105240_10011632 | |||
| 544 | Ga0105240_10155851 | |||
| 545 | Ga0111539_10027558 | |||
| 546 | Ga0111539_10132141 | |||
| 547 | Ga0105245_10035413 | |||
| 548 | Ga0105245_10207287 | |||
| 549 | Ga0105247_10014238 | |||
| 550 | Ga0105243_10112239 | |||
| 551 | Ga0105241_10153836 | |||
| 552 | Ga0105248_10026521 | |||
| 553 | Ga0105248_10445359 | |||
| 554 | Ga0105237_10216654 | |||
| 555 | Ga0105238_10029554 | |||
| 556 | Ga0105238_10458543 | |||
| 557 | Ga0105239_10063332 | |||
| 558 | Ga0105239_10458817 | |||
| 559 | Ga0105246_10065202 | |||
| 560 | Ga0157369_10023518 | |||
| 561 | Ga0157369_10102991 | |||
| 562 | Ga0157369_10365223 | |||
| 563 | Ga0157374_10027776 | |||
| 564 | Ga0163162_10184153 | |||
| 565 | Ga0157372_10004242 | |||
| 566 | Ga0157372_10028264 | |||
| 567 | Ga0157372_10248229 | |||
| 568 | Ga0157375_10134098 | |||
| 569 | Ga0182008_10026609 | |||
| 570 | Ga0157377_10010816 | |||
| 571 | Ga0157379_10325847 | |||
| 572 | Ga0157376_10375974 | |||
| 573 | Ga0206356_10967524 | |||
| 574 | Ga0206353_10599600 | |||
| 575 | Ga0207692_10050019 | |||
| 576 | Ga0207692_10068970 | |||
| 577 | Ga0207688_10005463 | |||
| 578 | Ga0207699_10001898 | |||
| 579 | Ga0207699_10052688 | |||
| 580 | Ga0207705_10045086 | |||
| 581 | Ga0207684_10057069 | |||
| 582 | Ga0207654_10258535 | |||
| 583 | Ga0207707_10030989 | |||
| 584 | Ga0207707_10091127 | |||
| 585 | Ga0207707_10169463 | |||
| 586 | Ga0207695_10013024 | |||
| 587 | Ga0207695_10203209 | |||
| 588 | Ga0207671_10110940 | |||
| 589 | Ga0207693_10004412 | |||
| 590 | Ga0207693_10151380 | |||
| 591 | Ga0207663_10039777 | |||
| 592 | Ga0207660_10157441 | |||
| 593 | Ga0207660_10304741 | |||
| 594 | Ga0207657_10001500 | |||
| 595 | Ga0207657_10008387 | |||
| 596 | Ga0207657_10035104 | |||
| 597 | Ga0207657_10048086 | |||
| 598 | Ga0207649_10190677 | |||
| 599 | Ga0207652_10220412 | |||
| 600 | Ga0207652_10264171 | |||
| 601 | Ga0207646_10001697 | |||
| 602 | Ga0207646_10072212 | |||
| 603 | Ga0207687_10001441 | |||
| 604 | Ga0207700_10084494 | |||
| 605 | Ga0207700_10252796 | |||
| 606 | Ga0207700_10307063 | |||
| 607 | Ga0207664_10005211 | |||
| 608 | Ga0207664_10006342 | |||
| 609 | Ga0207664_10039460 | |||
| 610 | Ga0207664_10056848 | |||
| 611 | Ga0207664_10067111 | |||
| 612 | Ga0207664_10079973 | |||
| 613 | Ga0207664_10096020 | |||
| 614 | Ga0207664_10186919 | |||
| 615 | Ga0207664_10224235 | |||
| 616 | Ga0207690_10006970 | |||
| 617 | Ga0207690_10340506 | |||
| 618 | Ga0207709_10339642 | |||
| 619 | Ga0207665_10034469 | |||
| 620 | Ga0207665_10094503 | |||
| 621 | Ga0207665_10099991 | |||
| 622 | Ga0207711_10071968 | |||
| 623 | Ga0207689_10043871 | |||
| 624 | Ga0207661_10012797 | |||
| 625 | Ga0207661_10077521 | |||
| 626 | Ga0207667_10012444 | |||
| 627 | Ga0207640_10083355 | |||
| 628 | Ga0207677_10005694 | |||
| 629 | Ga0207708_10075145 | |||
| 630 | Ga0207674_10395434 | |||
| 631 | Ga0207683_10010391 | |||
| 632 | Ga0207683_10145351 | |||
