F451137

General Info

Members Datasets Scaffolds Average Seq Length
474 266 948 252

Family's Representative Sequence

Representative Sequence 3300005343|Ga0070687_100079824|Ga0070687_1000798242
Length 265
Sequence MTSSTVPAATLEEAFTAFHEQVTSRLQAVADDAARGGLDPAIDLVVDSIRRGGVLQAFGTGHSQAFAMEIAGRAGGLIPTNNVALRDVVLLGGKDASILFDGAALEREPTVVDDLWATIQPHPEDVFVIASNSGVNGSVVGMAIAAKEHGHGVIAVTSLEHTARVTPKHPSGARLSEVADVVIDNLAPYGDTTLTLDGPDGPVGVGAVSSMTAAFIAQLLTIAVSERIVAAGAVPPIYLSANIPAGDDHNNLLENQYGDRLRRHA

Samples

Sample ID Description Type Environment
1 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
140 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
141 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
156 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
157 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
160 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
163 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
174 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
175 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
176 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
177 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
178 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
179 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
180 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
190 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
191 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
243 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
254 2643221629 Devosia sp. Root105 Isolate Unclassified
255 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
256 2643221662 Devosia sp. Root413D1 Isolate Unclassified
257 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
258 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
259 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
260 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
261 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
262 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
263 2919395869 Microbacterium resistens 2980 Isolate Unclassified
264 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
265 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
266 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.05
Metatranscriptomes 0.21
Isolates 2.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.53
Nodule 0
Rhizoplane 9.92
Rhizosphere 84.6
Stem 0
Stem Tuber 0
Unclassified 1.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070687_100079824 3300005343 Bacteria 1782
2 JGI24740J21852_10020410 3300001979 Bacteria 2312
3 JGI24740J21852_10035828 3300001979 Bacteria 1547
4 JGI25165J46597_1002906 3300003214 Bacteria 4847
5 rootH1_10063481 3300003323 Bacteria 4904
6 rootH1_10224969 3300003323 Bacteria 1355
7 Ga0070658_10023511 3300005327 Bacteria 4945
8 Ga0070658_10071029 3300005327 Bacteria 2851
9 Ga0070676_10133155 3300005328 Bacteria 1574
10 Ga0070676_10264711 3300005328 Bacteria 1152
11 Ga0070682_100067168 3300005337 Bacteria 2283
12 Ga0070682_100214581 3300005337 Bacteria 1366
13 Ga0068868_100579559 3300005338 Bacteria 992
14 Ga0070660_100030582 3300005339 Bacteria 4039
15 Ga0070661_100143157 3300005344 Bacteria 1803
16 Ga0070668_100269919 3300005347 Bacteria 1418
17 Ga0070668_100369679 3300005347 Bacteria 1218
18 Ga0070669_100251115 3300005353 Bacteria 1408
19 Ga0070675_100084565 3300005354 Bacteria 2650
20 Ga0070674_100012700 3300005356 Bacteria 5179
21 Ga0070674_100034023 3300005356 Bacteria 3399
22 Ga0070674_100181376 3300005356 Bacteria 1613
23 Ga0070688_100492690 3300005365 Bacteria 923
24 Ga0070659_100055831 3300005366 Bacteria 3113
25 Ga0070709_10207608 3300005434 Bacteria 1391
26 Ga0070713_100032251 3300005436 Bacteria 4182
27 Ga0070710_10096242 3300005437 Bacteria 1754
28 Ga0070700_100024264 3300005441 Bacteria 3559
29 Ga0070663_100047449 3300005455 Bacteria 3042
30 Ga0070663_100090172 3300005455 Bacteria 2270
31 Ga0070663_100760847 3300005455 Bacteria 828
32 Ga0070678_100445036 3300005456 Bacteria 1134
33 Ga0070662_100379399 3300005457 Bacteria 1163
34 Ga0070662_100405425 3300005457 Bacteria 1126
35 Ga0068867_100151305 3300005459 Bacteria 1823
36 Ga0070685_10097178 3300005466 Bacteria 1793
37 Ga0070684_100073448 3300005535 Bacteria 3014
38 Ga0070684_100155638 3300005535 Bacteria 2072
39 Ga0068853_100000386 3300005539 Bacteria 30324
40 Ga0068853_100098732 3300005539 Bacteria 2579
41 Ga0070665_100002133 3300005548 Bacteria 22083
42 Ga0070665_100013932 3300005548 Bacteria 8089
43 Ga0070665_100175856 3300005548 Bacteria 2141
44 Ga0070665_100462558 3300005548 Bacteria 1279
45 Ga0068855_100040865 3300005563 Bacteria 5500
46 Ga0068855_100595140 3300005563 Bacteria 1193
47 Ga0070664_100481610 3300005564 Bacteria 1142
