F451067

General Info

Members Datasets Scaffolds Average Seq Length
473 223 946 218

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0238737|Ga0466967_0238737_543_1289
Length 248
Sequence MTTLAHEGWAARLVAIDASTYGGTVAVLRDGRVVAERTVAMRGEREERLMPTVVEALGAAGVQPGGLAGVVCGAGPGSFTSLRIAASIAKGIAQGTGTPLYAAPSLALLVGAVRPVLAPGRYLAALDALRGESYAAIVSVELDARGACVVVGYDYRGIVPTAALAELARHGEATMLRVEGSSGTGEGIAPRARGVVALARLLADSGPVDLDAWEPDYGRKAEAQVKWETAHGRALPPAVDTADVGSGT

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
180 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
181 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.11
Rhizosphere 96.41
Stem 0
Stem Tuber 0
Unclassified 11.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0238737 3300045976 Bacteria 1733
2 Ga0070658_10006108 3300005327 Bacteria 9767
3 Ga0070658_10017935 3300005327 Bacteria 5661
4 Ga0070658_10194174 3300005327 Bacteria 1712
5 Ga0070676_10043548 3300005328 Bacteria 2609
6 Ga0070683_100016694 3300005329 Bacteria 6477
7 Ga0070683_100048494 3300005329 Bacteria 3927
8 Ga0070683_100067978 3300005329 Bacteria 3319
9 Ga0070683_100074424 3300005329 Bacteria 3172
10 Ga0070683_100149111 3300005329 Unclassified 2217
11 Ga0070683_100173132 3300005329 Bacteria 2049
12 Ga0070683_101018841 3300005329 Bacteria 795
13 Ga0070690_100313212 3300005330 Bacteria 1129
14 Ga0070690_100368901 3300005330 Bacteria 1047
15 Ga0070670_100003047 3300005331 Bacteria 13863
16 Ga0070670_100020537 3300005331 Bacteria 5679
17 Ga0070670_100130359 3300005331 Bacteria 2171
18 Ga0070670_100231146 3300005331 Bacteria 1609
19 Ga0070670_100336274 3300005331 Bacteria 1325
20 Ga0068869_100002948 3300005334 Bacteria 10334
21 Ga0068869_100255283 3300005334 Bacteria 1402
22 Ga0070666_10429791 3300005335 Bacteria 952
23 Ga0070680_100027361 3300005336 Bacteria 4566
24 Ga0070680_100249245 3300005336 Bacteria 1501
25 Ga0070680_100431856 3300005336 Bacteria 1124
26 Ga0070682_100019746 3300005337 Bacteria 3958
27 Ga0068868_100014082 3300005338 Bacteria 5887
28 Ga0068868_100055300 3300005338 Bacteria 3131
29 Ga0070660_100034573 3300005339 Bacteria 3819
30 Ga0070660_100087882 3300005339 Bacteria 2447
31 Ga0070689_100106373 3300005340 Bacteria 2226
32 Ga0070689_100110002 3300005340 Bacteria 2190
33 Ga0070691_10166946 3300005341 Bacteria 1138
34 Ga0070687_100020259 3300005343 Bacteria 3107
35 Ga0070661_100003949 3300005344 Bacteria 10200
36 Ga0070661_100036309 3300005344 Bacteria 3582
37 Ga0070661_100036471 3300005344 Bacteria 3574
38 Ga0070661_100157992 3300005344 Bacteria 1716
39 Ga0070661_100158763 3300005344 Bacteria 1712
40 Ga0070661_100490140 3300005344 Archaea 983
41 Ga0070692_10274119 3300005345 Bacteria 1020
42 Ga0070668_100005385 3300005347 Bacteria 9496
43 Ga0070668_100217834 3300005347 Bacteria 1573
44 Ga0070669_100001077 3300005353 Bacteria 19996
45 Ga0070669_100019980 3300005353 Bacteria 4783
46 Ga0070669_100084998 3300005353 Bacteria 2362
47 Ga0070675_100006582 3300005354 Bacteria 8933
48 Ga0070675_100006714 3300005354 Bacteria 8849
49 Ga0070675_100017468 3300005354 Bacteria 5700
50 Ga0070675_100158846 3300005354 Bacteria 1943
51 Ga0070671_100054674 3300005355 Bacteria 3319
52 Ga0070671_100469226 3300005355 Bacteria 1081
53 Ga0070673_100014725 3300005364 Bacteria 5463
54 Ga0070673_100117720 3300005364 Bacteria 2211
55 Ga0070673_100166546 3300005364 Bacteria 1878
56 Ga0070673_100253185 3300005364 Unclassified 1536
57 Ga0070688_100016926 3300005365 Bacteria 4176
58 Ga0070688_100355467 3300005365 Bacteria 1074
59 Ga0070659_100000762 3300005366 Bacteria 23407
60 Ga0070659_100019720 3300005366 Bacteria 5116
61 Ga0070659_100038987 3300005366 Bacteria 3707
62 Ga0070659_100075931 3300005366 Bacteria 2679
63 Ga0070659_100334120 3300005366 Bacteria 1269
