F451116

General Info

Members Datasets Scaffolds Average Seq Length
473 305 379 249

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2990088156|2990090303
Length 265
Sequence ADTAAAAVHTAAAGSGGVNRTVLSGALLLAVPVAVLGGLVSFFSPCVLPLVPGYLSYVTGVSGTDLAQARRGRMFLGAGLFVLGFTAVFVSGGALFGGFGATLQEHRVIISRVLGALTILLGLTFMGALGPLSRFTSREFRIHRKPAVGLAGAPMLGVLFGIGWTPCIGPTLAAVQTLAFSEASAGRGALLTVAYCLGLGVPFVVAAVAFRRTLGAFGWVKRHYAWVMRIGGGMLVVVGVLLVTGAWDRIVYDLQVWSSDYTVGI

Samples

Sample ID Description Type Environment
1 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
2 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
3 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
4 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
5 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
6 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
7 2643221548 Streptomyces sp. Root55 Isolate Unclassified
8 2643221578 Streptomyces sp. Root63 Isolate Unclassified
9 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
10 2643221604 Nocardioides sp. Root190 Isolate Unclassified
11 2643221647 Streptomyces sp. Root369 Isolate Unclassified
12 2643221670 Streptomyces sp. Root431 Isolate Unclassified
13 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
14 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
15 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
16 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
17 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
18 2643221714 Streptomyces sp. Root264 Isolate Unclassified
19 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
20 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
21 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
22 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
23 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
24 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
25 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
26 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
27 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
28 2808606448 Streptomyces sp. 193411 Isolate Unclassified
29 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
30 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
31 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
32 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
33 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
34 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
35 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
36 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
37 2862574272 Streptomyces sp. AcE210 Isolate Nodule
38 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
39 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
40 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
41 2867369537 Streptomyces sp. Z26 Isolate Unclassified
42 2867428634 Streptomyces sp. RP5T Isolate Unclassified
43 2867475112 Streptomyces sp. TM32 Isolate Unclassified
44 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
45 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
46 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
47 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
48 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
49 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
50 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
51 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
52 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
53 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
54 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
55 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
56 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
57 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
58 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
59 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
60 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
61 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
62 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
63 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
64 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
65 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
66 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
67 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
68 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
69 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
70 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
71 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
72 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
73 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
74 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
75 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
76 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
77 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
78 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
79 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
80 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
81 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
82 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
83 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
84 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
85 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
89 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
105 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
120 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
123 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
124 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
127 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
128 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
142 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
143 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
144 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
145 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
148 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
149 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
152 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
153 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
154 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
155 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
156 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
157 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
158 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
159 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
160 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
161 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
162 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
163 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
188 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
189 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
190 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
194 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