| 633 | Ga0207698_10144044 | |||
| 634 | Ga0207428_10169350 | |||
| 635 | Ga0265323_10057037 | |||
| 636 | Ga0265338_10000634 | |||
| 637 | Ga0265338_10003841 | |||
| 638 | Ga0265338_10009445 | |||
| 639 | Ga0265313_10071870 | |||
| 640 | Ga0373944_0014418 | |||
| 641 | Ga0373923_0036103 | |||
| 642 | Ga0373936_0050387 | |||
| 643 | Ga0373936_0089784 | |||
| 644 | Ga0373953_0034863 | |||
| 645 | Ga0373956_0032830 | |||
| 646 | Ga0373943_0002749 | |||
| 647 | Ga0373943_0126264 | |||
| 648 | Ga0373946_0017477 | |||
| 649 | Ga0373955_0080316 | |||
| 650 | Ga0373924_0043909 | |||
| 651 | Ga0373927_0027693 | |||
| 652 | Ga0373947_0013415 | |||
| 653 | Ga0373937_0000749 | |||
| 654 | Ga0373937_0015175 | |||
| 655 | Ga0373925_0108268 | |||
| 656 | Ga0395900_0705946 | |||
| 657 | Ga0395898_0016479 | |||
| 658 | Ga0395905_0243994 | |||
| 659 | Ga0395901_0018271 | |||
| 660 | Ga0436363_1197225 | |||
| 661 | Ga0466969_0009696 | |||
| 662 | Ga0466966_0011285 | |||
| 663 | Ga0466966_0039274 | |||
| 664 | Ga0466961_0048295 | |||
| 665 | Ga0466961_0089184 | |||
| 666 | Ga0466961_0134655 | |||
| 667 | Ga0466963_0000509 | |||
| 668 | Ga0466963_0001597 | |||
| 669 | Ga0466963_0002118 | |||
| 670 | Ga0466963_0002515 | |||
| 671 | Ga0466963_0002832 | |||
| 672 | Ga0466963_0003519 | |||
| 673 | Ga0466963_0006150 | |||
| 674 | Ga0466963_0008397 | |||
| 675 | Ga0466963_0011746 | |||
| 676 | Ga0466963_0016609 | |||
| 677 | Ga0466963_0038812 | |||
| 678 | Ga0466963_0060453 | |||
| 679 | Ga0466963_0069365 | |||
| 680 | Ga0466963_0079581 | |||
| 681 | Ga0466963_0086371 | |||
| 682 | Ga0466963_0133620 | |||
| 683 | Ga0466963_0172117 | |||
| 684 | Ga0466964_0000410 | |||
| 685 | Ga0466964_0005945 | |||
| 686 | Ga0466964_0029283 | |||
| 687 | Ga0466964_0109264 | |||
| 688 | Ga0466971_0000934 | |||
| 689 | Ga0466971_0048181 | |||
| 690 | Ga0466968_0007968 | |||
| 691 | Ga0466968_0009625 | |||
| 692 | Ga0466968_0025286 | |||
| 693 | Ga0466968_0131509 | |||
| 694 | Ga0466970_0047079 | |||
| 695 | Ga0466970_0093465 | |||
| 696 | Ga0466970_0160624 | |||
| 697 | Ga0466957_0000407 | |||
| 698 | Ga0466957_0015410 | |||
| 699 | Ga0466957_0019958 | |||
| 700 | Ga0466957_0037146 | |||
| 701 | Ga0466957_0058954 | |||
| 702 | Ga0466957_0094781 | |||
| 703 | Ga0466960_0010587 | |||
| 704 | Ga0466960_0046358 | |||
| 705 | Ga0466959_0000954 | |||
| 706 | Ga0466959_0004817 | |||
| 707 | Ga0466959_0004867 | |||
| 708 | Ga0466959_0217639 | |||
| 709 | Ga0466958_0001863 | |||
| 710 | Ga0466958_0002628 | |||
| 711 | Ga0466958_0005988 | |||
| 712 | Ga0466958_0013151 | |||
| 713 | Ga0466958_0015030 | |||
| 714 | Ga0466958_0016791 | |||
| 715 | Ga0466958_0018159 | |||
| 716 | Ga0466958_0089866 | |||
| 717 | Ga0466958_0232734 | |||
| 718 | Ga0466967_0000297 | |||
| 719 | Ga0466967_0005309 | |||
| 720 | Ga0466967_0009346 | |||
| 721 | Ga0466967_0010505 | |||
| 722 | Ga0466967_0012741 | |||
| 723 | Ga0466967_0013215 | |||
| 724 | Ga0466967_0014505 | |||