64 Ga0070667_100160559 3300005367 Bacteria 1979
65 Ga0070667_100167700 3300005367 Bacteria 1937
66 Ga0070667_100280617 3300005367 Bacteria 1496
67 Ga0070703_10102688 3300005406 Unclassified 1010
68 Ga0070701_10025793 3300005438 Bacteria 2859
69 Ga0070701_10113830 3300005438 Bacteria 1515
70 Ga0070700_100037021 3300005441 Bacteria 2964
71 Ga0070700_100860631 3300005441 Unclassified 735
72 Ga0070694_100083398 3300005444 Bacteria 2227
73 Ga0070694_100090278 3300005444 Bacteria 2148
74 Ga0070708_100000486 3300005445 Bacteria 30121
75 Ga0070663_100029019 3300005455 Bacteria 3774
76 Ga0070678_100243191 3300005456 Unclassified 1506
77 Ga0070678_100267372 3300005456 Bacteria 1441
78 Ga0070678_100620790 3300005456 Unclassified 967
79 Ga0070662_100034020 3300005457 Bacteria 3592
80 Ga0070662_100158450 3300005457 Bacteria 1769
81 Ga0070662_100322674 3300005457 Unclassified 1259
82 Ga0070681_10000084 3300005458 Bacteria 70932
83 Ga0070681_10000157 3300005458 Bacteria 52119
84 Ga0068867_100057498 3300005459 Bacteria 2881
85 Ga0068867_100314345 3300005459 Bacteria 1295
86 Ga0068867_101530240 3300005459 Bacteria 622
87 Ga0070706_100541042 3300005467 Unclassified 1083
88 Ga0070707_100022241 3300005468 Bacteria 5994
89 Ga0070698_100000081 3300005471 Bacteria 73806
90 Ga0070698_100111991 3300005471 Bacteria 2694
91 Ga0070699_100057684 3300005518 Bacteria 3363
92 Ga0070699_100058773 3300005518 Bacteria 3331
93 Ga0070679_100003796 3300005530 Bacteria 13868
94 Ga0070679_100023283 3300005530 Bacteria 6061
95 Ga0070679_100023474 3300005530 Bacteria 6038
96 Ga0070684_100001180 3300005535 Bacteria 18777
97 Ga0070684_100006795 3300005535 Bacteria 8872
98 Ga0070684_100045917 3300005535 Bacteria 3784
99 Ga0070684_100168011 3300005535 Bacteria 1992
100 Ga0070684_100241785 3300005535 Unclassified 1649
101 Ga0070684_100243648 3300005535 Unclassified 1643
102 Ga0070684_100330670 3300005535 Bacteria 1400
103 Ga0070684_100493197 3300005535 Unclassified 1134
104 Ga0070697_100107613 3300005536 Unclassified 2320
105 Ga0068853_100013132 3300005539 Bacteria 6758
106 Ga0068853_100148747 3300005539 Bacteria 2107
107 Ga0068853_100247870 3300005539 Bacteria 1634
108 Ga0068853_100406343 3300005539 Bacteria 1275
109 Ga0070672_100003209 3300005543 Bacteria 10582
110 Ga0070672_100009937 3300005543 Bacteria 6581
111 Ga0070686_100273835 3300005544 Bacteria 1242
112 Ga0070686_100374422 3300005544 Bacteria 1076
113 Ga0070695_100018167 3300005545 Bacteria 4269
114 Ga0070693_100008061 3300005547 Bacteria 5171
115 Ga0070693_100062300 3300005547 Bacteria 2170
116 Ga0070665_100248100 3300005548 Bacteria 1781
117 Ga0070665_100714868 3300005548 Bacteria 1015
118 Ga0068855_100016550 3300005563 Bacteria 8870
119 Ga0068855_100175939 3300005563 Bacteria 2422
120 Ga0068855_100753890 3300005563 Bacteria 1038
121 Ga0070664_100023815 3300005564 Bacteria 5057
122 Ga0070664_100048934 3300005564 Bacteria 3574
123 Ga0070664_100049286 3300005564 Bacteria 3561
124 Ga0070664_100053403 3300005564 Bacteria 3425
125 Ga0070664_100057102 3300005564 Bacteria 3317
126 Ga0070664_100109786 3300005564 Bacteria 2406
127 Ga0070664_100670233 3300005564 Unclassified 965
128 Ga0068857_100012418 3300005577 Bacteria 7413
129 Ga0068857_100043044 3300005577 Bacteria 4006
130 Ga0068857_100053775 3300005577 Bacteria 3572
131 Ga0068857_100152341 3300005577 Bacteria 2095
132 Ga0068857_100184529 3300005577 Bacteria 1899
133 Ga0068856_100044697 3300005614 Bacteria 4360
134 Ga0068856_100255035 3300005614 Unclassified 1769
135 Ga0068856_100393824 3300005614 Bacteria 1405
136 Ga0070702_100001161 3300005615 Bacteria 10604
137 Ga0070702_100126835 3300005615 Bacteria 1606
138 Ga0068852_100002247 3300005616 Bacteria 13258