195 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
200 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
204 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
207 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
208 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
217 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
220 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
259 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
260 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
261 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
262 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
263 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
264 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
265 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
268 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
269 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
270 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
271 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
272 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
273 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
274 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
275 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
276 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
277 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
278 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
279 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
280 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
281 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
282 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
283 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
284 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
285 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
288 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
289 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
290 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
291 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
292 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
293 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
294 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
295 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
296 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
297 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
298 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
299 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
300 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
301 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
302 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
303 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
304 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
305 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.49
Metatranscriptomes 0.63
Isolates 19.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.25
Nodule 0.85
Rhizoplane 2.96
Rhizosphere 69.34
Stem 0
Stem Tuber 0
Unclassified 18.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10004290 3300003316 Bacteria 14663
2 rootH2_10048161 3300003320 Bacteria 11950
3 rootH1_10022641 3300003323 Bacteria 4379
4 rootH1_10022642 3300003323 Bacteria 1011
5 JGI25160J50197_1010122 3300003354 Bacteria 3435
6 JGI25160J50197_1038064 3300003354 Bacteria 1143
7 Ga0006562J51391_1036491 3300003578 Bacteria 5410
8 Ga0006562J51391_1076094 3300003578 Bacteria 1676
9 Ga0006562J51391_1076095 3300003578 Bacteria 1290
10 Ga0068868_100449125 3300005338 Bacteria 1121
11 Ga0070663_100291202 3300005455 Bacteria 1304
12 Ga0070706_100440813 3300005467 Bacteria 1212
13 Ga0070672_100253309 3300005543 Bacteria 1483
14 Ga0070665_100517424 3300005548 Bacteria 1205
15 Ga0081455_10028999 3300005937 Bacteria 5049
16 Ga0081455_10496869 3300005937 Bacteria 820
17 Ga0075365_10034789 3300006038 Bacteria 3255
18 Ga0075368_10026788 3300006042 Bacteria 2219
19 Ga0075363_100038668 3300006048 Bacteria 2509
20 Ga0075367_10001154 3300006178 Bacteria 11024
21 Ga0075370_10017476 3300006353 Bacteria 3877
22 Ga0075370_10076072 3300006353 Bacteria 1925
23 Ga0099826_10046055 3300006948 Bacteria 2976
24 Ga0105247_10177475 3300009101 Bacteria 1420
25 Ga0105243_10345761 3300009148 Bacteria 1364
26 Ga0105248_10100778 3300009177 Bacteria 3255
27 Ga0105238_10189328 3300009551 Bacteria 2034
28 Ga0105238_10251780 3300009551 Bacteria 1745
29 Ga0163162_10170473 3300013306 Bacteria 2301
30 Ga0157375_10270412 3300013308 Bacteria 1862
31 Ga0182008_10005072 3300014497 Bacteria 7566
32 Ga0157379_10780499 3300014968 Bacteria 901
33 Ga0182006_1013567 3300015261 Bacteria 3533
34 Ga0182007_10001147 3300015262 Bacteria 14359
35 Ga0182005_1018546 3300015265 Bacteria 1923
36 Ga0183367_1002 3300015688 Bacteria 1101531
37 Ga0213875_10101146 3300021388 Bacteria 1345
38 Ga0209758_1007687 3300025297 Bacteria 7246
39 Ga0207426_1001814 3300025302 Bacteria 15838
40 Ga0207426_1002214 3300025302 Bacteria 13042
41 Ga0207710_10070443 3300025900 Bacteria 1602
42 Ga0207709_10134693 3300025935 Bacteria 1689
43 Ga0207691_10111372 3300025940 Bacteria 2434
44 Ga0207711_10628624 3300025941 Bacteria 1002
45 Ga0207661_10107773 3300025944 Bacteria 2351
46 Ga0207679_10252627 3300025945 Bacteria 1500
47 Ga0207639_10061876 3300026041 Bacteria 2893
48 Ga0209371_1013366 3300027312 Bacteria 2310
49 Ga0209813_10010733 3300027866 Bacteria 2377
50 Ga0268266_10312406 3300028379 Bacteria 1469
51 Ga0265322_10000079 3300028654 Bacteria 45897
52 Ga0307517_10001546 3300028786 Bacteria 38330
53 Ga0307517_10002771 3300028786 Bacteria 27879
54 Ga0307515_10000258 3300028794 Bacteria 131660
55 Ga0307515_10163223 3300028794 Bacteria 2260
56 Ga0307515_10453609 3300028794 Bacteria 897
57 Ga0268256_1014709 3300030500 Bacteria 2310
58 Ga0307511_10000481 3300030521 Bacteria 43338
59 Ga0307511_10137258 3300030521 Bacteria 1451
60 Ga0307511_10153403 3300030521 Bacteria 1315
61 Ga0307512_10003476 3300030522 Bacteria 18264
62 Ga0307512_10012662 3300030522 Bacteria 7954
63 Ga0307513_10048766 3300031456 Bacteria 4592
64 Ga0307513_10054039 3300031456 Bacteria 4310
65 Ga0307513_10077036 3300031456 Bacteria 3455
66 Ga0307509_10082599 3300031507 Bacteria 3314
67 Ga0307509_10091720 3300031507 Bacteria 3108
68 Ga0307509_10186968 3300031507 Bacteria 1928
69 Ga0307508_10002380 3300031616 Bacteria 19890
70 Ga0307508_10024106 3300031616 Bacteria 5522
71 Ga0307508_10033261 3300031616 Bacteria 4653
72 Ga0307508_10054666 3300031616 Bacteria 3538
73 Ga0307514_10003034 3300031649 Bacteria 16588
74 Ga0265342_10126356 3300031712 Bacteria 1436
75 Ga0307516_10008581 3300031730 Bacteria 11537
76 Ga0307516_10010912 3300031730 Bacteria 9936
77 Ga0307516_10022336 3300031730 Bacteria 6499
78 Ga0307516_10028899 3300031730 Bacteria 5606
79 Ga0307518_10096157 3300031838 Bacteria 2125
80 Ga0307518_10145373 3300031838 Bacteria 1647
81 Ga0307410_10074955 3300031852 Bacteria 2358
82 Ga0307416_100093496 3300032002 Bacteria 2590
83 Ga0307416_100744631 3300032002 Bacteria 1072