| 725 | Ga0466967_0078887 | |||
| 726 | Ga0466967_0099103 | |||
| 727 | Ga0466967_0100017 | |||
| 728 | Ga0466967_0135888 | |||
| 729 | Ga0466967_0152368 | |||
| 730 | Ga0466967_0154430 | |||
| 731 | Ga0466967_0170510 | |||
| 732 | Ga0466967_0213503 | |||
| 733 | Ga0466967_0224722 | |||
| 734 | Ga0466967_0227298 | |||
| 735 | Ga0466967_0238330 | |||
| 736 | Ga0495592_0000728 | |||
| 737 | Ga0495592_0004738 | |||
| 738 | Ga0495592_0042525 | |||
| 739 | Ga0495592_0200695 | |||
| 740 | Ga0495603_0009878 | |||
| 741 | Ga0495603_0217824 | |||
| 742 | Ga0495629_0023322 | |||
| 743 | Ga0495629_0047954 | |||
| 744 | Ga0495629_0091876 | |||
| 745 | Ga0495629_0121653 | |||
| 746 | Ga0495641_0012232 | |||
| 747 | Ga0495641_0026781 | |||
| 748 | Ga0495641_0030688 | |||
| 749 | Ga0495651_0000699 | |||
| 750 | Ga0495651_0044646 | |||
| 751 | Ga0495651_0080924 | |||
| 752 | Ga0495651_0211225 | |||
| 753 | Ga0495653_0001005 | |||
| 754 | Ga0495653_0003907 | |||
| 755 | Ga0495653_0020859 | |||
| 756 | Ga0495653_0070529 | |||
| 757 | Ga0495653_0139579 | |||
| 758 | Ga0495653_0145955 | |||
| 759 | Ga0495580_0034887 | |||
| 760 | Ga0495580_0039038 | |||
| 761 | Ga0495580_0161196 | |||
| 762 | Ga0495582_0036284 | |||
| 763 | Ga0495582_0037977 | |||
| 764 | Ga0495582_0078936 | |||
| 765 | Ga0495639_0004120 | |||
| 766 | Ga0495662_0001154 | |||
| 767 | Ga0495662_0009125 | |||
| 768 | Ga0495662_0020845 | |||
| 769 | Ga0495664_0002268 | |||
| 770 | Ga0495664_0003678 | |||
| 771 | Ga0495585_0045453 | |||
| 772 | Ga0495594_0013265 | |||
| 773 | Ga0495608_0005259 | |||
| 774 | Ga0495608_0023808 | |||
| 775 | Ga0495608_0077780 | |||
| 776 | Ga0495618_0000821 | |||
| 777 | Ga0495618_0007687 | |||
| 778 | Ga0495618_0042278 | |||
| 779 | Ga0495618_0164225 | |||
| 780 | Ga0495628_0001050 | |||
| 781 | Ga0495628_0084666 | |||
| 782 | Ga0495628_0102528 | |||
| 783 | Ga0495630_0015918 | |||
| 784 | Ga0495630_0026091 | |||
| 785 | Ga0495630_0053526 | |||
| 786 | Ga0495630_0060603 | |||
| 787 | Ga0495630_0136113 | |||
| 788 | Ga0495630_0164057 | |||
| 789 | Ga0495644_0063915 | |||
| 790 | Ga0495666_0002626 | |||
| 791 | Ga0495666_0004962 | |||
| 792 | Ga0495652_0000187 | |||
| 793 | Ga0495652_0069181 | |||
| 794 | Ga0495652_0306288 | |||
| 795 | Ga0495665_0000405 | |||
| 796 | Ga0495665_0054699 | |||
| 797 | Ga0495640_0024398 | |||
| 798 | Ga0495640_0078185 | |||
| 799 | Ga0495640_0094950 | |||
| 800 | Ga0495640_0139456 | |||
| 801 | Ga0495640_0231360 | |||
| 802 | Ga0495586_0016992 | |||
| 803 | Ga0495586_0116801 | |||
| 804 | Ga0495587_0000467 | |||
| 805 | Ga0495587_0098839 | |||
| 806 | Ga0495645_0000700 | |||
| 807 | Ga0495645_0017353 | |||
| 808 | Ga0495645_0064892 | |||
| 809 | Ga0495645_0206619 | |||
| 810 | Ga0495667_0021720 | |||
| 811 | Ga0495667_0095360 | |||
| 812 | Ga0495667_0135165 | |||
| 813 | Ga0495667_0157032 | |||
| 814 | Ga0495656_0002093 | |||
| 815 | Ga0495634_0057900 | |||
| 816 | Ga0495634_0070838 | |||