139 Ga0068852_100019644 3300005616 Bacteria 5353
140 Ga0068852_100589038 3300005616 Bacteria 1116
141 Ga0068859_100073014 3300005617 Bacteria 3468
142 Ga0068864_100058324 3300005618 Bacteria 3336
143 Ga0068864_100251227 3300005618 Bacteria 1642
144 Ga0068864_100293793 3300005618 Bacteria 1519
145 Ga0068861_100002312 3300005719 Bacteria 12385
146 Ga0068861_100033462 3300005719 Bacteria 3792
147 Ga0068851_10188782 3300005834 Unclassified 1145
148 Ga0068870_10069481 3300005840 Bacteria 1916
149 Ga0068870_10153240 3300005840 Bacteria 1359
150 Ga0068863_100062271 3300005841 Bacteria 3528
151 Ga0068863_100105723 3300005841 Bacteria 2677
152 Ga0068863_100178587 3300005841 Bacteria 2038
153 Ga0068863_100328474 3300005841 Bacteria 1487
154 Ga0068858_100035835 3300005842 Bacteria 4601
155 Ga0068858_100190907 3300005842 Bacteria 1936
156 Ga0068860_100087057 3300005843 Bacteria 2973
157 Ga0068860_100241649 3300005843 Unclassified 1757
158 Ga0068862_100000130 3300005844 Bacteria 87869
159 Ga0068862_100031745 3300005844 Bacteria 4461
160 Ga0081539_10000104 3300005985 Bacteria 197478
161 Ga0070715_10055573 3300006163 Bacteria 1719
162 Ga0097621_100044552 3300006237 Bacteria 3580
163 Ga0068871_100174029 3300006358 Bacteria 1847
164 Ga0075428_100010454 3300006844 Bacteria 10308
165 Ga0075428_100068447 3300006844 Bacteria 3883
166 Ga0075428_100532049 3300006844 Unclassified 1257
167 Ga0075430_100131511 3300006846 Bacteria 2086
168 Ga0075430_100194202 3300006846 Unclassified 1687
169 Ga0075431_100017430 3300006847 Bacteria 7297
170 Ga0075431_100031904 3300006847 Bacteria 5427
171 Ga0075431_100055991 3300006847 Bacteria 4068
172 Ga0075431_100270003 3300006847 Unclassified 1724
173 Ga0075431_100410115 3300006847 Unclassified 1355
174 Ga0075433_10002120 3300006852 Bacteria 15030
175 Ga0075434_100013919 3300006871 Bacteria 7674
176 Ga0075429_100103436 3300006880 Bacteria 2487
177 Ga0075429_100625566 3300006880 Bacteria 943
178 Ga0068865_100002483 3300006881 Bacteria 10921
179 Ga0097620_100073011 3300006931 Bacteria 3468
180 Ga0105240_10109635 3300009093 Unclassified 3343
181 Ga0105240_10298763 3300009093 Unclassified 1843
182 Ga0111539_10066030 3300009094 Bacteria 4273
183 Ga0111539_10091814 3300009094 Bacteria 3567
184 Ga0111539_10324817 3300009094 Bacteria 1791
185 Ga0105245_10002598 3300009098 Bacteria 16276
186 Ga0105245_10014709 3300009098 Bacteria 6813
187 Ga0114129_10230668 3300009147 Bacteria 2493
188 Ga0114129_10387778 3300009147 Bacteria 1843
189 Ga0105241_10037185 3300009174 Bacteria 3666
190 Ga0105242_10005222 3300009176 Bacteria 10025
191 Ga0105242_10035188 3300009176 Bacteria 4016
192 Ga0105248_10029779 3300009177 Bacteria 6092
193 Ga0105248_10038116 3300009177 Bacteria 5378
194 Ga0105248_10059096 3300009177 Bacteria 4306
195 Ga0105248_10400361 3300009177 Bacteria 1546
196 Ga0105249_10000155 3300009553 Bacteria 84757
197 Ga0105249_10005540 3300009553 Bacteria 10911
198 Ga0105249_10110484 3300009553 Bacteria 2598
199 Ga0105239_10131410 3300010375 Bacteria 2785
200 Ga0105239_10501015 3300010375 Bacteria 1381
201 Ga0105246_10000048 3300011119 Bacteria 47038
202 Ga0157370_10647215 3300013104 Bacteria 966
203 Ga0157369_10038408 3300013105 Bacteria 5235
204 Ga0157369_10071854 3300013105 Bacteria 3714
205 Ga0157369_10603420 3300013105 Bacteria 1133
206 Ga0157374_10022918 3300013296 Bacteria 5577
207 Ga0157378_10050109 3300013297 Bacteria 3715
208 Ga0157378_10174384 3300013297 Bacteria 2019
209 Ga0157378_10572091 3300013297 Unclassified 1138
210 Ga0163162_10004600 3300013306 Bacteria 13294
211 Ga0163162_10043035 3300013306 Bacteria 4521
212 Ga0157372_10046173 3300013307 Bacteria 4835
213 Ga0157372_10091767 3300013307 Bacteria 3454
214 Ga0157372_10097728 3300013307 Bacteria 3349