84 Ga0307507_10042414 3300033179 Bacteria 4534
85 Ga0307507_10089864 3300033179 Bacteria 2639
86 Ga0307507_10122122 3300033179 Bacteria 2078
87 Ga0307507_10288781 3300033179 Bacteria 1017
88 Ga0307510_10061942 3300033180 Bacteria 3828
89 Ga0307510_10172496 3300033180 Bacteria 1739
90 Ga0395900_0026984 3300037418 Bacteria 5879
91 Ga0395900_0122390 3300037418 Bacteria 2669
92 Ga0395898_0002008 3300037466 Bacteria 25542
93 Ga0395898_0008001 3300037466 Bacteria 11217
94 Ga0395905_0201257 3300037471 Bacteria 1867
95 Ga0436364_0233589 3300037853 Bacteria 2603
96 Ga0395901_0006887 3300038443 Bacteria 11481
97 Ga0395901_0480146 3300038443 Bacteria 1268
98 Ga0439436_0036860 3300041404 Bacteria 1409
99 Ga0439439_0003698 3300041406 Bacteria 3392
100 Ga0439439_0017332 3300041406 Bacteria 1770
101 Ga0451802_2040293 3300041460 Bacteria 1177
102 Ga0451837_0908984 3300041494 Bacteria 2604
103 Ga0451849_0278406 3300041505 Bacteria 1898
104 Ga0451853_0477359 3300041512 Bacteria 6934
105 Ga0451853_1620956 3300041512 Bacteria 4790
106 Ga0451853_1756989 3300041512 Bacteria 4041
107 Ga0451853_3136774 3300041512 Bacteria 1362
108 Ga0439433_0003534 3300041999 Bacteria 3357
109 Ga0439442_001996 3300042002 Bacteria 4014
110 Ga0439448_0006207 3300042005 Bacteria 3429
111 Ga0439449_0000546 3300042007 Bacteria 14105
112 Ga0439449_0035482 3300042007 Bacteria 1856
113 Ga0439455_0001893 3300042012 Bacteria 3666
114 Ga0439457_000628 3300042014 Bacteria 10428
115 Ga0439457_001057 3300042014 Bacteria 8315
116 Ga0439457_016057 3300042014 Bacteria 1670
117 Ga0439462_0004574 3300042015 Bacteria 3385
118 Ga0439462_0017905 3300042015 Bacteria 1838
119 Ga0450894_000318 3300042131 Bacteria 8611
120 Ga0450896_000751 3300042133 Bacteria 3638
121 Ga0450898_001709 3300042134 Bacteria 2949
122 Ga0450899_000742 3300042135 Bacteria 3718
123 Ga0450903_000309 3300042138 Bacteria 10772
124 Ga0450906_003122 3300042145 Bacteria 3581
125 Ga0439458_0000477 3300042157 Bacteria 10257
126 Ga0466969_0001717 3300044656 Bacteria 11702
127 Ga0466972_0007577 3300044658 Bacteria 5450
128 Ga0466972_0016050 3300044658 Bacteria 3744
129 Ga0466972_0186474 3300044658 Bacteria 972
130 Ga0466965_0005326 3300044683 Bacteria 5787
131 Ga0466965_0006928 3300044683 Bacteria 5186
132 Ga0466966_0005819 3300044684 Bacteria 8128
133 Ga0466966_0024933 3300044684 Bacteria 3910
134 Ga0466961_0022375 3300044693 Bacteria 4066
135 Ga0466961_0069628 3300044693 Bacteria 2233
136 Ga0466963_0000269 3300044694 Bacteria 23035
137 Ga0466963_0026384 3300044694 Bacteria 3715
138 Ga0466963_0080608 3300044694 Bacteria 2204
139 Ga0466963_0488942 3300044694 Bacteria 869
140 Ga0466964_0001563 3300044706 Bacteria 7879
141 Ga0466971_0002774 3300044719 Bacteria 7408
142 Ga0466971_0024107 3300044719 Bacteria 2714
143 Ga0466970_0000799 3300044765 Bacteria 15161
144 Ga0466970_0000935 3300044765 Bacteria 14107
145 Ga0466957_0002560 3300044842 Bacteria 9784
146 Ga0466960_0001937 3300044901 Bacteria 7648
147 Ga0466960_0101682 3300044901 Bacteria 1481
148 Ga0466960_0158833 3300044901 Bacteria 1213
149 Ga0466959_0000277 3300045049 Bacteria 31271
150 Ga0466959_0168373 3300045049 Bacteria 1537
151 Ga0466958_0069471 3300045836 Bacteria 2153
152 Ga0466967_0084318 3300045976 Bacteria 2875
153 Ga0466967_0227424 3300045976 Bacteria 1775
154 Ga0495592_0063507 3300046454 Bacteria 2708
155 Ga0495603_0011342 3300046455 Bacteria 5396
156 Ga0495603_0013246 3300046455 Bacteria 4986
157 Ga0495603_0051193 3300046455 Bacteria 2454
158 Ga0495629_0013195 3300046459 Bacteria 5965
159 Ga0495629_0026790 3300046459 Bacteria 4093
160 Ga0495629_0027971 3300046459 Bacteria 4004
161 Ga0495629_0065752 3300046459 Bacteria 2531
162 Ga0495629_0067610 3300046459 Bacteria 2493
163 Ga0495638_0021304 3300046460 Bacteria 4274
164 Ga0495651_0005757 3300046462 Bacteria 9452
165 Ga0495582_0016664 3300046473 Bacteria 4024
166 Ga0495582_0076063 3300046473 Bacteria 1860
167 Ga0495639_0043485 3300046475 Bacteria 2029
168 Ga0495662_0011108 3300046476 Bacteria 4399
169 Ga0495662_0021120 3300046476 Bacteria 3148
170 Ga0495662_0056632 3300046476 Bacteria 1893
171 Ga0495664_0003045 3300046477 Bacteria 9073
172 Ga0495594_0047193 3300046499 Bacteria 2365
173 Ga0495594_0237275 3300046499 Bacteria 1039
174 Ga0495618_0030673 3300046514 Bacteria 3359
175 Ga0495618_0034928 3300046514 Bacteria 3154
176 Ga0495628_0016746 3300046516 Bacteria 6112
177 Ga0495628_0181556 3300046516 Bacteria 1591
178 Ga0495631_0052790 3300046518 Bacteria 1775
179 Ga0495632_0075714 3300046519 Bacteria 1610
180 Ga0495643_0007128 3300046522 Bacteria 7254
181 Ga0495644_0041472 3300046523 Bacteria 1733
182 Ga0495652_0012697 3300046529 Bacteria 7589
183 Ga0495665_0138303 3300046531 Bacteria 1274
184 Ga0495587_0011350 3300046536 Bacteria 5645
185 Ga0495587_0107507 3300046536 Bacteria 1604
186 Ga0495645_0012281 3300046543 Bacteria 6031
187 Ga0495622_0041186 3300046557 Bacteria 2148
188 Ga0495667_0185585 3300046559 Bacteria 1334
189 Ga0495668_0224833 3300046616 Bacteria 1028
190 Ga0495634_0009925 3300046642 Bacteria 6997
191 Ga0495634_0065318 3300046642 Bacteria 2412
192 Ga0495634_0074375 3300046642 Bacteria 2232
193 Ga0495611_0055431 3300046648 Bacteria 1793
194 Ga0495625_0006901 3300046660 Bacteria 10024
195 Ga0495625_0095951 3300046660 Bacteria 2043
196 Ga0495635_0015946 3300046663 Bacteria 5248
197 Ga0495635_0201861 3300046663 Bacteria 1348
198 Ga0495588_0004519 3300046674 Bacteria 6151
199 Ga0495588_0020104 3300046674 Bacteria 3276
200 Ga0495588_0031264 3300046674 Bacteria 2679
201 Ga0495588_0034169 3300046674 Bacteria 2572
202 Ga0495588_0115879 3300046674 Bacteria 1412
203 Ga0495657_0002308 3300046675 Bacteria 16080
204 Ga0495657_0006251 3300046675 Bacteria 9338
205 Ga0495657_0026166 3300046675 Bacteria 4133
206 Ga0495657_0149084 3300046675 Bacteria 1453
207 Ga0495646_0002409 3300046680 Bacteria 11476
208 Ga0495613_0001522 3300046689 Bacteria 17649
209 Ga0495613_0002552 3300046689 Bacteria 13700
210 Ga0495613_0017763 3300046689 Bacteria 5300
211 Ga0495613_0028165 3300046689 Bacteria 4179
212 Ga0495613_0063997 3300046689 Bacteria 2690
213 Ga0495613_0292288 3300046689 Bacteria 1129
214 Ga0495670_0002765 3300046691 Bacteria 8670
215 Ga0495670_0007504 3300046691 Bacteria 5360
216 Ga0495671_0011737 3300046692 Bacteria 4804
217 Ga0495589_0015545 3300046794 Bacteria 3914
218 Ga0495589_0017017 3300046794 Bacteria 3733
219 Ga0495589_0064631 3300046794 Bacteria 1794
220 Ga0495600_0012155 3300046809 Bacteria 5376
221 Ga0495600_0053159 3300046809 Bacteria 2645
222 Ga0495600_0181360 3300046809 Bacteria 1357
223 Ga0495660_0015746 3300046810 Bacteria 4365
224 Ga0495660_0200302 3300046810 Bacteria 954
225 Ga0495581_0073294 3300047315 Bacteria 1981
226 Ga0495604_0000193 3300047317 Bacteria 54925
227 Ga0495604_0041483 3300047317 Bacteria 3610
228 Ga0495636_0003322 3300047318 Bacteria 6238
229 Ga0495636_0006241 3300047318 Bacteria 4682
230 Ga0495636_0019447 3300047318 Bacteria 2731
231 Ga0495636_0022942 3300047318 Bacteria 2525
232 Ga0495636_0051231 3300047318 Bacteria 1730
233 Ga0495676_0003273 3300047321 Bacteria 14633