48 Ga0068857_100073612 3300005577 Bacteria 3044
49 Ga0068857_100088242 3300005577 Bacteria 2774
50 Ga0068857_100268228 3300005577 Bacteria 1568
51 Ga0068854_100091873 3300005578 Bacteria 2260
52 Ga0068856_100025092 3300005614 Bacteria 5809
53 Ga0068856_100088719 3300005614 Bacteria 3075
54 Ga0068856_100406491 3300005614 Bacteria 1381
55 Ga0070702_100017038 3300005615 Bacteria 3741
56 Ga0070702_100513502 3300005615 Bacteria 882
57 Ga0068852_100008202 3300005616 Bacteria 7675
58 Ga0068852_100027362 3300005616 Bacteria 4647
59 Ga0068852_100125734 3300005616 Bacteria 2354
60 Ga0068852_100192758 3300005616 Bacteria 1924
61 Ga0068852_100198279 3300005616 Bacteria 1899
62 Ga0068852_100388605 3300005616 Bacteria 1370
63 Ga0068866_10025952 3300005718 Bacteria 2761
64 Ga0068866_10046786 3300005718 Bacteria 2178
65 Ga0068866_10063358 3300005718 Bacteria 1927
66 Ga0068861_100040364 3300005719 Bacteria 3490
67 Ga0068861_100235187 3300005719 Bacteria 1556
68 Ga0068851_10000136 3300005834 Bacteria 39586
69 Ga0068863_100366293 3300005841 Bacteria 1406
70 Ga0068858_100294417 3300005842 Bacteria 1548
71 Ga0068858_100427491 3300005842 Bacteria 1274
72 Ga0068860_100249038 3300005843 Bacteria 1730
73 Ga0081455_10000218 3300005937 Bacteria 73659
74 Ga0081455_10004715 3300005937 Bacteria 15155
75 Ga0081455_10021117 3300005937 Bacteria 6114
76 Ga0081455_10070806 3300005937 Bacteria 2894
77 Ga0081538_10000811 3300005981 Bacteria 33899
78 Ga0081538_10118263 3300005981 Bacteria 1281
79 Ga0081540_1009568 3300005983 Bacteria 6669
80 Ga0070717_10103594 3300006028 Bacteria 2419
81 Ga0075365_10511306 3300006038 Bacteria 849
82 Ga0075432_10001013 3300006058 Bacteria 8910
83 Ga0075432_10001271 3300006058 Bacteria 8138
84 Ga0070715_10007990 3300006163 Bacteria 3668
85 Ga0070716_100005790 3300006173 Bacteria 6002
86 Ga0075367_10005958 3300006178 Bacteria 6119
87 Ga0075427_10006066 3300006194 Bacteria 1741
88 Ga0075366_10022035 3300006195 Bacteria 3704
89 Ga0075366_10092240 3300006195 Bacteria 1815
90 Ga0075428_100041579 3300006844 Bacteria 5055
91 Ga0075428_100328092 3300006844 Bacteria 1644
92 Ga0075430_100333005 3300006846 Bacteria 1254
93 Ga0075433_10001237 3300006852 Bacteria 18633
94 Ga0075433_10051937 3300006852 Bacteria 3571
95 Ga0075434_100000426 3300006871 Bacteria 31164
96 Ga0075434_100011940 3300006871 Bacteria 8217
97 Ga0075429_100032458 3300006880 Bacteria 4539
98 Ga0068865_100008910 3300006881 Bacteria 6206
99 Ga0068865_100326682 3300006881 Bacteria 1236
100 Ga0075436_100009251 3300006914 Bacteria 6742
101 Ga0075436_100060690 3300006914 Bacteria 2612
102 Ga0075435_100001662 3300007076 Bacteria 14423
103 Ga0105240_10069423 3300009093 Bacteria 4361
104 Ga0105240_10687496 3300009093 Bacteria 1118
105 Ga0111539_10010340 3300009094 Bacteria 11748
106 Ga0111539_10013174 3300009094 Bacteria 10338
107 Ga0105245_10051666 3300009098 Bacteria 3684
108 Ga0105245_10243712 3300009098 Bacteria 1743
109 Ga0105245_10263760 3300009098 Bacteria 1677
110 Ga0105247_10107571 3300009101 Bacteria 1791
111 Ga0105247_10376439 3300009101 Bacteria 1005
112 Ga0114129_10013934 3300009147 Bacteria 11453
113 Ga0114129_10838458 3300009147 Bacteria 1170
114 Ga0105243_10005951 3300009148 Bacteria 9448
115 Ga0105243_10015150 3300009148 Bacteria 5835
116 Ga0105243_10021622 3300009148 Bacteria 4883
117 Ga0105243_10456368 3300009148 Bacteria 1200
118 Ga0105243_10499750 3300009148 Bacteria 1152
119 Ga0105241_10278818 3300009174 Bacteria 1427
120 Ga0105241_10335856 3300009174 Bacteria 1307
121 Ga0105242_10101142 3300009176 Bacteria 2442
122 Ga0105242_10963398 3300009176 Bacteria 858
123 Ga0105248_10363384 3300009177 Bacteria 1630
124 Ga0105237_10000158 3300009545 Bacteria 96082
125 Ga0105237_10010475 3300009545 Bacteria 9855
126 Ga0105237_10623579 3300009545 Bacteria 1085
127 Ga0105238_10002491 3300009551 Bacteria 18434
128 Ga0105238_10047093 3300009551 Bacteria 4349
129 Ga0105238_10056675 3300009551 Bacteria 3931
130 Ga0105238_10094739 3300009551 Bacteria 2973
131 Ga0105238_10109631 3300009551 Bacteria 2742
132 Ga0105238_11046483 3300009551 Bacteria 838
133 Ga0105249_10070857 3300009553 Bacteria 3219
134 Ga0105249_10496394 3300009553 Bacteria 1265
135 Ga0105249_10643887 3300009553 Bacteria 1117
136 Ga0105239_10001702 3300010375 Bacteria 28992
137 Ga0105239_10035518 3300010375 Bacteria 5473
138 Ga0105239_10121587 3300010375 Bacteria 2900
139 Ga0105239_10295608 3300010375 Bacteria 1824
140 Ga0105239_10792775 3300010375 Bacteria 1085
141 Ga0105246_10003475 3300011119 Bacteria 9551
142 Ga0157326_1007639 3300012513 Bacteria 1170
143 Ga0157371_10040939 3300013102 Bacteria 3308
144 Ga0157371_10046664 3300013102 Bacteria 3081
145 Ga0157370_10017616 3300013104 Bacteria 7204