215 Ga0157372_10134014 3300013307 Bacteria 2852
216 Ga0157372_10170684 3300013307 Bacteria 2516
217 Ga0157372_10191070 3300013307 Bacteria 2372
218 Ga0157372_10520780 3300013307 Bacteria 1386
219 Ga0157372_10575645 3300013307 Unclassified 1312
220 Ga0157375_11319240 3300013308 Bacteria 849
221 Ga0163163_10001957 3300014325 Bacteria 17415
222 Ga0163163_10055505 3300014325 Bacteria 3915
223 Ga0163163_10395992 3300014325 Bacteria 1439
224 Ga0163163_11177047 3300014325 Bacteria 829
225 Ga0157380_10061953 3300014326 Bacteria 2995
226 Ga0157380_10179396 3300014326 Bacteria 1859
227 Ga0157377_10002268 3300014745 Bacteria 8458
228 Ga0157377_10002632 3300014745 Bacteria 7965
229 Ga0157377_10192531 3300014745 Bacteria 1290
230 Ga0157379_10027659 3300014968 Bacteria 5048
231 Ga0157379_10885501 3300014968 Bacteria 846
232 Ga0157376_10582101 3300014969 Bacteria 1112
233 Ga0163161_10047193 3300017792 Bacteria 3111
234 Ga0163161_10308813 3300017792 Bacteria 1247
235 Ga0213876_10005929 3300021384 Bacteria 6676
236 Ga0213876_10126352 3300021384 Bacteria 1358
237 Ga0213875_10041973 3300021388 Bacteria 2151
238 Ga0207697_10002300 3300025315 Bacteria 9982
239 Ga0207656_10016238 3300025321 Bacteria 2896
240 Ga0207682_10009596 3300025893 Bacteria 3815
241 Ga0207688_10064056 3300025901 Bacteria 2074
242 Ga0207645_10013581 3300025907 Bacteria 5483
243 Ga0207645_10124624 3300025907 Unclassified 1674
244 Ga0207643_10001273 3300025908 Bacteria 14711
245 Ga0207643_10006164 3300025908 Bacteria 6418
246 Ga0207643_10141997 3300025908 Bacteria 1435
247 Ga0207705_10013914 3300025909 Bacteria 5802
248 Ga0207705_10016288 3300025909 Bacteria 5332
249 Ga0207684_10039942 3300025910 Bacteria 3978
250 Ga0207684_10214549 3300025910 Unclassified 1660
251 Ga0207654_10018382 3300025911 Bacteria 3666
252 Ga0207707_10001011 3300025912 Bacteria 26967
253 Ga0207707_10324548 3300025912 Bacteria 1329
254 Ga0207695_10496744 3300025913 Bacteria 1102
255 Ga0207660_10252575 3300025917 Unclassified 1392
256 Ga0207660_10417800 3300025917 Unclassified 1081
257 Ga0207662_10000202 3300025918 Bacteria 27768
258 Ga0207662_10010975 3300025918 Bacteria 5012
259 Ga0207657_10013393 3300025919 Bacteria 8048
260 Ga0207657_10104512 3300025919 Bacteria 2346
261 Ga0207657_10175235 3300025919 Bacteria 1736
262 Ga0207649_10001975 3300025920 Bacteria 11694
263 Ga0207649_10002504 3300025920 Bacteria 10255
264 Ga0207649_10115540 3300025920 Bacteria 1800
265 Ga0207652_10017518 3300025921 Bacteria 5862
266 Ga0207652_10297158 3300025921 Bacteria 1457
267 Ga0207646_10001974 3300025922 Bacteria 24627
268 Ga0207681_10005006 3300025923 Bacteria 8141
269 Ga0207681_10039757 3300025923 Bacteria 3124
270 Ga0207694_10379947 3300025924 Bacteria 1172
271 Ga0207650_10005433 3300025925 Bacteria 8698
272 Ga0207650_10028128 3300025925 Bacteria 4028
273 Ga0207650_10101864 3300025925 Bacteria 2212
274 Ga0207659_10003020 3300025926 Bacteria 10035
275 Ga0207659_10009179 3300025926 Bacteria 6176
276 Ga0207659_10090738 3300025926 Bacteria 2281
277 Ga0207659_10208308 3300025926 Unclassified 1566
278 Ga0207659_10365545 3300025926 Bacteria 1200
279 Ga0207659_10798184 3300025926 Bacteria 811
280 Ga0207687_10015691 3300025927 Bacteria 4971
281 Ga0207687_10389340 3300025927 Unclassified 1144
282 Ga0207644_10106932 3300025931 Bacteria 2110
283 Ga0207644_10204284 3300025931 Bacteria 1559
284 Ga0207690_10020042 3300025932 Bacteria 4126
285 Ga0207690_10029746 3300025932 Bacteria 3476
286 Ga0207690_10077245 3300025932 Bacteria 2314
287 Ga0207690_10291605 3300025932 Bacteria 1274
288 Ga0207690_10373176 3300025932 Unclassified 1132
289 Ga0207706_10065190 3300025933 Bacteria 3207
290 Ga0207706_10180159 3300025933 Bacteria 1856