| 817 | Ga0495634_0125287 | |||
| 818 | Ga0495635_0008970 | |||
| 819 | Ga0495635_0088678 | |||
| 820 | Ga0495661_0108355 | |||
| 821 | Ga0495657_0002882 | |||
| 822 | Ga0495657_0007202 | |||
| 823 | Ga0495657_0257379 | |||
| 824 | Ga0495599_0000333 | |||
| 825 | Ga0495599_0010821 | |||
| 826 | Ga0495599_0122220 | |||
| 827 | Ga0495623_0000045 | |||
| 828 | Ga0495623_0080327 | |||
| 829 | Ga0495623_0112238 | |||
| 830 | Ga0495646_0001574 | |||
| 831 | Ga0495646_0094012 | |||
| 832 | Ga0495647_0013452 | |||
| 833 | Ga0495647_0017771 | |||
| 834 | Ga0495647_0023463 | |||
| 835 | Ga0495658_0014768 | |||
| 836 | Ga0495658_0099920 | |||
| 837 | Ga0495658_0100900 | |||
| 838 | Ga0495658_0174016 | |||
| 839 | Ga0495658_0202675 | |||
| 840 | Ga0495613_0010049 | |||
| 841 | Ga0495613_0062957 | |||
| 842 | Ga0495613_0081687 | |||
| 843 | Ga0495613_0241376 | |||
| 844 | Ga0495624_0003744 | |||
| 845 | Ga0495624_0014145 | |||
| 846 | Ga0495624_0098323 | |||
| 847 | Ga0495624_0266645 | |||
| 848 | Ga0495600_0003464 | |||
| 849 | Ga0495600_0042097 | |||
| 850 | Ga0495600_0123316 | |||
| 851 | Ga0495581_0005247 | |||
| 852 | Ga0495581_0026778 | |||
| 853 | Ga0495581_0032532 | |||
| 854 | Ga0495581_0040671 | |||
| 855 | Ga0495604_0000221 | |||
| 856 | Ga0495674_0016676 | |||
| 857 | Ga0495674_0026366 | |||
| 858 | Ga0495674_0067286 | |||
| 859 | Ga0495674_0076921 | |||
| 860 | Ga0495674_0142095 | |||
| 861 | Ga0495676_0018992 | |||
| 862 | Ga0495676_0175670 | |||
| 863 | Ga0495676_0175950 | |||
| 864 | Ga0495676_0260771 | |||
| 865 | Ga0495680_0007245 | |||
| 866 | Ga0495680_0029574 | |||
| 867 | Ga0495680_0035189 | |||
| 868 | Ga0495680_0137982 | |||
| 869 | Ga0495680_0322829 | |||
| 870 | Ga0495675_0000301 | |||
| 871 | Ga0495675_0117367 | |||
| 872 | Ga0495684_0002557 | |||
| 873 | Ga0495684_0012054 | |||
| 874 | Ga0495684_0052286 | |||
| 875 | Ga0495593_0014070 | |||
| 876 | Ga0495602_0000515 | |||
| 877 | Ga0495602_0044533 | |||
| 878 | Ga0495602_0106805 | |||
| 879 | Ga0495614_0005381 | |||
| 880 | Ga0495614_0009448 | |||
| 881 | Ga0496100_0005026 | |||
| 882 | Ga0496100_0050436 | |||
| 883 | Ga0496101_0041466 | |||
| 884 | Ga0496101_0044394 | |||
| 885 | Ga0496101_0067865 | |||
| 886 | Ga0496101_0163803 | |||
| 887 | Ga0496102_0102833 | |||
| 888 | Ga0496102_0167455 | |||
| 889 | Ga0496103_0168618 | |||
| 890 | Ga0496104_0001804 | |||
| 891 | Ga0496104_0018020 | |||
| 892 | Ga0496104_0106596 | |||
| 893 | Ga0496105_0064569 | |||
| 894 | Ga0496105_0091323 | |||
| 895 | Ga0496106_0008135 | |||
| 896 | Ga0496107_0035929 | |||
| 897 | Ga0496107_0036744 | |||
| 898 | Ga0496107_0087462 | |||
| 899 | Ga0496108_0038344 | |||
| 900 | Ga0496108_0063998 | |||
| 901 | Ga0496108_0169715 | |||
| 902 | Ga0496109_0006259 | |||
| 903 | Ga0496109_0021836 | |||
| 904 | Ga0496109_0054836 | |||
| 905 | Ga0496109_0145867 | |||
| 906 | Ga0496110_0432212 | |||
| 907 | Ga0496111_0001118 | |||
| 908 | Ga0496112_0005722 | |||