146 Ga0157370_10281852 3300013104 Bacteria 1535
147 Ga0157369_10006088 3300013105 Bacteria 14000
148 Ga0157369_10043995 3300013105 Bacteria 4863
149 Ga0157369_10496037 3300013105 Bacteria 1263
150 Ga0157378_10177001 3300013297 Bacteria 2004
151 Ga0157378_10486899 3300013297 Unclassified 1230
152 Ga0163162_10116470 3300013306 Bacteria 2773
153 Ga0163162_10742763 3300013306 Bacteria 1101
154 Ga0157372_10040106 3300013307 Bacteria 5170
155 Ga0157372_10043560 3300013307 Bacteria 4969
156 Ga0157372_10482945 3300013307 Bacteria 1444
157 Ga0157372_11150862 3300013307 Bacteria 897
158 Ga0157375_10058401 3300013308 Bacteria 3816
159 Ga0157375_10501514 3300013308 Bacteria 1378
160 Ga0163163_10086659 3300014325 Bacteria 3141
161 Ga0157380_10034447 3300014326 Bacteria 3906
162 Ga0182008_10046275 3300014497 Bacteria 2163
163 Ga0157377_10211999 3300014745 Bacteria 1235
164 Ga0157379_10264462 3300014968 Bacteria 1563
165 Ga0163161_10006706 3300017792 Bacteria 7966
166 Ga0206353_11663887 3300020082 Bacteria 1475
167 Ga0207427_101801 3300025231 Bacteria 6874
168 Ga0209233_1011250 3300025261 Bacteria 2643
169 Ga0207692_10002981 3300025898 Bacteria 6557
170 Ga0207688_10028808 3300025901 Bacteria 3054
171 Ga0207647_10143228 3300025904 Bacteria 1400
172 Ga0207685_10001205 3300025905 Bacteria 5234
173 Ga0207699_10005346 3300025906 Bacteria 6153
174 Ga0207645_10027235 3300025907 Bacteria 3692
175 Ga0207705_10012263 3300025909 Bacteria 6194
176 Ga0207705_10076180 3300025909 Bacteria 2438
177 Ga0207654_10119048 3300025911 Bacteria 1655
178 Ga0207707_10431049 3300025912 Bacteria 1129
179 Ga0207695_10034009 3300025913 Bacteria 5550
180 Ga0207671_10000795 3300025914 Bacteria 39998
181 Ga0207663_10006308 3300025916 Bacteria 6055
182 Ga0207660_10244327 3300025917 Bacteria 1415
183 Ga0207657_10000691 3300025919 Bacteria 35886
184 Ga0207657_10016286 3300025919 Bacteria 7174
185 Ga0207657_10045312 3300025919 Bacteria 3861
186 Ga0207657_10185283 3300025919 Bacteria 1681
187 Ga0207649_10001185 3300025920 Bacteria 15697
188 Ga0207649_10053864 3300025920 Bacteria 2502
189 Ga0207649_10102216 3300025920 Bacteria 1899
190 Ga0207681_10207289 3300025923 Bacteria 1509
191 Ga0207694_10008683 3300025924 Bacteria 7670
192 Ga0207694_10064472 3300025924 Bacteria 2855
193 Ga0207694_10458125 3300025924 Bacteria 1065
194 Ga0207659_10168269 3300025926 Bacteria 1727
195 Ga0207687_10011288 3300025927 Bacteria 5839
196 Ga0207687_10318033 3300025927 Bacteria 1259
197 Ga0207700_10019700 3300025928 Bacteria 4562
198 Ga0207700_10088342 3300025928 Bacteria 2440
199 Ga0207700_10244335 3300025928 Bacteria 1531
200 Ga0207664_10004280 3300025929 Bacteria 9662
201 Ga0207690_10052878 3300025932 Bacteria 2722
202 Ga0207690_10064162 3300025932 Bacteria 2507
203 Ga0207706_10016939 3300025933 Bacteria 6574
204 Ga0207709_10040149 3300025935 Bacteria 2800
205 Ga0207709_10147903 3300025935 Bacteria 1623
206 Ga0207709_10218095 3300025935 Bacteria 1374
207 Ga0207709_10244274 3300025935 Bacteria 1308
208 Ga0207709_10529429 3300025935 Bacteria 924
209 Ga0207669_10022635 3300025937 Bacteria 3342
210 Ga0207669_10192523 3300025937 Bacteria 1472
211 Ga0207704_10058627 3300025938 Bacteria 2372
212 Ga0207704_10315671 3300025938 Bacteria 1203
213 Ga0207704_10495709 3300025938 Bacteria 983
214 Ga0207691_10035903 3300025940 Bacteria 4595
215 Ga0207711_10127887 3300025941 Bacteria 2275
216 Ga0207679_10035064 3300025945 Bacteria 3547
217 Ga0207667_10002347 3300025949 Bacteria 23722
218 Ga0207667_10010807 3300025949 Bacteria 10648
219 Ga0207712_10228897 3300025961 Bacteria 1491
220 Ga0207712_10393880 3300025961 Bacteria 1162
221 Ga0207668_10185110 3300025972 Bacteria 1646
222 Ga0207640_10002023 3300025981 Bacteria 10953
223 Ga0207640_10014540 3300025981 Bacteria 4535
224 Ga0207640_10058455 3300025981 Bacteria 2541
225 Ga0207703_10051029 3300026035 Bacteria 3350
226 Ga0207639_10017440 3300026041 Bacteria 5090
227 Ga0207639_10046138 3300026041 Bacteria 3286
228 Ga0207639_10729033 3300026041 Bacteria 921
229 Ga0207678_10307648 3300026067 Bacteria 1362
230 Ga0207702_10032642 3300026078 Bacteria 4344
231 Ga0207648_10028630 3300026089 Bacteria 4938
232 Ga0207648_10197719 3300026089 Bacteria 1783
233 Ga0207648_10403530 3300026089 Unclassified 1239
234 Ga0207648_10413435 3300026089 Bacteria 1224
235 Ga0207676_10158242 3300026095 Bacteria 1960
236 Ga0207674_10004078 3300026116 Bacteria 17700
237 Ga0207674_10032521 3300026116 Bacteria 5471
238 Ga0207674_10043820 3300026116 Bacteria 4611
239 Ga0207674_10243723 3300026116 Bacteria 1744
240 Ga0207675_100076536 3300026118 Bacteria 3133
241 Ga0207675_100107893 3300026118 Bacteria 2626
242 Ga0207675_100188896 3300026118 Bacteria 1975
243 Ga0207683_10012714 3300026121 Bacteria 7182