291 Ga0207686_10044882 3300025934 Bacteria 2716
292 Ga0207686_10051105 3300025934 Bacteria 2574
293 Ga0207686_10103570 3300025934 Bacteria 1904
294 Ga0207670_10578204 3300025936 Bacteria 920
295 Ga0207669_10057408 3300025937 Bacteria 2370
296 Ga0207669_10093133 3300025937 Bacteria 1968
297 Ga0207669_10183061 3300025937 Bacteria 1504
298 Ga0207691_10000643 3300025940 Bacteria 34530
299 Ga0207691_10004117 3300025940 Bacteria 14126
300 Ga0207691_10085428 3300025940 Bacteria 2832
301 Ga0207691_10147054 3300025940 Bacteria 2074
302 Ga0207711_10203256 3300025941 Bacteria 1808
303 Ga0207711_10347857 3300025941 Bacteria 1372
304 Ga0207711_10532471 3300025941 Bacteria 1096
305 Ga0207689_10001995 3300025942 Bacteria 19271
306 Ga0207689_10031204 3300025942 Bacteria 4438
307 Ga0207661_10000431 3300025944 Bacteria 27045
308 Ga0207661_10041593 3300025944 Bacteria 3618
309 Ga0207661_10045206 3300025944 Bacteria 3484
310 Ga0207661_10054266 3300025944 Bacteria 3210
311 Ga0207661_10145981 3300025944 Bacteria 2041
312 Ga0207661_10337011 3300025944 Bacteria 1358
313 Ga0207661_10700758 3300025944 Bacteria 931
314 Ga0207679_10000787 3300025945 Bacteria 20742
315 Ga0207679_10002073 3300025945 Bacteria 12438
316 Ga0207679_10029214 3300025945 Bacteria 3836
317 Ga0207679_10051507 3300025945 Bacteria 3014
318 Ga0207679_10134889 3300025945 Bacteria 1986
319 Ga0207679_10204353 3300025945 Bacteria 1652
320 Ga0207679_10718937 3300025945 Unclassified 907
321 Ga0207667_10231682 3300025949 Bacteria 1891
322 Ga0207651_10028856 3300025960 Bacteria 3507
323 Ga0207651_10058380 3300025960 Bacteria 2667
324 Ga0207651_10129380 3300025960 Bacteria 1930
325 Ga0207651_10217700 3300025960 Bacteria 1541
326 Ga0207712_10000577 3300025961 Bacteria 29678
327 Ga0207712_10028755 3300025961 Bacteria 3721
328 Ga0207668_10015257 3300025972 Bacteria 4769
329 Ga0207658_10144259 3300025986 Bacteria 1931
330 Ga0207658_10619829 3300025986 Bacteria 973
331 Ga0207703_10017731 3300026035 Bacteria 5558
332 Ga0207639_10023306 3300026041 Bacteria 4469
333 Ga0207639_10135081 3300026041 Bacteria 2047
334 Ga0207708_10015100 3300026075 Bacteria 5787
335 Ga0207702_10035624 3300026078 Bacteria 4161
336 Ga0207702_10042496 3300026078 Bacteria 3813
337 Ga0207641_10154182 3300026088 Bacteria 2083
338 Ga0207648_10015944 3300026089 Bacteria 6885
339 Ga0207648_10030456 3300026089 Bacteria 4779
340 Ga0207648_10406220 3300026089 Bacteria 1235
341 Ga0207648_10589128 3300026089 Bacteria 1024
342 Ga0207676_10000528 3300026095 Bacteria 32064
343 Ga0207676_10036006 3300026095 Bacteria 3762
344 Ga0207676_10047731 3300026095 Bacteria 3320
345 Ga0207676_10417244 3300026095 Bacteria 1258
346 Ga0207674_10001126 3300026116 Bacteria 34664
347 Ga0207674_10023246 3300026116 Bacteria 6640
348 Ga0207674_10029440 3300026116 Bacteria 5781
349 Ga0207674_10069572 3300026116 Bacteria 3540
350 Ga0207674_10069607 3300026116 Bacteria 3539
351 Ga0207674_10184959 3300026116 Bacteria 2034
352 Ga0207675_100000069 3300026118 Bacteria 78094
353 Ga0207675_100007147 3300026118 Bacteria 10552
354 Ga0207683_10236192 3300026121 Unclassified 1667
355 Ga0207683_10319579 3300026121 Bacteria 1422
356 Ga0207683_10378864 3300026121 Bacteria 1300
357 Ga0207698_10016364 3300026142 Bacteria 4995
358 Ga0207698_10267520 3300026142 Bacteria 1574
359 Ga0207698_10521559 3300026142 Bacteria 1160
360 Ga0207698_10840674 3300026142 Unclassified 922
361 Ga0209984_1004492 3300027424 Unclassified 1646
362 Ga0209966_1023419 3300027695 Bacteria 1214
363 Ga0209998_10004038 3300027717 Bacteria 3140
364 Ga0268266_10035905 3300028379 Bacteria 4216
365 Ga0268265_10000327 3300028380 Bacteria 51788
366 Ga0307408_100226026 3300031548 Bacteria 1530
367 Ga0307405_10034013 3300031731 Bacteria 3029