| 909 | Ga0496112_0509774 | |||
| 910 | Ga0496114_0000875 | |||
| 911 | Ga0496114_0028305 | |||
| 912 | Ga0496114_0396461 | |||
| 913 | Ga0496115_0003970 | |||
| 914 | Ga0496115_0029540 | |||
| 915 | Ga0496115_0053091 | |||
| 916 | Ga0496115_0060972 | |||
| 917 | Ga0501067_0012836 | |||
| 918 | Ga0501067_0023474 | |||
| 919 | Ga0501067_0065015 | |||
| 920 | Ga0501069_0026095 | |||
| 921 | Ga0501069_0175246 | |||
| 922 | nmdc:mga05p37_66000_c1 | |||
| 923 | nmdc:mga08y16_110353_c1 | |||
| 924 | nmdc:mga0n895_2163_c1 | |||
| 925 | nmdc:mga0n895_846_c1 | |||
| 926 | nmdc:mga0rr50_4981_c1 | |||
| 927 | nmdc:mga0a205_208882_c1 | |||
| 928 | Ga0495601_0000835 | |||
| 929 | Ga0495601_0003505 | |||
| 930 | Ga0495601_0004502 | |||
| 931 | Ga0495601_0007124 | |||
| 932 | Ga0495601_0027795 | |||
| 933 | Ga0495612_0013141 | |||
| 934 | Ga0495612_0014967 | |||
| 935 | Ga0495612_0061706 | |||
| 936 | Ga0495595_0020015 | |||
| 937 | Ga0495595_0028351 | |||
| 938 | Ga0495619_0008401 | |||
| 939 | Ga0495619_0053200 | |||
| 940 | Ga0495619_0070495 | |||
| 941 | Ga0495619_0070560 | |||
| 942 | Ga0495619_0094878 | |||
| 943 | Ga0500566_0022821 | |||
| 944 | Ga0466962_0001729 | |||
| 945 | Ga0466962_0007815 | |||
| 946 | Ga0466962_0018277 | |||
| 947 | Ga0466962_0068804 | |||
| 948 | Ga0530510_0101770 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6sf0-assembly2.cif.gz_C-2 | crystal structure of ancestral flavin-containing monooxygenase (fmo) 2 in the presence of nadp+ | 0.8716 | 161 | 190 |
| 6sem-assembly2.cif.gz_A | crystal structure of ancestral flavin-containing monooxygenase (fmo) 2 | 0.8567 | 161 | 191 |
| 4k7z-assembly1.cif.gz_A-2 | crystal structure of the c136(42)a/c141(47)a double mutant of tn501 mera in complex with nadp and hg2+ | 0.856 | 159 | 190 |
| 4h2n-assembly1.cif.gz_A | crystal structure of mhpco, y270f mutant | 0.8374 | 160 | 189 |
| 3alm-assembly2.cif.gz_B | crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase, mutant c294a | 0.8366 | 160 | 189 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2we7A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9306 | 164 | 309 | 3.40.50.720 |
| 2we7A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8898 | 164 | 309 | 3.40.50.720 |
| af_Q46808_105_253_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8851 | 163 | 309 | 3.40.50.720 |
| af_P77183_179_306_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8781 | 163 | 309 | 3.40.50.720 |
| af_Q9EQ76_1_173_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8677 | 160 | 190 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6G2LJD5-F1-model_v4 | deleted | 0.9559 | 159 | 260 |
|
| AF-A0A4Q5T957-F1-model_v4 | XshC-Cox1-family protein | 0.9433 | 160 | 309 |
|
| AF-A0A250VU92-F1-model_v4 | XdhC Rossmann domain-containing protein | 0.9385 | 164 | 294 |
|
| AF-A0A7Y3B781-F1-model_v4 | XdhC family protein | 0.9368 | 159 | 311 |
|
| AF-A0A537VRG9-F1-model_v4 | XdhC family protein | 0.9353 | 180 | 308 |
|