244 Ga0207683_10076078 3300026121 Bacteria 2972
245 Ga0207683_10282750 3300026121 Bacteria 1516
246 Ga0207698_10012416 3300026142 Bacteria 5572
247 Ga0207698_10432624 3300026142 Bacteria 1266
248 Ga0207698_10525921 3300026142 Bacteria 1155
249 Ga0207698_10724964 3300026142 Bacteria 991
250 Ga0207428_10003829 3300027907 Bacteria 14431
251 Ga0207428_10024122 3300027907 Bacteria 5108
252 Ga0268266_10000350 3300028379 Bacteria 71708
253 Ga0268266_10001910 3300028379 Bacteria 23446
254 Ga0268266_10085229 3300028379 Bacteria 2760
255 Ga0268266_10137212 3300028379 Bacteria 2192
256 Ga0268265_10098906 3300028380 Bacteria 2351
257 Ga0268264_10873175 3300028381 Bacteria 902
258 Ga0265318_10003901 3300028577 Bacteria 7350
259 Ga0316181_1166162 3300030744 Bacteria 1257
260 Ga0265332_10077043 3300031238 Bacteria 1417
261 Ga0307408_100014806 3300031548 Bacteria 5186
262 Ga0307408_100632206 3300031548 Bacteria 955
263 Ga0265314_10116321 3300031711 Bacteria 1690
264 Ga0307405_10002017 3300031731 Bacteria 8801
265 Ga0307405_10049128 3300031731 Bacteria 2606
266 Ga0307413_10000429 3300031824 Bacteria 13620
267 Ga0307413_10010151 3300031824 Bacteria 4549
268 Ga0307413_10012776 3300031824 Bacteria 4192
269 Ga0307413_10026061 3300031824 Bacteria 3217
270 Ga0307413_10583162 3300031824 Bacteria 912
271 Ga0307410_10023162 3300031852 Bacteria 3855
272 Ga0307410_10068525 3300031852 Bacteria 2451
273 Ga0307406_10000628 3300031901 Bacteria 20155
274 Ga0307406_10007038 3300031901 Bacteria 6228
275 Ga0307406_10082403 3300031901 Bacteria 2142
276 Ga0307406_10316583 3300031901 Bacteria 1205
277 Ga0307407_10004247 3300031903 Bacteria 6048
278 Ga0307407_10019580 3300031903 Bacteria 3449
279 Ga0307407_10035181 3300031903 Bacteria 2749
280 Ga0307407_10039835 3300031903 Bacteria 2616
281 Ga0307407_10052454 3300031903 Bacteria 2342
282 Ga0307407_10062573 3300031903 Bacteria 2180
283 Ga0307412_10004194 3300031911 Bacteria 8037
284 Ga0307412_10411738 3300031911 Bacteria 1104
285 Ga0307409_100000139 3300031995 Bacteria 27253
286 Ga0307409_100000320 3300031995 Bacteria 19702
287 Ga0307409_100143969 3300031995 Bacteria 2058
288 Ga0307409_100302356 3300031995 Bacteria 1489
289 Ga0307409_100484733 3300031995 Unclassified 1201
290 Ga0307409_100699534 3300031995 Bacteria 1013
291 Ga0307409_100982367 3300031995 Bacteria 862
292 Ga0307416_100000106 3300032002 Bacteria 51399
293 Ga0307414_10003824 3300032004 Bacteria 8095
294 Ga0307414_10006382 3300032004 Bacteria 6574
295 Ga0307414_10017694 3300032004 Bacteria 4368
296 Ga0307414_10924561 3300032004 Bacteria 800
297 Ga0307411_10000125 3300032005 Bacteria 24093
298 Ga0307411_10014886 3300032005 Bacteria 4346
299 Ga0307411_10019605 3300032005 Bacteria 3911
300 Ga0307415_100001437 3300032126 Bacteria 11397
301 Ga0307415_100014300 3300032126 Bacteria 4661
302 Ga0307415_100531702 3300032126 Bacteria 1034
303 Ga0307507_10177618 3300033179 Bacteria 1530
304 Ga0373944_0041064 3300035089 Bacteria 1430
305 Ga0373952_0013444 3300035092 Bacteria 1624
306 Ga0373923_0064994 3300035111 Bacteria 1556
307 Ga0373939_0044905 3300035114 Bacteria 1347
308 Ga0373939_0129155 3300035114 Bacteria 900
309 Ga0373945_0074633 3300035116 Bacteria 1289
310 Ga0373954_0071590 3300035118 Bacteria 1648
311 Ga0373957_0041886 3300035120 Bacteria 1726
312 Ga0373942_0004106 3300035207 Bacteria 3390
313 Ga0373962_0040461 3300035242 Bacteria 1311
314 Ga0373931_0005203 3300035691 Bacteria 6000
315 Ga0373931_0027137 3300035691 Bacteria 2920
316 Ga0373931_0089607 3300035691 Bacteria 1712
317 Ga0373927_0150763 3300035695 Bacteria 1522
318 Ga0373925_0560937 3300037068 Bacteria 939
319 Ga0395899_0048386 3300037312 Bacteria 3164
320 Ga0395899_0291169 3300037312 Unclassified 1108
321 Ga0395900_0015088 3300037418 Bacteria 7876
322 Ga0395898_0007021 3300037466 Bacteria 11966
323 Ga0395898_0046741 3300037466 Bacteria 4251
324 Ga0395898_0156986 3300037466 Bacteria 2176
325 Ga0395898_0227385 3300037466 Bacteria 1779
326 Ga0395905_0080563 3300037471 Bacteria 3051
327 Ga0395901_0221137 3300038443 Bacteria 1979
328 Ga0439448_0024558 3300042005 Bacteria 1886
329 Ga0439450_039838 3300042008 Bacteria 1087
330 Ga0439463_008756 3300042016 Bacteria 2492
331 Ga0439463_028582 3300042016 Bacteria 1405
332 Ga0439444_0013927 3300042437 Bacteria 1338
333 Ga0439459_0003779 3300042438 Bacteria 2420
334 Ga0439464_0011353 3300042439 Bacteria 2359
335 Ga0439460_0039946 3300042461 Bacteria 1373
336 Ga0439440_0018108 3300042993 Bacteria 1557
337 Ga0466965_0058035 3300044683 Bacteria 1930
338 Ga0466963_0181216 3300044694 Bacteria 1471
339 Ga0466964_0060063 3300044706 Bacteria 1580
340 Ga0466970_0000222 3300044765 Bacteria 28015
341 Ga0466957_0063259 3300044842 Bacteria 2274
342 Ga0466957_0359841 3300044842 Bacteria 989