368 Ga0307405_10165117 3300031731 Unclassified 1573
369 Ga0307405_10325838 3300031731 Bacteria 1175
370 Ga0307413_10654978 3300031824 Unclassified 867
371 Ga0307413_10661163 3300031824 Bacteria 863
372 Ga0307413_10976319 3300031824 Bacteria 724
373 Ga0307410_10064668 3300031852 Bacteria 2514
374 Ga0307410_10399624 3300031852 Unclassified 1110
375 Ga0307406_10001942 3300031901 Bacteria 11292
376 Ga0307412_10019019 3300031911 Bacteria 4148
377 Ga0307412_10276213 3300031911 Bacteria 1317
378 Ga0307416_100001416 3300032002 Bacteria 13016
379 Ga0307416_100084630 3300032002 Bacteria 2696
380 Ga0307416_100191627 3300032002 Unclassified 1929
381 Ga0307416_100345064 3300032002 Bacteria 1504
382 Ga0307416_101282486 3300032002 Bacteria 838
383 Ga0307411_10148638 3300032005 Bacteria 1738
384 Ga0307415_100153622 3300032126 Bacteria 1775
385 Ga0307415_100541467 3300032126 Bacteria 1026
386 Ga0307415_100604625 3300032126 Bacteria 976
387 Ga0373931_0029578 3300035691 Bacteria 2814
388 Ga0373931_0064081 3300035691 Bacteria 1988
389 Ga0373931_0343439 3300035691 Archaea 933
390 Ga0395899_0007937 3300037312 Bacteria 8176
391 Ga0395900_0055832 3300037418 Bacteria 4066
392 Ga0395898_0202602 3300037466 Bacteria 1894
393 Ga0395905_0023786 3300037471 Bacteria 5785
394 Ga0395905_0098976 3300037471 Bacteria 2739
395 Ga0436364_0735003 3300037853 Bacteria 1880
396 Ga0395901_0004192 3300038443 Bacteria 14540
397 Ga0436365_0432238 3300039437 Bacteria 3982
398 Ga0436365_0524664 3300039437 Bacteria 971
399 Ga0436365_1595047 3300039437 Bacteria 8042
400 Ga0439457_028473 3300042014 Bacteria 1237
401 Ga0451577_0004371 3300042876 Bacteria 14953
402 Ga0451577_0074400 3300042876 Bacteria 3029
403 Ga0451577_0081363 3300042876 Bacteria 2888
404 Ga0451577_0878033 3300042876 Bacteria 808
405 Ga0453684_0001810 3300044712 Bacteria 56611
406 Ga0453684_0067910 3300044712 Bacteria 4530
407 Ga0451576_0058878 3300045051 Bacteria 4012
408 Ga0451576_0143659 3300045051 Bacteria 2488
409 Ga0451576_0168178 3300045051 Bacteria 2288
410 Ga0466967_0056382 3300045976 Bacteria 3464
411 Ga0466967_0913473 3300045976 Unclassified 873
412 Ga0495629_0027379 3300046459 Bacteria 4046
413 Ga0495582_0040627 3300046473 Bacteria 2562
414 Ga0495664_0323473 3300046477 Bacteria 930
415 Ga0495620_0073571 3300046515 Bacteria 1393
416 Ga0495663_0022326 3300046525 Unclassified 1827
417 Ga0495665_0059705 3300046531 Bacteria 2013
418 Ga0495587_0289458 3300046536 Bacteria 917
419 Ga0495645_0369268 3300046543 Unclassified 920
420 Ga0495623_0024305 3300046679 Bacteria 3905
421 Ga0495658_0207537 3300046683 Bacteria 1223
422 Ga0495669_0051563 3300046684 Unclassified 1847
423 Ga0495613_0085278 3300046689 Unclassified 2292
424 Ga0495581_0100803 3300047315 Unclassified 1677
425 Ga0495636_0101059 3300047318 Bacteria 1261
426 Ga0495675_0068143 3300047444 Bacteria 2248
427 Ga0495593_0237686 3300047673 Unclassified 913
428 Ga0496104_0113165 3300048907 Bacteria 2603
429 Ga0496105_0389424 3300048908 Bacteria 1108
430 Ga0496108_0036545 3300048911 Bacteria 4087
431 Ga0496108_0404149 3300048911 Bacteria 1193
432 Ga0496109_0062287 3300048912 Bacteria 3411
433 Ga0496112_0007051 3300048915 Bacteria 9928
434 Ga0496112_0140202 3300048915 Bacteria 2387
435 Ga0496112_0287654 3300048915 Bacteria 1590
436 Ga0496113_0008479 3300048916 Bacteria 6699
437 Ga0496113_0047071 3300048916 Bacteria 3204
438 Ga0501031_0546072 3300049568 Unclassified 746
439 Ga0501033_0025216 3300049570 Bacteria 4480
440 Ga0501036_0441532 3300049572 Bacteria 1084
441 Ga0501038_0110623 3300049574 Bacteria 2276
442 Ga0501038_0233695 3300049574 Unclassified 1462
443 Ga0501041_0057019 3300049577 Bacteria 2388
444 Ga0501043_0053197 3300049579 Bacteria 3180