234 Ga0495676_0030636 3300047321 Bacteria 4560
235 Ga0495676_0076675 3300047321 Bacteria 2551
236 Ga0495676_0246421 3300047321 Bacteria 1221
237 Ga0495680_0011334 3300047322 Bacteria 7901
238 Ga0495683_0075280 3300047323 Bacteria 1653
239 Ga0495687_001866 3300047443 Bacteria 18284
240 Ga0495687_003532 3300047443 Bacteria 11253
241 Ga0495687_078743 3300047443 Bacteria 1297
242 Ga0495687_130585 3300047443 Bacteria 890
243 Ga0495675_0023915 3300047444 Bacteria 3893
244 Ga0495675_0029586 3300047444 Bacteria 3494
245 Ga0495675_0121926 3300047444 Bacteria 1623
246 Ga0495685_002160 3300047447 Bacteria 6105
247 Ga0495685_006828 3300047447 Bacteria 3754
248 Ga0495685_008908 3300047447 Bacteria 3345
249 Ga0495685_009554 3300047447 Bacteria 3244
250 Ga0495685_030121 3300047447 Bacteria 1866
251 Ga0495681_0000899 3300047470 Bacteria 22984
252 Ga0495681_0005860 3300047470 Bacteria 8162
253 Ga0495686_0014862 3300047472 Bacteria 5344
254 Ga0495686_0028880 3300047472 Bacteria 3610
255 Ga0495686_0037065 3300047472 Bacteria 3126
256 Ga0495593_0012117 3300047673 Bacteria 4934
257 Ga0495602_0024302 3300048088 Bacteria 5881
258 Ga0495614_0000315 3300048089 Bacteria 19162
259 Ga0495614_0005439 3300048089 Bacteria 5740
260 Ga0495614_0064639 3300048089 Bacteria 1574
261 Ga0496104_0297160 3300048907 Bacteria 1527
262 Ga0496105_0093407 3300048908 Bacteria 2484
263 Ga0496106_0360732 3300048909 Bacteria 1167
264 Ga0496107_0224578 3300048910 Bacteria 1397
265 Ga0496108_0074169 3300048911 Bacteria 2872
266 Ga0496108_0377044 3300048911 Bacteria 1239
267 Ga0496109_0015388 3300048912 Bacteria 6665
268 Ga0496110_0050851 3300048913 Bacteria 3640
269 Ga0496111_0080861 3300048914 Bacteria 2371
270 Ga0496112_0011305 3300048915 Bacteria 8145
271 Ga0496113_0037936 3300048916 Bacteria 3539
272 Ga0496114_0003065 3300048917 Bacteria 12805
273 Ga0501031_0007150 3300049568 Bacteria 7286
274 Ga0501032_0009664 3300049569 Bacteria 6986
275 Ga0501032_0027138 3300049569 Bacteria 3937
276 Ga0501032_0031395 3300049569 Bacteria 3642
277 Ga0501032_0052270 3300049569 Bacteria 2753
278 Ga0501032_0118478 3300049569 Bacteria 1751
279 Ga0501033_0005953 3300049570 Bacteria 9572
280 Ga0501033_0008220 3300049570 Bacteria 8081
281 Ga0501033_0008675 3300049570 Bacteria 7862
282 Ga0501033_0059916 3300049570 Bacteria 2810
283 Ga0501033_0098396 3300049570 Bacteria 2136
284 Ga0501034_0000700 3300049571 Bacteria 50894
285 Ga0501034_0021616 3300049571 Bacteria 6555
286 Ga0501034_0027701 3300049571 Bacteria 5762
287 Ga0501034_0039336 3300049571 Bacteria 4790
288 Ga0501034_0047309 3300049571 Bacteria 4344
289 Ga0501034_0280333 3300049571 Bacteria 1606
290 Ga0501034_0395436 3300049571 Bacteria 1305
291 Ga0501034_0533115 3300049571 Bacteria 1085
292 Ga0501036_0001673 3300049572 Bacteria 17191
293 Ga0501036_0061630 3300049572 Bacteria 3177
294 Ga0501036_0065063 3300049572 Bacteria 3086
295 Ga0501036_0117586 3300049572 Bacteria 2245
296 Ga0501036_0151564 3300049572 Bacteria 1955
297 Ga0501037_0002374 3300049573 Bacteria 13595
298 Ga0501038_0007174 3300049574 Bacteria 10300
299 Ga0501038_0058235 3300049574 Bacteria 3313
300 Ga0501038_0058616 3300049574 Bacteria 3300
301 Ga0501038_0122361 3300049574 Bacteria 2144
302 Ga0501039_0005978 3300049575 Bacteria 9224
303 Ga0501039_0206593 3300049575 Bacteria 1544
304 Ga0501039_0295309 3300049575 Bacteria 1274
305 Ga0501042_0224407 3300049578 Bacteria 1355
306 Ga0501043_0000581 3300049579 Bacteria 32474
307 Ga0501043_0007143 3300049579 Bacteria 8886
308 Ga0501043_0009724 3300049579 Bacteria 7536
309 Ga0501043_0041822 3300049579 Bacteria 3600
310 Ga0501043_0064885 3300049579 Bacteria 2867
311 Ga0501046_0203910 3300049580 Bacteria 1470
312 Ga0501047_0023599 3300049581 Bacteria 5904
313 Ga0501047_0025567 3300049581 Bacteria 5676
314 Ga0501047_0039856 3300049581 Bacteria 4543
315 Ga0501047_0042397 3300049581 Bacteria 4398
316 Ga0501047_0138596 3300049581 Bacteria 2312
317 Ga0501047_0171466 3300049581 Bacteria 2038
318 Ga0501047_0219532 3300049581 Bacteria 1757
319 Ga0501048_0006648 3300049582 Bacteria 8789
320 Ga0501070_0000252 3300049586 Bacteria 50462
321 Ga0501070_0060149 3300049586 Bacteria 3149
322 Ga0501074_0008891 3300049590 Bacteria 7281
323 Ga0501075_0021394 3300049591 Bacteria 4715
324 Ga0501075_0125414 3300049591 Bacteria 1955
325 Ga0501076_0123412 3300049592 Bacteria 2098
326 Ga0501217_050277 3300049661 Bacteria 1088
327 Ga0501080_0113748 3300049742 Bacteria 2509
328 Ga0501080_0806186 3300049742 Bacteria 823
329 Ga0501081_0041834 3300049743 Bacteria 3140
330 Ga0501035_0000796 3300049822 Bacteria 33545
331 Ga0501035_0009677 3300049822 Bacteria 8964
332 Ga0501035_0026967 3300049822 Bacteria 5253
333 Ga0501035_0029336 3300049822 Bacteria 5016
334 Ga0501035_0035635 3300049822 Bacteria 4514
335 Ga0501035_0055635 3300049822 Bacteria 3532
336 Ga0501035_0109101 3300049822 Bacteria 2426
337 Ga0501044_0003360 3300049823 Bacteria 18042
338 Ga0501044_0005676 3300049823 Bacteria 13833
339 Ga0501044_0006346 3300049823 Bacteria 13072
340 Ga0501044_0028555 3300049823 Bacteria 5888
341 Ga0501044_0054574 3300049823 Bacteria 4107
342 Ga0501044_0102151 3300049823 Bacteria 2883
343 Ga0501044_0383818 3300049823 Bacteria 1319
344 Ga0501044_1082457 3300049823 Bacteria 671
345 Ga0501045_0080023 3300049824 Bacteria 2409
346 Ga0501045_0361595 3300049824 Bacteria 1080
347 Ga0501045_0449200 3300049824 Bacteria 958
348 nmdc:mga03n38_31618_c1 3300050490 Bacteria 2235
349 nmdc:mga0yw44_130338_c1 3300050492 Bacteria 1627
350 nmdc:mga06z11_1208_c1 3300050494 Bacteria 9535
351 nmdc:mga04h51_12509_c1 3300050495 Bacteria 2383
352 nmdc:mga07m45_15478_c1 3300050496 Bacteria 4073
353 nmdc:mga07m45_73577_c1 3300050496 Bacteria 1945
354 Ga0495612_0015303 3300053078 Bacteria 3076
355 Ga0495655_0003047 3300053083 Bacteria 2722
356 Ga0495619_0138178 3300053085 Bacteria 1677
357 Ga0500578_0077850 3300053086 Bacteria 2110
358 Ga0500644_0008719 3300053088 Bacteria 2685
359 Ga0500654_018590 3300053099 Bacteria 4506
360 Ga0500660_018902 3300053100 Bacteria 3683
361 Ga0500560_026600 3300053107 Bacteria 1710
362 Ga0500569_001616 3300053109 Bacteria 4279
363 Ga0500580_147324 3300053113 Bacteria 855
364 Ga0500594_0064454 3300053118 Bacteria 1064
365 Ga0500628_001906 3300053129 Bacteria 3508
366 Ga0500652_001882 3300053131 Bacteria 6319
367 Ga0500658_0025924 3300053134 Bacteria 2255
368 Ga0500573_0015881 3300053140 Bacteria 4271
369 Ga0500573_0061931 3300053140 Bacteria 2143
370 Ga0500579_021148 3300053143 Bacteria 4221
371 Ga0500600_0012518 3300053149 Bacteria 5148
372 Ga0500600_0142776 3300053149 Bacteria 1203
373 Ga0500616_0008471 3300053153 Bacteria 6382
374 Ga0500633_0009574 3300053160 Bacteria 2555
375 Ga0500634_0011771 3300053161 Bacteria 4527
376 Ga0500656_000994 3300053732 Bacteria 2311
377 Ga0500587_003826 3300053739 Bacteria 2089
378 Ga0501084_0278293 3300054114 Bacteria 1413
379 Ga0466962_0026181 3300061719 Bacteria 2801

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0122390 Ga0395900_0122390_2065_2634 189
2 3300049822 Ga0501035_0109101 Ga0501035_0109101_21_590 189