343 Ga0466959_0300166 3300045049 Bacteria 1100
344 Ga0466967_0038239 3300045976 Bacteria 4113
345 Ga0466967_0067639 3300045976 Bacteria 3187
346 Ga0466967_0187228 3300045976 Bacteria 1955
347 Ga0466967_0821967 3300045976 Bacteria 923
348 Ga0495592_0008084 3300046454 Bacteria 7898
349 Ga0495641_0057743 3300046461 Bacteria 1757
350 Ga0495653_0014911 3300046463 Bacteria 6339
351 Ga0495639_0207901 3300046475 Bacteria 960
352 Ga0495608_0052703 3300046511 Bacteria 2692
353 Ga0495652_0010619 3300046529 Bacteria 8343
354 Ga0495640_0019875 3300046533 Bacteria 4953
355 Ga0495586_0098826 3300046535 Bacteria 1618
356 Ga0495667_0161623 3300046559 Bacteria 1441
357 Ga0495667_0396416 3300046559 Bacteria 869
358 Ga0495634_0034248 3300046642 Bacteria 3486
359 Ga0495611_0244806 3300046648 Bacteria 832
360 Ga0495599_0052586 3300046678 Bacteria 2551
361 Ga0495646_0039942 3300046680 Bacteria 2891
362 Ga0495624_0096674 3300046690 Bacteria 1819
363 Ga0495581_0155751 3300047315 Bacteria 1335
364 Ga0495680_0117811 3300047322 Bacteria 1963
365 Ga0495602_0030413 3300048088 Bacteria 5121
366 Ga0496101_0015531 3300048904 Bacteria 5135
367 Ga0496101_0037911 3300048904 Bacteria 3421
368 Ga0496101_0263259 3300048904 Bacteria 1345
369 Ga0496102_0063895 3300048905 Bacteria 3371
370 Ga0496102_0084888 3300048905 Bacteria 2923
371 Ga0496102_0340230 3300048905 Bacteria 1413
372 Ga0496103_0132587 3300048906 Bacteria 1591
373 Ga0496104_0001726 3300048907 Bacteria 18876
374 Ga0496104_0088957 3300048907 Bacteria 2950
375 Ga0496104_0115093 3300048907 Bacteria 2580
376 Ga0496105_0022233 3300048908 Bacteria 5136
377 Ga0496105_0063443 3300048908 Bacteria 3048
378 Ga0496105_0063784 3300048908 Bacteria 3040
379 Ga0496105_0157711 3300048908 Bacteria 1863
380 Ga0496105_0547528 3300048908 Bacteria 903
381 Ga0496106_0025202 3300048909 Bacteria 4425
382 Ga0496106_0062945 3300048909 Bacteria 2818
383 Ga0496106_0099015 3300048909 Bacteria 2260
384 Ga0496107_0152571 3300048910 Bacteria 1709
385 Ga0496107_0158745 3300048910 Bacteria 1675
386 Ga0496108_0055887 3300048911 Bacteria 3315
387 Ga0496108_0141168 3300048911 Bacteria 2075
388 Ga0496108_0141552 3300048911 Bacteria 2072
389 Ga0496108_0233289 3300048911 Bacteria 1600
390 Ga0496109_0104350 3300048912 Bacteria 2632
391 Ga0496109_0208114 3300048912 Bacteria 1839
392 Ga0496109_0340017 3300048912 Bacteria 1417
393 Ga0496109_0415322 3300048912 Bacteria 1271
394 Ga0496109_0439028 3300048912 Bacteria 1233
395 Ga0496109_0575650 3300048912 Bacteria 1061
396 Ga0496110_0090352 3300048913 Bacteria 2738
397 Ga0496111_0064396 3300048914 Bacteria 2659
398 Ga0496111_0097972 3300048914 Bacteria 2153
399 Ga0496111_0184364 3300048914 Bacteria 1552
400 Ga0496111_0210189 3300048914 Bacteria 1445
401 Ga0496112_0112792 3300048915 Bacteria 2689
402 Ga0496112_0148061 3300048915 Bacteria 2316
403 Ga0496113_0053956 3300048916 Bacteria 3007
404 Ga0496113_0061623 3300048916 Bacteria 2831
405 Ga0496113_0673440 3300048916 Bacteria 827
406 Ga0496114_0015760 3300048917 Bacteria 6082
407 Ga0496114_0039448 3300048917 Bacteria 3908
408 Ga0496114_0147461 3300048917 Bacteria 2040
409 Ga0496115_0011566 3300048918 Bacteria 6616
410 Ga0496115_0063159 3300048918 Bacteria 2987
411 Ga0496115_0093774 3300048918 Bacteria 2455
412 Ga0496115_0238021 3300048918 Bacteria 1501
413 Ga0496118_0078249 3300048921 Bacteria 2341
414 Ga0496121_0046584 3300048924 Bacteria 3710
415 Ga0496126_0420690 3300048929 Bacteria 1080
416 Ga0501032_0036157 3300049569 Bacteria 3373
417 Ga0501032_0046119 3300049569 Bacteria 2945
418 Ga0501033_0011111 3300049570 Bacteria 6897
419 Ga0501034_0012606 3300049571 Bacteria 8723
420 Ga0501034_0021022 3300049571 Bacteria 6661
421 Ga0501034_0028702 3300049571 Bacteria 5661
422 Ga0501034_0164526 3300049571 Bacteria 2187
423 Ga0501034_0349281 3300049571 Bacteria 1408
424 Ga0501036_0022626 3300049572 Bacteria 5288
425 Ga0501036_0124818 3300049572 Bacteria 2174
426 Ga0501038_0003206 3300049574 Bacteria 15265
427 Ga0501038_0022815 3300049574 Bacteria 5602
428 Ga0501038_0043680 3300049574 Bacteria 3896
429 Ga0501042_0001044 3300049578 Bacteria 15794
430 Ga0501043_0031705 3300049579 Bacteria 4154
431 Ga0501046_0035637 3300049580 Bacteria 4009
432 Ga0501047_0019280 3300049581 Bacteria 6544
433 Ga0501070_0076666 3300049586 Bacteria 2767
434 Ga0501071_0050540 3300049587 Bacteria 2995
435 Ga0501072_0318095 3300049588 Bacteria 1237
436 Ga0501079_0506988 3300049741 Bacteria 949
437 Ga0501083_0004398 3300049744 Bacteria 9933
438 Ga0501083_0005683 3300049744 Bacteria 8829
439 Ga0501035_0012395 3300049822 Bacteria 7880
440 Ga0501035_0036895 3300049822 Bacteria 4428
441 Ga0501044_0540643 3300049823 Bacteria 1063
442 Ga0501044_0546610 3300049823 Bacteria 1056
443 Ga0501045_0222961 3300049824 Bacteria 1404