445 Ga0501047_0274281 3300049581 Bacteria 1532
446 Ga0501067_0190580 3300049583 Unclassified 1142
447 Ga0501070_0030112 3300049586 Bacteria 4548
448 Ga0501070_0669164 3300049586 Unclassified 823
449 Ga0501071_0187190 3300049587 Bacteria 1552
450 Ga0501072_0242897 3300049588 Bacteria 1434
451 Ga0501077_0102632 3300049593 Bacteria 1812
452 Ga0501079_0061960 3300049741 Bacteria 2885
453 Ga0501080_0130369 3300049742 Bacteria 2328
454 Ga0501081_0225231 3300049743 Unclassified 1364
455 Ga0501035_0071116 3300049822 Bacteria 3081
456 Ga0501035_0174858 3300049822 Bacteria 1853
457 Ga0501045_0205987 3300049824 Unclassified 1465
458 nmdc:mga05p37_459716_c1 3300050507 Unclassified 1471
459 nmdc:mga09592_17094_c1 3300050508 Bacteria 5938
460 nmdc:mga0qj67_29722_c1 3300050509 Bacteria 4245
461 nmdc:mga0qj67_96800_c1 3300050509 Bacteria 2376
462 nmdc:mga06r32_1094702_c1 3300050510 Bacteria 746
463 nmdc:mga06r32_374457_c1 3300050510 Bacteria 1407
464 nmdc:mga06r32_52130_c1 3300050510 Bacteria 3918
465 nmdc:mga06r32_64900_c1 3300050510 Bacteria 3521
466 nmdc:mga06r32_70872_c1 3300050510 Bacteria 3372
467 nmdc:mga08y16_40889_c1 3300050511 Bacteria 4857
468 nmdc:mga08y16_73943_c1 3300050511 Bacteria 3551
469 nmdc:mga0n895_268389_c1 3300050512 Bacteria 1731
470 nmdc:mga0n895_4016_c1 3300050512 Bacteria 11971
471 nmdc:mga0rr50_349420_c1 3300050513 Bacteria 1243
472 nmdc:mga0a205_997_c1 3300050515 Bacteria 23446
473 Ga0501082_0143548 3300060353 Bacteria 2072
474 Ga0466967_0238737
475 Ga0070658_10006108
476 Ga0070658_10017935
477 Ga0070658_10194174
478 Ga0070676_10043548
479 Ga0070683_100016694
480 Ga0070683_100048494
481 Ga0070683_100067978
482 Ga0070683_100074424
483 Ga0070683_100149111
484 Ga0070683_100173132
485 Ga0070683_101018841
486 Ga0070690_100313212
487 Ga0070690_100368901
488 Ga0070670_100003047
489 Ga0070670_100020537
490 Ga0070670_100130359
491 Ga0070670_100231146
492 Ga0070670_100336274
493 Ga0068869_100002948
494 Ga0068869_100255283
495 Ga0070666_10429791
496 Ga0070680_100027361
497 Ga0070680_100249245
498 Ga0070680_100431856
499 Ga0070682_100019746
500 Ga0068868_100014082
501 Ga0068868_100055300
502 Ga0070660_100034573
503 Ga0070660_100087882
504 Ga0070689_100106373
505 Ga0070689_100110002
506 Ga0070691_10166946
507 Ga0070687_100020259
508 Ga0070661_100003949
509 Ga0070661_100036309
510 Ga0070661_100036471
511 Ga0070661_100157992
512 Ga0070661_100158763
513 Ga0070661_100490140
514 Ga0070692_10274119
515 Ga0070668_100005385
516 Ga0070668_100217834
517 Ga0070669_100001077
518 Ga0070669_100019980
519 Ga0070669_100084998
520 Ga0070675_100006582
521 Ga0070675_100006714
522 Ga0070675_100017468
523 Ga0070675_100158846
524 Ga0070671_100054674
525 Ga0070671_100469226
526 Ga0070673_100014725
527 Ga0070673_100117720
528 Ga0070673_100166546
529 Ga0070673_100253185
530 Ga0070688_100016926
531 Ga0070688_100355467
532 Ga0070659_100000762
533 Ga0070659_100019720
534 Ga0070659_100038987
535 Ga0070659_100075931
536 Ga0070659_100334120
537 Ga0070667_100160559
538 Ga0070667_100167700
539 Ga0070667_100280617
540 Ga0070703_10102688
541 Ga0070701_10025793
542 Ga0070701_10113830
543 Ga0070700_100037021
544 Ga0070700_100860631
545 Ga0070694_100083398
546 Ga0070694_100090278
547 Ga0070708_100000486
548 Ga0070663_100029019
549 Ga0070678_100243191
550 Ga0070678_100267372
551 Ga0070678_100620790
552 Ga0070662_100034020
553 Ga0070662_100158450
554 Ga0070662_100322674
555 Ga0070681_10000084
556 Ga0070681_10000157
557 Ga0068867_100057498
558 Ga0068867_100314345
559 Ga0068867_101530240
560 Ga0070706_100541042
561 Ga0070707_100022241
562 Ga0070698_100000081
563 Ga0070698_100111991
564 Ga0070699_100057684
565 Ga0070699_100058773
566 Ga0070679_100003796
567 Ga0070679_100023283