3 3300049823 Ga0501044_1082457 Ga0501044_1082457_83_652 189
4 3300009101 Ga0105247_10177475 Ga0105247_101774752 194
5 3300025900 Ga0207710_10070443 Ga0207710_100704432 194
6 3300046514 Ga0495618_0034928 Ga0495618_0034928_508_1290 202
7 3300046516 Ga0495628_0181556 Ga0495628_0181556_746_1528 202
8 3300046523 Ga0495644_0041472 Ga0495644_0041472_328_1110 202
9 3300046529 Ga0495652_0012697 Ga0495652_0012697_4671_5453 202
10 3300046531 Ga0495665_0138303 Ga0495665_0138303_139_921 202
11 3300046642 Ga0495634_0074375 Ga0495634_0074375_1429_2211 202
12 3300046675 Ga0495657_0026166 Ga0495657_0026166_3076_3858 202
13 3300047322 Ga0495680_0011334 Ga0495680_0011334_5078_5860 202
14 3300047444 Ga0495675_0029586 Ga0495675_0029586_89_871 202
15 3300047472 Ga0495686_0037065 Ga0495686_0037065_893_1675 202
16 3300053085 Ga0495619_0138178 Ga0495619_0138178_18_800 202
17 3300009551 Ga0105238_10251780 Ga0105238_102517802 203
18 3300046455 Ga0495603_0051193 Ga0495603_0051193_345_1136 206
19 3300046499 Ga0495594_0047193 Ga0495594_0047193_467_1258 206
20 3300046557 Ga0495622_0041186 Ga0495622_0041186_684_1475 206
21 3300046674 Ga0495588_0020104 Ga0495588_0020104_519_1310 206
22 3300048911 Ga0496108_0377044 Ga0496108_0377044_427_1218 209
23 3300046475 Ga0495639_0043485 Ga0495639_0043485_25_762 215
24 3300041512 Ga0451853_0477359 Ga0451853_0477359_2245_3006 216
25 3300046476 Ga0495662_0021120 Ga0495662_0021120_1664_2455 216
26 3300046663 Ga0495635_0201861 Ga0495635_0201861_173_964 216
27 3300046675 Ga0495657_0006251 Ga0495657_0006251_2344_3135 216
28 3300046689 Ga0495613_0017763 Ga0495613_0017763_2153_2944 216
29 3300047318 Ga0495636_0022942 Ga0495636_0022942_1514_2344 216
30 3300047443 Ga0495687_001866 Ga0495687_001866_2809_3639 216
31 3300003323 rootH1_10022641 rootH1_100226412 218
32 3300044658 Ga0466972_0186474 Ga0466972_0186474_166_936 219
33 3300044719 Ga0466971_0024107 Ga0466971_0024107_1656_2426 219
34 3300049570 Ga0501033_0008675 Ga0501033_0008675_6478_7248 219
35 3300046455 Ga0495603_0013246 Ga0495603_0013246_1874_2665 223
36 3300046459 Ga0495629_0026790 Ga0495629_0026790_641_1432 223
37 3300046476 Ga0495662_0056632 Ga0495662_0056632_422_1213 223
38 3300046674 Ga0495588_0034169 Ga0495588_0034169_500_1291 223
39 3300049591 Ga0501075_0021394 Ga0501075_0021394_2059_2796 223
40 3300049592 Ga0501076_0123412 Ga0501076_0123412_155_892 223
41 3300054114 Ga0501084_0278293 Ga0501084_0278293_101_838 223
42 iso_pu_bacteria 2969765954 2969769084 223
43 3300003578 Ga0006562J51391_1036491 Ga0006562J51391_10364915 224
44 3300042005 Ga0439448_0006207 Ga0439448_0006207_1633_2406 224
45 3300042012 Ga0439455_0001893 Ga0439455_0001893_2652_3425 224
46 3300042138 Ga0450903_000309 Ga0450903_000309_5157_5930 224
47 3300042157 Ga0439458_0000477 Ga0439458_0000477_5217_5990 224
48 3300049823 Ga0501044_0054574 Ga0501044_0054574_1283_2044 224
49 3300044694 Ga0466963_0000269 Ga0466963_0000269_2350_3123 225
50 3300049572 Ga0501036_0065063 Ga0501036_0065063_574_1335 227
51 3300049568 Ga0501031_0007150 Ga0501031_0007150_6310_7071 228
52 3300049569 Ga0501032_0009664 Ga0501032_0009664_2202_2963 228
53 3300049571 Ga0501034_0021616 Ga0501034_0021616_5271_6032 228
54 3300049573 Ga0501037_0002374 Ga0501037_0002374_10565_11326 228
55 3300049574 Ga0501038_0058235 Ga0501038_0058235_1924_2685 228
56 3300049575 Ga0501039_0206593 Ga0501039_0206593_744_1505 228
57 3300049579 Ga0501043_0009724 Ga0501043_0009724_744_1505 228
58 3300049580 Ga0501046_0203910 Ga0501046_0203910_186_947 228
59 3300049581 Ga0501047_0039856 Ga0501047_0039856_2427_3188 228
60 3300049582 Ga0501048_0006648 Ga0501048_0006648_5240_6001 228
61 3300049822 Ga0501035_0026967 Ga0501035_0026967_1286_2047 228
62 3300049823 Ga0501044_0102151 Ga0501044_0102151_825_1586 228
63 3300005467 Ga0070706_100440813 Ga0070706_1004408131 229
64 3300046616 Ga0495668_0224833 Ga0495668_0224833_57_830 231
65 3300049742 Ga0501080_0806186 Ga0501080_0806186_20_760 231
66 3300049824 Ga0501045_0449200 Ga0501045_0449200_182_922 231
67 3300048909 Ga0496106_0360732 Ga0496106_0360732_120_884 232
68 3300049572 Ga0501036_0061630 Ga0501036_0061630_2333_3094 232
69 3300049591 Ga0501075_0125414 Ga0501075_0125414_25_771 233
70 3300047321 Ga0495676_0246421 Ga0495676_0246421_226_1014 234
71 3300030521 Ga0307511_10137258 Ga0307511_101372582 235
72 3300045976 Ga0466967_0227424 Ga0466967_0227424_177_938 235
73 3300049571 Ga0501034_0533115 Ga0501034_0533115_72_815 235
74 3300049823 Ga0501044_0006346 Ga0501044_0006346_6040_6798 235
75 3300028654 Ga0265322_10000079 Ga0265322_1000007914 236
76 3300031712 Ga0265342_10126356 Ga0265342_101263562 236
77 3300049743 Ga0501081_0041834 Ga0501081_0041834_93_830 237
78 3300032002 Ga0307416_100093496 Ga0307416_1000934962 238
79 3300046518 Ga0495631_0052790 Ga0495631_0052790_228_1004 239
80 3300046691 Ga0495670_0007504 Ga0495670_0007504_3321_4097 239
81 3300046794 Ga0495589_0064631 Ga0495589_0064631_416_1192 239
82 3300048089 Ga0495614_0064639 Ga0495614_0064639_350_1126 239
83 3300033179 Ga0307507_10089864 Ga0307507_100898642 240
84 3300046536 Ga0495587_0011350 Ga0495587_0011350_1671_2432 240
85 3300046642 Ga0495634_0009925 Ga0495634_0009925_2695_3456 240
86 3300046663 Ga0495635_0015946 Ga0495635_0015946_4317_5078 240
87 3300046675 Ga0495657_0002308 Ga0495657_0002308_7819_8580 240
88 3300047317 Ga0495604_0000193 Ga0495604_0000193_18672_19433 240
89 3300047444 Ga0495675_0023915 Ga0495675_0023915_1723_2484 240
90 3300048088 Ga0495602_0024302 Ga0495602_0024302_1619_2380 240
91 iso_pu_bacteria 2554235005 2554256926 241
92 iso_pu_bacteria 2643221587 2643943433 241
93 iso_pu_bacteria 2643221670 2644388594 241
94 iso_pu_bacteria 2643221677 2644429916 241
95 iso_pu_bacteria 2912757875 2912762004 241
96 iso_pu_bacteria 2918501144 2918504504 241
97 iso_pu_bacteria 2643221604 2644036000 242
98 3300044694 Ga0466963_0488942 Ga0466963_0488942_118_852 243
99 3300044901 Ga0466960_0158833 Ga0466960_0158833_415_1149 243
100 iso_pu_bacteria 2767802112 2768644270 243
101 iso_pu_bacteria 2862705112 2862706458 243
102 iso_pu_bacteria 2867346516 2867349009 243
103 iso_pu_bacteria 2990044586 2990045214 243
104 iso_pu_bacteria 8008485437 8008488721 243
105 iso_pu_bacteria 8025524527 8025529480 243
106 iso_pu_bacteria 8033684223 8033687805 243
107 3300003354 JGI25160J50197_1010122 JGI25160J50197_10101223 244
108 3300031616 Ga0307508_10024106 Ga0307508_100241064 244
109 iso_pu_bacteria 2643221697 2644538853 244
110 iso_pu_bacteria 2935390628 2935392421 244
111 3300041406 Ga0439439_0017332 Ga0439439_0017332_487_1284 245
112 3300041999 Ga0439433_0003534 Ga0439433_0003534_1518_2315 245
113 3300042014 Ga0439457_001057 Ga0439457_001057_5477_6274 245
114 3300042015 Ga0439462_0017905 Ga0439462_0017905_416_1213 245
115 3300046459 Ga0495629_0027971 Ga0495629_0027971_1962_2753 245
116 3300046473 Ga0495582_0016664 Ga0495582_0016664_1229_2020 245
117 3300046476 Ga0495662_0011108 Ga0495662_0011108_1439_2230 245
118 3300046536 Ga0495587_0107507 Ga0495587_0107507_584_1321 245
119 3300046543 Ga0495645_0012281 Ga0495645_0012281_4785_5522 245