444 nmdc:mga03683_80347_c1 3300050489 Bacteria 1407
445 nmdc:mga0k408_258728_c1 3300050493 Bacteria 1039
446 nmdc:mga06z11_12492_c1 3300050494 Bacteria 3696
447 nmdc:mga07m45_94862_c1 3300050496 Bacteria 1711
448 nmdc:mga05p37_12441_c1 3300050507 Bacteria 10163
449 nmdc:mga09592_43352_c1 3300050508 Bacteria 3787
450 nmdc:mga0qj67_98247_c1 3300050509 Bacteria 2358
451 nmdc:mga08y16_23907_c1 3300050511 Bacteria 6454
452 nmdc:mga08y16_68080_c1 3300050511 Bacteria 3713
453 nmdc:mga0n895_47266_c1 3300050512 Bacteria 4208
454 nmdc:mga0rr50_14176_c1 3300050513 Bacteria 5219
455 nmdc:mga0rr50_7462_c1 3300050513 Bacteria 6748
456 nmdc:mga08x19_1917_c1 3300050514 Bacteria 12730
457 nmdc:mga0a205_172809_c1 3300050515 Bacteria 2057
458 nmdc:mga0a205_68481_c1 3300050515 Unclassified 3428
459 nmdc:mga0a205_89_c1 3300050515 Bacteria 51004
460 Ga0495601_0014977 3300053077 Bacteria 4682
461 Ga0500568_0022883 3300053139 Bacteria 2665
462 2644168309 2643221629 Bacteria 5850260
463 2644182510 2643221632 Bacteria 3406696
464 2644351168 2643221662 Bacteria 5851492
465 2729907926 2728369276 Bacteria 5610032
466 2774394416 2773857762 Bacteria 5971770
467 2809194728 2808606439 Bacteria 5952208
468 2852649757 2852646457 Bacteria 3408613
469 2857730218 2857729791 Bacteria 4040535
470 2891972816 2891968417 Bacteria 5821697
471 2919396901 2919395869 Bacteria 3704152
472 2928123440 2928121344 Bacteria 3972376
473 2945969889 2945968032 Bacteria 4111363
474 2946034213 2946033335 Bacteria 3835514
475 Ga0070687_100079824
476 JGI24740J21852_10020410
477 JGI24740J21852_10035828
478 JGI25165J46597_1002906
479 rootH1_10063481
480 rootH1_10224969
481 Ga0070658_10023511
482 Ga0070658_10071029
483 Ga0070676_10133155
484 Ga0070676_10264711
485 Ga0070682_100067168
486 Ga0070682_100214581
487 Ga0068868_100579559
488 Ga0070660_100030582
489 Ga0070661_100143157
490 Ga0070668_100269919
491 Ga0070668_100369679
492 Ga0070669_100251115
493 Ga0070675_100084565
494 Ga0070674_100012700
495 Ga0070674_100034023
496 Ga0070674_100181376
497 Ga0070688_100492690
498 Ga0070659_100055831
499 Ga0070709_10207608
500 Ga0070713_100032251
501 Ga0070710_10096242
502 Ga0070700_100024264
503 Ga0070663_100047449
504 Ga0070663_100090172
505 Ga0070663_100760847
506 Ga0070678_100445036
507 Ga0070662_100379399
508 Ga0070662_100405425
509 Ga0068867_100151305
510 Ga0070685_10097178
511 Ga0070684_100073448
512 Ga0070684_100155638
513 Ga0068853_100000386
514 Ga0068853_100098732
515 Ga0070665_100002133
516 Ga0070665_100013932
517 Ga0070665_100175856
518 Ga0070665_100462558
519 Ga0068855_100040865
520 Ga0068855_100595140
521 Ga0070664_100481610
522 Ga0068857_100073612
523 Ga0068857_100088242
524 Ga0068857_100268228
525 Ga0068854_100091873
526 Ga0068856_100025092
527 Ga0068856_100088719
528 Ga0068856_100406491
529 Ga0070702_100017038
530 Ga0070702_100513502
531 Ga0068852_100008202
532 Ga0068852_100027362
533 Ga0068852_100125734
534 Ga0068852_100192758
535 Ga0068852_100198279
536 Ga0068852_100388605
537 Ga0068866_10025952
538 Ga0068866_10046786
539 Ga0068866_10063358
540 Ga0068861_100040364
541 Ga0068861_100235187
542 Ga0068851_10000136
543 Ga0068863_100366293
544 Ga0068858_100294417
545 Ga0068858_100427491
546 Ga0068860_100249038
547 Ga0081455_10000218
548 Ga0081455_10004715
549 Ga0081455_10021117
550 Ga0081455_10070806
551 Ga0081538_10000811
552 Ga0081538_10118263
553 Ga0081540_1009568
554 Ga0070717_10103594
555 Ga0075365_10511306
556 Ga0075432_10001013
557 Ga0075432_10001271
558 Ga0070715_10007990
559 Ga0070716_100005790
560 Ga0075367_10005958
561 Ga0075427_10006066
562 Ga0075366_10022035
563 Ga0075366_10092240
564 Ga0075428_100041579
565 Ga0075428_100328092
566 Ga0075430_100333005
567 Ga0075433_10001237
568 Ga0075433_10051937
569 Ga0075434_100000426
570 Ga0075434_100011940
571 Ga0075429_100032458
572 Ga0068865_100008910
573 Ga0068865_100326682
574 Ga0075436_100009251
575 Ga0075436_100060690
576 Ga0075435_100001662
577 Ga0105240_10069423
578 Ga0105240_10687496
579 Ga0111539_10010340
580 Ga0111539_10013174
581 Ga0105245_10051666
582 Ga0105245_10243712
583 Ga0105245_10263760
584 Ga0105247_10107571
585 Ga0105247_10376439
586 Ga0114129_10013934
587 Ga0114129_10838458
588 Ga0105243_10005951
589 Ga0105243_10015150
590 Ga0105243_10021622
591 Ga0105243_10456368
592 Ga0105243_10499750
593 Ga0105241_10278818
594 Ga0105241_10335856
595 Ga0105242_10101142
596 Ga0105242_10963398
597 Ga0105248_10363384
598 Ga0105237_10000158
599 Ga0105237_10010475
600 Ga0105237_10623579
601 Ga0105238_10002491
602 Ga0105238_10047093
603 Ga0105238_10056675
604 Ga0105238_10094739
605 Ga0105238_10109631
606 Ga0105238_11046483
607 Ga0105249_10070857
608 Ga0105249_10496394
609 Ga0105249_10643887
610 Ga0105239_10001702
611 Ga0105239_10035518