120 3300046559 Ga0495667_0185585 Ga0495667_0185585_388_1125 245
121 3300046689 Ga0495613_0063997 Ga0495613_0063997_513_1304 245
122 3300046809 Ga0495600_0053159 Ga0495600_0053159_578_1315 245
123 3300047318 Ga0495636_0019447 Ga0495636_0019447_113_850 245
124 3300047444 Ga0495675_0121926 Ga0495675_0121926_530_1267 245
125 3300005338 Ga0068868_100449125 Ga0068868_1004491252 246
126 3300005543 Ga0070672_100253309 Ga0070672_1002533092 246
127 3300006048 Ga0075363_100038668 Ga0075363_1000386683 246
128 3300006353 Ga0075370_10076072 Ga0075370_100760723 246
129 3300009177 Ga0105248_10100778 Ga0105248_101007782 246
130 3300013306 Ga0163162_10170473 Ga0163162_101704732 246
131 3300013308 Ga0157375_10270412 Ga0157375_102704122 246
132 3300014968 Ga0157379_10780499 Ga0157379_107804992 246
133 3300025941 Ga0207711_10628624 Ga0207711_106286242 246
134 3300025944 Ga0207661_10107773 Ga0207661_101077733 246
135 3300025945 Ga0207679_10252627 Ga0207679_102526272 246
136 3300041404 Ga0439436_0036860 Ga0439436_0036860_476_1273 246
137 3300042014 Ga0439457_016057 Ga0439457_016057_633_1418 246
138 3300042131 Ga0450894_000318 Ga0450894_000318_6700_7485 246
139 3300042133 Ga0450896_000751 Ga0450896_000751_1838_2623 246
140 3300042134 Ga0450898_001709 Ga0450898_001709_1068_1853 246
141 3300042135 Ga0450899_000742 Ga0450899_000742_810_1595 246
142 3300042145 Ga0450906_003122 Ga0450906_003122_1174_1959 246
143 3300048907 Ga0496104_0297160 Ga0496104_0297160_108_857 246
144 3300048908 Ga0496105_0093407 Ga0496105_0093407_95_844 246
145 3300048910 Ga0496107_0224578 Ga0496107_0224578_566_1315 246
146 3300048911 Ga0496108_0074169 Ga0496108_0074169_94_843 246
147 3300048912 Ga0496109_0015388 Ga0496109_0015388_2712_3461 246
148 3300048913 Ga0496110_0050851 Ga0496110_0050851_1685_2434 246
149 3300048914 Ga0496111_0080861 Ga0496111_0080861_1260_2009 246
150 3300048915 Ga0496112_0011305 Ga0496112_0011305_2809_3558 246
151 3300048916 Ga0496113_0037936 Ga0496113_0037936_457_1206 246
152 3300048917 Ga0496114_0003065 Ga0496114_0003065_7427_8176 246
153 3300049822 Ga0501035_0055635 Ga0501035_0055635_1274_2044 246
154 3300050490 nmdc:mga03n38_31618_c1 nmdc:mga03n38_31618_c1_616_1401 246
155 3300050496 nmdc:mga07m45_73577_c1 nmdc:mga07m45_73577_c1_1053_1838 246
156 3300053140 Ga0500573_0061931 Ga0500573_0061931_1099_1893 247
157 iso_pu_bacteria 2582581314 2585319108 247
158 3300046648 Ga0495611_0055431 Ga0495611_0055431_490_1266 248
159 3300047318 Ga0495636_0003322 Ga0495636_0003322_3933_4709 248
160 3300047447 Ga0495685_030121 Ga0495685_030121_814_1590 248
161 iso_pu_bacteria 2582581312 2585301258 248
162 iso_pu_bacteria 2616644941 2616904754 248
163 iso_pu_bacteria 2643221548 2643765800 248
164 iso_pu_bacteria 2643221682 2644459911 248
165 iso_pu_bacteria 2808606982 2811845242 248
166 iso_pu_bacteria 2862178590 2862181636 248
167 3300041494 Ga0451837_0908984 Ga0451837_0908984_861_1616 249
168 iso_pu_bacteria 2616644814 2616696941 249
169 iso_pu_bacteria 2867369537 2867373083 249
170 iso_pu_bacteria 2867475112 2867480335 249
171 iso_pu_bacteria 2873151551 2873154858 249
172 3300006038 Ga0075365_10034789 Ga0075365_100347892 250
173 3300049569 Ga0501032_0052270 Ga0501032_0052270_1379_2149 250
174 3300049570 Ga0501033_0008220 Ga0501033_0008220_4614_5384 250
175 3300049571 Ga0501034_0047309 Ga0501034_0047309_2172_2942 250
176 3300049572 Ga0501036_0117586 Ga0501036_0117586_92_862 250
177 3300049581 Ga0501047_0042397 Ga0501047_0042397_2635_3405 250
178 3300049822 Ga0501035_0035635 Ga0501035_0035635_2475_3245 250
179 iso_pu_bacteria 2791355406 2793979189 250
180 iso_pu_bacteria 2997451912 2997458110 250
181 iso_pu_bacteria 8047893842 8047897101 250
182 iso_pu_bacteria 8048127548 8048134722 250
183 iso_pu_bacteria 8048356638 8048361851 250
184 iso_pu_bacteria 8048369669 8048374085 250
185 iso_pu_bacteria 8048379754 8048384141 250
186 iso_pu_bacteria 8054160619 8054160688 250
187 3300028794 Ga0307515_10453609 Ga0307515_104536091 251
188 3300030521 Ga0307511_10000481 Ga0307511_1000048124 251
189 3300030522 Ga0307512_10012662 Ga0307512_100126622 251
190 3300031456 Ga0307513_10077036 Ga0307513_100770362 251
191 3300031507 Ga0307509_10082599 Ga0307509_100825992 251
192 3300031507 Ga0307509_10091720 Ga0307509_100917203 251
193 3300031730 Ga0307516_10008581 Ga0307516_100085813 251
194 3300031838 Ga0307518_10096157 Ga0307518_100961572 251
195 3300031838 Ga0307518_10145373 Ga0307518_101453732 251
196 3300038443 Ga0395901_0480146 Ga0395901_0480146_160_930 251
197 3300042007 Ga0439449_0000546 Ga0439449_0000546_2301_3059 251
198 3300044658 Ga0466972_0016050 Ga0466972_0016050_2816_3577 251
199 3300044683 Ga0466965_0005326 Ga0466965_0005326_3240_4001 251
200 3300044694 Ga0466963_0026384 Ga0466963_0026384_22_783 251
201 3300044719 Ga0466971_0002774 Ga0466971_0002774_3239_4000 251
202 3300044765 Ga0466970_0000799 Ga0466970_0000799_8943_9704 251
203 3300044842 Ga0466957_0002560 Ga0466957_0002560_3720_4481 251
204 3300045049 Ga0466959_0000277 Ga0466959_0000277_26974_27735 251
205 3300045836 Ga0466958_0069471 Ga0466958_0069471_862_1623 251
206 3300046454 Ga0495592_0063507 Ga0495592_0063507_43_804 251
207 3300046459 Ga0495629_0065752 Ga0495629_0065752_100_861 251
208 3300046460 Ga0495638_0021304 Ga0495638_0021304_832_1593 251
209 3300046462 Ga0495651_0005757 Ga0495651_0005757_7414_8175 251
210 3300046473 Ga0495582_0076063 Ga0495582_0076063_407_1168 251
211 3300046477 Ga0495664_0003045 Ga0495664_0003045_1960_2721 251
212 3300046514 Ga0495618_0030673 Ga0495618_0030673_2459_3220 251
213 3300046516 Ga0495628_0016746 Ga0495628_0016746_932_1693 251
214 3300046680 Ga0495646_0002409 Ga0495646_0002409_9045_9806 251
215 3300046689 Ga0495613_0001522 Ga0495613_0001522_7072_7833 251
216 3300046794 Ga0495589_0015545 Ga0495589_0015545_2307_3068 251
217 3300046809 Ga0495600_0012155 Ga0495600_0012155_4445_5206 251
218 3300047318 Ga0495636_0051231 Ga0495636_0051231_209_970 251
219 3300047321 Ga0495676_0076675 Ga0495676_0076675_1620_2381 251
220 3300047443 Ga0495687_003532 Ga0495687_003532_8174_8935 251
221 3300047443 Ga0495687_130585 Ga0495687_130585_34_795 251
222 3300047447 Ga0495685_009554 Ga0495685_009554_1319_2080 251
223 3300047673 Ga0495593_0012117 Ga0495593_0012117_2503_3264 251
224 3300049569 Ga0501032_0118478 Ga0501032_0118478_537_1298 251
225 3300049570 Ga0501033_0005953 Ga0501033_0005953_3981_4742 251
226 3300049571 Ga0501034_0000700 Ga0501034_0000700_38207_38968 251
227 3300049571 Ga0501034_0395436 Ga0501034_0395436_275_1036 251
228 3300049572 Ga0501036_0001673 Ga0501036_0001673_6058_6819 251
229 3300049574 Ga0501038_0122361 Ga0501038_0122361_44_805 251
230 3300049575 Ga0501039_0005978 Ga0501039_0005978_6846_7607 251
231 3300049579 Ga0501043_0000581 Ga0501043_0000581_27065_27826 251
232 3300049581 Ga0501047_0023599 Ga0501047_0023599_3438_4199 251
233 3300049586 Ga0501070_0000252 Ga0501070_0000252_34106_34867 251
234 3300049590 Ga0501074_0008891 Ga0501074_0008891_3571_4332 251
235 3300049822 Ga0501035_0000796 Ga0501035_0000796_12950_13711 251
236 3300049823 Ga0501044_0003360 Ga0501044_0003360_17252_18013 251