612 Ga0105239_10121587
613 Ga0105239_10295608
614 Ga0105239_10792775
615 Ga0105246_10003475
616 Ga0157326_1007639
617 Ga0157371_10040939
618 Ga0157371_10046664
619 Ga0157370_10017616
620 Ga0157370_10281852
621 Ga0157369_10006088
622 Ga0157369_10043995
623 Ga0157369_10496037
624 Ga0157378_10177001
625 Ga0157378_10486899
626 Ga0163162_10116470
627 Ga0163162_10742763
628 Ga0157372_10040106
629 Ga0157372_10043560
630 Ga0157372_10482945
631 Ga0157372_11150862
632 Ga0157375_10058401
633 Ga0157375_10501514
634 Ga0163163_10086659
635 Ga0157380_10034447
636 Ga0182008_10046275
637 Ga0157377_10211999
638 Ga0157379_10264462
639 Ga0163161_10006706
640 Ga0206353_11663887
641 Ga0207427_101801
642 Ga0209233_1011250
643 Ga0207692_10002981
644 Ga0207688_10028808
645 Ga0207647_10143228
646 Ga0207685_10001205
647 Ga0207699_10005346
648 Ga0207645_10027235
649 Ga0207705_10012263
650 Ga0207705_10076180
651 Ga0207654_10119048
652 Ga0207707_10431049
653 Ga0207695_10034009
654 Ga0207671_10000795
655 Ga0207663_10006308
656 Ga0207660_10244327
657 Ga0207657_10000691
658 Ga0207657_10016286
659 Ga0207657_10045312
660 Ga0207657_10185283
661 Ga0207649_10001185
662 Ga0207649_10053864
663 Ga0207649_10102216
664 Ga0207681_10207289
665 Ga0207694_10008683
666 Ga0207694_10064472
667 Ga0207694_10458125
668 Ga0207659_10168269
669 Ga0207687_10011288
670 Ga0207687_10318033
671 Ga0207700_10019700
672 Ga0207700_10088342
673 Ga0207700_10244335
674 Ga0207664_10004280
675 Ga0207690_10052878
676 Ga0207690_10064162
677 Ga0207706_10016939
678 Ga0207709_10040149
679 Ga0207709_10147903
680 Ga0207709_10218095
681 Ga0207709_10244274
682 Ga0207709_10529429
683 Ga0207669_10022635
684 Ga0207669_10192523
685 Ga0207704_10058627
686 Ga0207704_10315671
687 Ga0207704_10495709
688 Ga0207691_10035903
689 Ga0207711_10127887
690 Ga0207679_10035064
691 Ga0207667_10002347
692 Ga0207667_10010807
693 Ga0207712_10228897
694 Ga0207712_10393880
695 Ga0207668_10185110
696 Ga0207640_10002023
697 Ga0207640_10014540
698 Ga0207640_10058455
699 Ga0207703_10051029
700 Ga0207639_10017440
701 Ga0207639_10046138
702 Ga0207639_10729033
703 Ga0207678_10307648
704 Ga0207702_10032642
705 Ga0207648_10028630
706 Ga0207648_10197719
707 Ga0207648_10403530
708 Ga0207648_10413435
709 Ga0207676_10158242
710 Ga0207674_10004078
711 Ga0207674_10032521
712 Ga0207674_10043820
713 Ga0207674_10243723
714 Ga0207675_100076536
715 Ga0207675_100107893
716 Ga0207675_100188896
717 Ga0207683_10012714
718 Ga0207683_10076078
719 Ga0207683_10282750
720 Ga0207698_10012416
721 Ga0207698_10432624
722 Ga0207698_10525921
723 Ga0207698_10724964
724 Ga0207428_10003829
725 Ga0207428_10024122
726 Ga0268266_10000350
727 Ga0268266_10001910
728 Ga0268266_10085229
729 Ga0268266_10137212
730 Ga0268265_10098906
731 Ga0268264_10873175
732 Ga0265318_10003901
733 Ga0316181_1166162
734 Ga0265332_10077043
735 Ga0307408_100014806
736 Ga0307408_100632206
737 Ga0265314_10116321
738 Ga0307405_10002017
739 Ga0307405_10049128
740 Ga0307413_10000429
741 Ga0307413_10010151
742 Ga0307413_10012776
743 Ga0307413_10026061
744 Ga0307413_10583162
745 Ga0307410_10023162
746 Ga0307410_10068525
747 Ga0307406_10000628
748 Ga0307406_10007038
749 Ga0307406_10082403
750 Ga0307406_10316583
751 Ga0307407_10004247
752 Ga0307407_10019580
753 Ga0307407_10035181
754 Ga0307407_10039835
755 Ga0307407_10052454
756 Ga0307407_10062573
757 Ga0307412_10004194
758 Ga0307412_10411738
759 Ga0307409_100000139
760 Ga0307409_100000320
761 Ga0307409_100143969
762 Ga0307409_100302356
763 Ga0307409_100484733
764 Ga0307409_100699534
765 Ga0307409_100982367
766 Ga0307416_100000106
767 Ga0307414_10003824
768 Ga0307414_10006382
769 Ga0307414_10017694
770 Ga0307414_10924561
771 Ga0307411_10000125
772 Ga0307411_10014886
773 Ga0307411_10019605
774 Ga0307415_100001437
775 Ga0307415_100014300
776 Ga0307415_100531702
777 Ga0307507_10177618
778 Ga0373944_0041064
779 Ga0373952_0013444
780 Ga0373923_0064994
781 Ga0373939_0044905
782 Ga0373939_0129155
783 Ga0373945_0074633
784 Ga0373954_0071590
785 Ga0373957_0041886
786 Ga0373942_0004106
787 Ga0373962_0040461
788 Ga0373931_0005203
789 Ga0373931_0027137
790 Ga0373931_0089607
791 Ga0373927_0150763
792 Ga0373925_0560937
793 Ga0395899_0048386
794 Ga0395899_0291169
795 Ga0395900_0015088
796 Ga0395898_0007021
797 Ga0395898_0046741
798 Ga0395898_0156986
799 Ga0395898_0227385
800 Ga0395905_0080563
801 Ga0395901_0221137
802 Ga0439448_0024558
803 Ga0439450_039838
804 Ga0439463_008756
805 Ga0439463_028582
806 Ga0439444_0013927
807 Ga0439459_0003779
808 Ga0439464_0011353
809 Ga0439460_0039946
810 Ga0439440_0018108
811 Ga0466965_0058035
812 Ga0466963_0181216
813 Ga0466964_0060063
814 Ga0466970_0000222
815 Ga0466957_0063259
816 Ga0466957_0359841
817 Ga0466959_0300166
818 Ga0466967_0038239
819 Ga0466967_0067639
820 Ga0466967_0187228
821 Ga0466967_0821967
822 Ga0495592_0008084
823 Ga0495641_0057743
824 Ga0495653_0014911
825 Ga0495639_0207901
826 Ga0495608_0052703
827 Ga0495652_0010619
828 Ga0495640_0019875
829 Ga0495586_0098826
830 Ga0495667_0161623
831 Ga0495667_0396416
832 Ga0495634_0034248
833 Ga0495611_0244806
834 Ga0495599_0052586
835 Ga0495646_0039942
836 Ga0495624_0096674
837 Ga0495581_0155751
838 Ga0495680_0117811
839 Ga0495602_0030413
840 Ga0496101_0015531
841 Ga0496101_0037911
842 Ga0496101_0263259
843 Ga0496102_0063895
844 Ga0496102_0084888
845 Ga0496102_0340230
846 Ga0496103_0132587
847 Ga0496104_0001726
848 Ga0496104_0088957
849 Ga0496104_0115093
850 Ga0496105_0022233
851 Ga0496105_0063443
852 Ga0496105_0063784
853 Ga0496105_0157711
854 Ga0496105_0547528
855 Ga0496106_0025202
856 Ga0496106_0062945
857 Ga0496106_0099015
858 Ga0496107_0152571
859 Ga0496107_0158745
860 Ga0496108_0055887
861 Ga0496108_0141168
862 Ga0496108_0141552
863 Ga0496108_0233289
864 Ga0496109_0104350
865 Ga0496109_0208114
866 Ga0496109_0340017
867 Ga0496109_0415322
868 Ga0496109_0439028
869 Ga0496109_0575650
870 Ga0496110_0090352
871 Ga0496111_0064396
872 Ga0496111_0097972
873 Ga0496111_0184364
874 Ga0496111_0210189
875 Ga0496112_0112792
876 Ga0496112_0148061
877 Ga0496113_0053956
878 Ga0496113_0061623
879 Ga0496113_0673440
880 Ga0496114_0015760
881 Ga0496114_0039448
882 Ga0496114_0147461
883 Ga0496115_0011566
884 Ga0496115_0063159
885 Ga0496115_0093774
886 Ga0496115_0238021
887 Ga0496118_0078249
888 Ga0496121_0046584
889 Ga0496126_0420690
890 Ga0501032_0036157
891 Ga0501032_0046119
892 Ga0501033_0011111
893 Ga0501034_0012606
894 Ga0501034_0021022
895 Ga0501034_0028702
896 Ga0501034_0164526
897 Ga0501034_0349281
898 Ga0501036_0022626
899 Ga0501036_0124818
900 Ga0501038_0003206
901 Ga0501038_0022815
902 Ga0501038_0043680
903 Ga0501042_0001044
904 Ga0501043_0031705
905 Ga0501046_0035637
906 Ga0501047_0019280
907 Ga0501070_0076666
908 Ga0501071_0050540
909 Ga0501072_0318095
910 Ga0501079_0506988
911 Ga0501083_0004398
912 Ga0501083_0005683
913 Ga0501035_0012395
914 Ga0501035_0036895
915 Ga0501044_0540643
916 Ga0501044_0546610
917 Ga0501045_0222961
918 nmdc:mga03683_80347_c1
919 nmdc:mga0k408_258728_c1
920 nmdc:mga06z11_12492_c1
921 nmdc:mga07m45_94862_c1
922 nmdc:mga05p37_12441_c1
923 nmdc:mga09592_43352_c1
924 nmdc:mga0qj67_98247_c1
925 nmdc:mga08y16_23907_c1
926 nmdc:mga08y16_68080_c1
927 nmdc:mga0n895_47266_c1
928 nmdc:mga0rr50_14176_c1
929 nmdc:mga0rr50_7462_c1
930 nmdc:mga08x19_1917_c1
931 nmdc:mga0a205_172809_c1
932 nmdc:mga0a205_68481_c1
933 nmdc:mga0a205_89_c1
934 Ga0495601_0014977
935 Ga0500568_0022883
936 2644168309
937 2644182510
938 2644351168
939 2729907926
940 2774394416
941 2809194728
942 2852649757
943 2857730218
944 2891972816
945 2919396901
946 2928123440
947 2945969889
948 2946034213

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13580

SIS_2

SIS domain

17

158

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cvj-assembly2.cif.gz_D crystal structure of a putative phosphoheptose isomerase (bh3325) from bacillus halodurans c-125 at 2.00 a resolution 0.8694 1 248
3cvj-assembly2.cif.gz_D crystal structure of a putative phosphoheptose isomerase (bh3325) from bacillus halodurans c-125 at 2.00 a resolution 0.866 1 248
3jx9-assembly1.cif.gz_B crystal structure of putative phosphoheptose isomerase (yp_001815198.1) from exiguobacterium sp. 255-15 at 1.95 a resolution 0.7827 4 216
3jx9-assembly1.cif.gz_B crystal structure of putative phosphoheptose isomerase (yp_001815198.1) from exiguobacterium sp. 255-15 at 1.95 a resolution 0.7746 4 216
5oj7-assembly1.cif.gz_A sirtuin 4 orthologue from xenopus tropicalis in complex with adp-ribose 0.7331 114 170
ID Description Score Start End Superfamily
3cvjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8733 3 248 3.40.50.10490
3cvjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8629 3 248 3.40.50.10490
3jx9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8112 8 208 3.40.50.10490
af_A0A1D6IU93_89_345_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.7994 114 172 3.40.50.1220
af_Q20481_13_287_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.7756 114 172 3.40.50.1220
ID Description Score Start End GO Terms
AF-A0A371NWI7-F1-model_v4 Sugar isomerase domain-containing protein 0.9871 1 250 GO:0016853
GO:0097367
GO:1901135
AF-A0A7W5JZ03-F1-model_v4 Putative phosphosugar-binding protein 0.9863 7 250 GO:0097367
GO:1901135
AF-A0A1Q3PZI2-F1-model_v4 deleted 0.9812 8 250
AF-A0A6F8Y031-F1-model_v4 UPF0309 protein 0.9777 40 250 GO:0097367
GO:1901135
AF-A0A4Q3Z8S0-F1-model_v4 Sugar isomerase domain-containing protein 0.9766 30 250 GO:0016853
GO:0097367
GO:1901135

Map