237 3300053078 Ga0495612_0015303 Ga0495612_0015303_2247_3008 251
238 3300053088 Ga0500644_0008719 Ga0500644_0008719_1187_1948 251
239 iso_pu_bacteria 2582581313 2585308262 251
240 iso_pu_bacteria 2643221578 2643898391 251
241 iso_pu_bacteria 2643221647 2644261772 251
242 iso_pu_bacteria 2643221673 2644403738 251
243 iso_pu_bacteria 2643221678 2644439161 251
244 iso_pu_bacteria 2643221714 2644632395 251
245 iso_pu_bacteria 2784132148 2784589535 251
246 iso_pu_bacteria 2784746768 2785370604 251
247 iso_pu_bacteria 2786546132 2786671786 251
248 iso_pu_bacteria 2808606359 2808843164 251
249 iso_pu_bacteria 2808606375 2808921528 251
250 iso_pu_bacteria 2808606448 2809233207 251
251 iso_pu_bacteria 2811994917 2812479613 251
252 iso_pu_bacteria 2818991463 2819698039 251
253 iso_pu_bacteria 2852635781 2852640534 251
254 iso_pu_bacteria 2867428634 2867435494 251
255 iso_pu_bacteria 2875391855 2875394567 251
256 iso_pu_bacteria 2877676314 2877679975 251
257 iso_pu_bacteria 2912715099 2912718605 251
258 iso_pu_bacteria 2919468124 2919475823 251
259 iso_pu_bacteria 2946045630 2946050072 251
260 iso_pu_bacteria 2946064051 2946068935 251
261 iso_pu_bacteria 2946072368 2946076951 251
262 iso_pu_bacteria 2954380949 2954384941 251
263 iso_pu_bacteria 2954673503 2954678062 251
264 iso_pu_bacteria 2954682443 2954686096 251
265 iso_pu_bacteria 2954691527 2954695753 251
266 iso_pu_bacteria 2954701450 2954710945 251
267 iso_pu_bacteria 2954711539 2954715163 251
268 iso_pu_bacteria 2954721474 2954725105 251
269 iso_pu_bacteria 2954731030 2954736713 251
270 iso_pu_bacteria 2954740390 2954744037 251
271 iso_pu_bacteria 2954749733 2954755560 251
272 iso_pu_bacteria 2966598605 2966602604 251
273 iso_pu_bacteria 2990059506 2990063074 251
274 iso_pu_bacteria 3006493962 3006499732 251
275 iso_pu_bacteria 8023623736 8023626316 251
276 3300003578 Ga0006562J51391_1076094 Ga0006562J51391_10760942 252
277 3300003578 Ga0006562J51391_1076095 Ga0006562J51391_10760952 252
278 3300005455 Ga0070663_100291202 Ga0070663_1002912022 252
279 3300005548 Ga0070665_100517424 Ga0070665_1005174241 252
280 3300005937 Ga0081455_10028999 Ga0081455_100289993 252
281 3300005937 Ga0081455_10496869 Ga0081455_104968691 252
282 3300006042 Ga0075368_10026788 Ga0075368_100267882 252
283 3300006178 Ga0075367_10001154 Ga0075367_100011545 252
284 3300006353 Ga0075370_10017476 Ga0075370_100174763 252
285 3300006948 Ga0099826_10046055 Ga0099826_100460552 252
286 3300009148 Ga0105243_10345761 Ga0105243_103457612 252
287 3300009551 Ga0105238_10189328 Ga0105238_101893282 252
288 3300014497 Ga0182008_10005072 Ga0182008_100050727 252
289 3300015261 Ga0182006_1013567 Ga0182006_10135672 252
290 3300015262 Ga0182007_10001147 Ga0182007_100011479 252
291 3300015265 Ga0182005_1018546 Ga0182005_10185463 252
292 3300015688 Ga0183367_1002 Ga0183367_1002990 252
293 3300025297 Ga0209758_1007687 Ga0209758_10076876 252
294 3300025935 Ga0207709_10134693 Ga0207709_101346932 252
295 3300025940 Ga0207691_10111372 Ga0207691_101113724 252
296 3300026041 Ga0207639_10061876 Ga0207639_100618762 252
297 3300027312 Ga0209371_1013366 Ga0209371_10133662 252
298 3300027866 Ga0209813_10010733 Ga0209813_100107332 252
299 3300028379 Ga0268266_10312406 Ga0268266_103124062 252
300 3300028786 Ga0307517_10002771 Ga0307517_1000277116 252
301 3300028794 Ga0307515_10000258 Ga0307515_1000025888 252
302 3300028794 Ga0307515_10163223 Ga0307515_101632232 252
303 3300030500 Ga0268256_1014709 Ga0268256_10147093 252
304 3300030522 Ga0307512_10003476 Ga0307512_100034768 252
305 3300031456 Ga0307513_10048766 Ga0307513_100487662 252
306 3300031456 Ga0307513_10054039 Ga0307513_100540392 252
307 3300031507 Ga0307509_10186968 Ga0307509_101869682 252
308 3300031616 Ga0307508_10033261 Ga0307508_100332615 252
309 3300031616 Ga0307508_10054666 Ga0307508_100546663 252
310 3300031649 Ga0307514_10003034 Ga0307514_100030344 252
311 3300031730 Ga0307516_10010912 Ga0307516_100109122 252
312 3300031852 Ga0307410_10074955 Ga0307410_100749552 252
313 3300032002 Ga0307416_100744631 Ga0307416_1007446312 252
314 3300033179 Ga0307507_10042414 Ga0307507_100424143 252
315 3300033179 Ga0307507_10288781 Ga0307507_102887811 252
316 3300033180 Ga0307510_10061942 Ga0307510_100619424 252
317 3300033180 Ga0307510_10172496 Ga0307510_101724962 252
318 3300037418 Ga0395900_0026984 Ga0395900_0026984_351_1109 252
319 3300037466 Ga0395898_0002008 Ga0395898_0002008_9896_10654 252
320 3300037466 Ga0395898_0008001 Ga0395898_0008001_7866_8636 252
321 3300037471 Ga0395905_0201257 Ga0395905_0201257_943_1701 252
322 3300038443 Ga0395901_0006887 Ga0395901_0006887_6580_7338 252
323 3300041406 Ga0439439_0003698 Ga0439439_0003698_316_1089 252
324 3300041460 Ga0451802_2040293 Ga0451802_2040293_109_906 252
325 3300041505 Ga0451849_0278406 Ga0451849_0278406_765_1538 252
326 3300041512 Ga0451853_1620956 Ga0451853_1620956_1727_2512 252
327 3300041512 Ga0451853_1756989 Ga0451853_1756989_1455_2225 252
328 3300041512 Ga0451853_3136774 Ga0451853_3136774_366_1160 252
329 3300042002 Ga0439442_001996 Ga0439442_001996_1754_2527 252
330 3300042007 Ga0439449_0035482 Ga0439449_0035482_498_1277 252
331 3300042014 Ga0439457_000628 Ga0439457_000628_3812_4585 252
332 3300042015 Ga0439462_0004574 Ga0439462_0004574_2147_2920 252
333 3300044656 Ga0466969_0001717 Ga0466969_0001717_3908_4684 252
334 3300044658 Ga0466972_0007577 Ga0466972_0007577_2378_3151 252
335 3300044683 Ga0466965_0006928 Ga0466965_0006928_4045_4818 252
336 3300044684 Ga0466966_0024933 Ga0466966_0024933_844_1620 252
337 3300044693 Ga0466961_0022375 Ga0466961_0022375_692_1468 252
338 3300044693 Ga0466961_0069628 Ga0466961_0069628_1135_1908 252
339 3300044694 Ga0466963_0080608 Ga0466963_0080608_664_1434 252
340 3300044706 Ga0466964_0001563 Ga0466964_0001563_1204_1974 252
341 3300044765 Ga0466970_0000935 Ga0466970_0000935_2411_3175 252
342 3300044901 Ga0466960_0001937 Ga0466960_0001937_3926_4699 252
343 3300044901 Ga0466960_0101682 Ga0466960_0101682_353_1126 252
344 3300045049 Ga0466959_0168373 Ga0466959_0168373_635_1411 252
345 3300045976 Ga0466967_0084318 Ga0466967_0084318_593_1363 252
346 3300046455 Ga0495603_0011342 Ga0495603_0011342_361_1125 252
347 3300046459 Ga0495629_0013195 Ga0495629_0013195_3942_4706 252
348 3300046499 Ga0495594_0237275 Ga0495594_0237275_77_841 252
349 3300046660 Ga0495625_0006901 Ga0495625_0006901_2936_3703 252
350 3300046660 Ga0495625_0095951 Ga0495625_0095951_1148_1921 252
351 3300046674 Ga0495588_0004519 Ga0495588_0004519_88_855 252
352 3300046689 Ga0495613_0002552 Ga0495613_0002552_3365_4129 252
353 3300046689 Ga0495613_0292288 Ga0495613_0292288_203_967 252
354 3300046692 Ga0495671_0011737 Ga0495671_0011737_410_1177 252
355 3300046810 Ga0495660_0200302 Ga0495660_0200302_98_871 252
356 3300047315 Ga0495581_0073294 Ga0495581_0073294_345_1109 252
357 3300047318 Ga0495636_0006241 Ga0495636_0006241_2102_2893 252
358 3300047321 Ga0495676_0003273 Ga0495676_0003273_13509_14273 252
359 3300047447 Ga0495685_006828 Ga0495685_006828_2065_2838 252
360 3300047447 Ga0495685_008908 Ga0495685_008908_567_1358 252
361 3300047470 Ga0495681_0000899 Ga0495681_0000899_14019_14786 252
362 3300047472 Ga0495686_0014862 Ga0495686_0014862_4175_4966 252
363 3300048089 Ga0495614_0000315 Ga0495614_0000315_9358_10122 252
364 3300048089 Ga0495614_0005439 Ga0495614_0005439_43_810 252
365 3300049571 Ga0501034_0039336 Ga0501034_0039336_734_1504 252
366 3300049574 Ga0501038_0058616 Ga0501038_0058616_1980_2750 252
367 3300049575 Ga0501039_0295309 Ga0501039_0295309_339_1109 252
368 3300049578 Ga0501042_0224407 Ga0501042_0224407_399_1169 252
369 3300049579 Ga0501043_0064885 Ga0501043_0064885_1904_2674 252
370 3300049581 Ga0501047_0025567 Ga0501047_0025567_2126_2896 252
371 3300049581 Ga0501047_0171466 Ga0501047_0171466_1134_1904 252
372 3300049661 Ga0501217_050277 Ga0501217_050277_265_1035 252
373 3300049742 Ga0501080_0113748 Ga0501080_0113748_1691_2461 252
374 3300049822 Ga0501035_0029336 Ga0501035_0029336_1497_2267 252
375 3300049823 Ga0501044_0028555 Ga0501044_0028555_3293_4063 252
376 3300049824 Ga0501045_0361595 Ga0501045_0361595_45_815 252
377 3300050492 nmdc:mga0yw44_130338_c1 nmdc:mga0yw44_130338_c1_348_1145 252
378 3300050494 nmdc:mga06z11_1208_c1 nmdc:mga06z11_1208_c1_1779_2549 252
379 3300050495 nmdc:mga04h51_12509_c1 nmdc:mga04h51_12509_c1_297_1067 252
380 3300050496 nmdc:mga07m45_15478_c1 nmdc:mga07m45_15478_c1_1427_2191 252
381 3300053107 Ga0500560_026600 Ga0500560_026600_919_1686 252
382 3300053149 Ga0500600_0142776 Ga0500600_0142776_11_784 252
383 iso_pu_bacteria 2784746763 2785342051 252
384 iso_pu_bacteria 2862281513 2862286917 252
385 iso_pu_bacteria 2862382967 2862390740 252
386 iso_pu_bacteria 2862507626 2862514496 252
387 iso_pu_bacteria 2863404153 2863411733 252
388 iso_pu_bacteria 2912723979 2912730931 252
389 iso_pu_bacteria 2954002825 2954002926 252
390 iso_pu_bacteria 3006393351 3006396412 252
391 iso_pu_bacteria 8008558824 8008566362 252
392 iso_pu_bacteria 8025530807 8025534887 252
393 iso_pu_bacteria 8048406513 8048412474 252
394 iso_pu_bacteria 8056667051 8056672743 252
395 iso_pu_bacteria 8056829672 8056833816 252
396 3300003316 rootH1_10004290 rootH1_100042907 253
397 3300003320 rootH2_10048161 rootH2_100481612 253
398 3300003323 rootH1_10022642 rootH1_100226422 253
399 3300003354 JGI25160J50197_1038064 JGI25160J50197_10380642 253
400 3300021388 Ga0213875_10101146 Ga0213875_101011462 253
401 3300025302 Ga0207426_1001814 Ga0207426_10018145 253
402 3300025302 Ga0207426_1002214 Ga0207426_10022142 253
403 3300028786 Ga0307517_10001546 Ga0307517_1000154628 253
404 3300030521 Ga0307511_10153403 Ga0307511_101534032 253
405 3300031616 Ga0307508_10002380 Ga0307508_1000238013 253
406 3300031730 Ga0307516_10022336 Ga0307516_100223363 253
407 3300031730 Ga0307516_10028899 Ga0307516_100288994 253
408 3300033179 Ga0307507_10122122 Ga0307507_101221222 253
409 3300037853 Ga0436364_0233589 Ga0436364_0233589_1811_2578 253
410 3300044684 Ga0466966_0005819 Ga0466966_0005819_5454_6224 253
411 3300046459 Ga0495629_0067610 Ga0495629_0067610_1364_2128 253
412 3300046519 Ga0495632_0075714 Ga0495632_0075714_312_1076 253
413 3300046522 Ga0495643_0007128 Ga0495643_0007128_4046_4810 253
414 3300046642 Ga0495634_0065318 Ga0495634_0065318_462_1226 253
415 3300046674 Ga0495588_0031264 Ga0495588_0031264_1116_1889 253
416 3300046674 Ga0495588_0115879 Ga0495588_0115879_247_1011 253
417 3300046675 Ga0495657_0149084 Ga0495657_0149084_504_1274 253
418 3300046689 Ga0495613_0028165 Ga0495613_0028165_1841_2605 253
419 3300046691 Ga0495670_0002765 Ga0495670_0002765_1741_2505 253
420 3300046794 Ga0495589_0017017 Ga0495589_0017017_1842_2606 253
421 3300046809 Ga0495600_0181360 Ga0495600_0181360_563_1333 253
422 3300046810 Ga0495660_0015746 Ga0495660_0015746_1309_2073 253
423 3300047317 Ga0495604_0041483 Ga0495604_0041483_2085_2855 253
424 3300047321 Ga0495676_0030636 Ga0495676_0030636_1497_2273 253
425 3300047323 Ga0495683_0075280 Ga0495683_0075280_423_1187 253
426 3300047443 Ga0495687_078743 Ga0495687_078743_486_1250 253
427 3300047447 Ga0495685_002160 Ga0495685_002160_1851_2615 253
428 3300047470 Ga0495681_0005860 Ga0495681_0005860_6610_7374 253
429 3300047472 Ga0495686_0028880 Ga0495686_0028880_1007_1771 253
430 3300049569 Ga0501032_0027138 Ga0501032_0027138_2295_3062 253
431 3300049569 Ga0501032_0031395 Ga0501032_0031395_1553_2317 253
432 3300049570 Ga0501033_0059916 Ga0501033_0059916_900_1667 253
433 3300049570 Ga0501033_0098396 Ga0501033_0098396_47_811 253
434 3300049571 Ga0501034_0027701 Ga0501034_0027701_1345_2109 253
435 3300049571 Ga0501034_0280333 Ga0501034_0280333_509_1276 253
436 3300049572 Ga0501036_0151564 Ga0501036_0151564_450_1214 253
437 3300049574 Ga0501038_0007174 Ga0501038_0007174_8336_9100 253
438 3300049579 Ga0501043_0007143 Ga0501043_0007143_801_1565 253
439 3300049579 Ga0501043_0041822 Ga0501043_0041822_1986_2753 253
440 3300049581 Ga0501047_0138596 Ga0501047_0138596_1079_1846 253
441 3300049581 Ga0501047_0219532 Ga0501047_0219532_642_1406 253
442 3300049586 Ga0501070_0060149 Ga0501070_0060149_477_1241 253
443 3300049822 Ga0501035_0009677 Ga0501035_0009677_1935_2702 253
444 3300049823 Ga0501044_0005676 Ga0501044_0005676_8543_9310 253
445 3300049823 Ga0501044_0383818 Ga0501044_0383818_509_1273 253
446 3300049824 Ga0501045_0080023 Ga0501045_0080023_1284_2048 253
447 3300053083 Ga0495655_0003047 Ga0495655_0003047_573_1337 253
448 3300053086 Ga0500578_0077850 Ga0500578_0077850_789_1553 253
449 3300053099 Ga0500654_018590 Ga0500654_018590_3064_3828 253
450 3300053100 Ga0500660_018902 Ga0500660_018902_67_831 253
451 3300053109 Ga0500569_001616 Ga0500569_001616_1848_2612 253
452 3300053113 Ga0500580_147324 Ga0500580_147324_42_806 253
453 3300053118 Ga0500594_0064454 Ga0500594_0064454_24_788 253
454 3300053129 Ga0500628_001906 Ga0500628_001906_1014_1778 253
455 3300053131 Ga0500652_001882 Ga0500652_001882_2061_2825 253
456 3300053134 Ga0500658_0025924 Ga0500658_0025924_806_1570 253
457 3300053140 Ga0500573_0015881 Ga0500573_0015881_1675_2448 253
458 3300053143 Ga0500579_021148 Ga0500579_021148_1852_2616 253
459 3300053149 Ga0500600_0012518 Ga0500600_0012518_2991_3755 253
460 3300053153 Ga0500616_0008471 Ga0500616_0008471_95_859 253
461 3300053160 Ga0500633_0009574 Ga0500633_0009574_1528_2292 253
462 3300053161 Ga0500634_0011771 Ga0500634_0011771_1871_2635 253
463 3300053732 Ga0500656_000994 Ga0500656_000994_1005_1769 253
464 3300053739 Ga0500587_003826 Ga0500587_003826_209_973 253
465 3300061719 Ga0466962_0026181 Ga0466962_0026181_1198_1968 253
466 iso_pu_bacteria 2802429296 2804845739 253
467 iso_pu_bacteria 2862574272 2862578328 253
468 iso_pu_bacteria 2990088156 2990090303 253
469 iso_pu_bacteria 3006425503 3006428918 253
470 iso_pu_bacteria 3006486233 3006493726 253
471 iso_pu_bacteria 8025413630 8025416920 253
472 iso_pu_bacteria 8025478263 8025479994 253
473 iso_pu_bacteria 8056447290 8056454384 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02683

DsbD

Cytochrome C biogenesis protein transmembrane region

34

244

0.97

Feature Viewer

pLDDT pTM Quality
58.06 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map