568 Ga0070679_100023474
569 Ga0070684_100001180
570 Ga0070684_100006795
571 Ga0070684_100045917
572 Ga0070684_100168011
573 Ga0070684_100241785
574 Ga0070684_100243648
575 Ga0070684_100330670
576 Ga0070684_100493197
577 Ga0070697_100107613
578 Ga0068853_100013132
579 Ga0068853_100148747
580 Ga0068853_100247870
581 Ga0068853_100406343
582 Ga0070672_100003209
583 Ga0070672_100009937
584 Ga0070686_100273835
585 Ga0070686_100374422
586 Ga0070695_100018167
587 Ga0070693_100008061
588 Ga0070693_100062300
589 Ga0070665_100248100
590 Ga0070665_100714868
591 Ga0068855_100016550
592 Ga0068855_100175939
593 Ga0068855_100753890
594 Ga0070664_100023815
595 Ga0070664_100048934
596 Ga0070664_100049286
597 Ga0070664_100053403
598 Ga0070664_100057102
599 Ga0070664_100109786
600 Ga0070664_100670233
601 Ga0068857_100012418
602 Ga0068857_100043044
603 Ga0068857_100053775
604 Ga0068857_100152341
605 Ga0068857_100184529
606 Ga0068856_100044697
607 Ga0068856_100255035
608 Ga0068856_100393824
609 Ga0070702_100001161
610 Ga0070702_100126835
611 Ga0068852_100002247
612 Ga0068852_100019644
613 Ga0068852_100589038
614 Ga0068859_100073014
615 Ga0068864_100058324
616 Ga0068864_100251227
617 Ga0068864_100293793
618 Ga0068861_100002312
619 Ga0068861_100033462
620 Ga0068851_10188782
621 Ga0068870_10069481
622 Ga0068870_10153240
623 Ga0068863_100062271
624 Ga0068863_100105723
625 Ga0068863_100178587
626 Ga0068863_100328474
627 Ga0068858_100035835
628 Ga0068858_100190907
629 Ga0068860_100087057
630 Ga0068860_100241649
631 Ga0068862_100000130
632 Ga0068862_100031745
633 Ga0081539_10000104
634 Ga0070715_10055573
635 Ga0097621_100044552
636 Ga0068871_100174029
637 Ga0075428_100010454
638 Ga0075428_100068447
639 Ga0075428_100532049
640 Ga0075430_100131511
641 Ga0075430_100194202
642 Ga0075431_100017430
643 Ga0075431_100031904
644 Ga0075431_100055991
645 Ga0075431_100270003
646 Ga0075431_100410115
647 Ga0075433_10002120
648 Ga0075434_100013919
649 Ga0075429_100103436
650 Ga0075429_100625566
651 Ga0068865_100002483
652 Ga0097620_100073011
653 Ga0105240_10109635
654 Ga0105240_10298763
655 Ga0111539_10066030
656 Ga0111539_10091814
657 Ga0111539_10324817
658 Ga0105245_10002598
659 Ga0105245_10014709
660 Ga0114129_10230668
661 Ga0114129_10387778
662 Ga0105241_10037185
663 Ga0105242_10005222
664 Ga0105242_10035188
665 Ga0105248_10029779
666 Ga0105248_10038116
667 Ga0105248_10059096
668 Ga0105248_10400361
669 Ga0105249_10000155
670 Ga0105249_10005540
671 Ga0105249_10110484
672 Ga0105239_10131410
673 Ga0105239_10501015
674 Ga0105246_10000048
675 Ga0157370_10647215
676 Ga0157369_10038408
677 Ga0157369_10071854
678 Ga0157369_10603420
679 Ga0157374_10022918
680 Ga0157378_10050109
681 Ga0157378_10174384
682 Ga0157378_10572091
683 Ga0163162_10004600
684 Ga0163162_10043035
685 Ga0157372_10046173
686 Ga0157372_10091767
687 Ga0157372_10097728
688 Ga0157372_10134014
689 Ga0157372_10170684
690 Ga0157372_10191070
691 Ga0157372_10520780
692 Ga0157372_10575645
693 Ga0157375_11319240
694 Ga0163163_10001957
695 Ga0163163_10055505
696 Ga0163163_10395992
697 Ga0163163_11177047
698 Ga0157380_10061953
699 Ga0157380_10179396
700 Ga0157377_10002268
701 Ga0157377_10002632
702 Ga0157377_10192531
703 Ga0157379_10027659
704 Ga0157379_10885501
705 Ga0157376_10582101
706 Ga0163161_10047193
707 Ga0163161_10308813
708 Ga0213876_10005929
709 Ga0213876_10126352
710 Ga0213875_10041973
711 Ga0207697_10002300
712 Ga0207656_10016238
713 Ga0207682_10009596
714 Ga0207688_10064056
715 Ga0207645_10013581
716 Ga0207645_10124624
717 Ga0207643_10001273
718 Ga0207643_10006164
719 Ga0207643_10141997
720 Ga0207705_10013914
721 Ga0207705_10016288
722 Ga0207684_10039942
723 Ga0207684_10214549
724 Ga0207654_10018382
725 Ga0207707_10001011
726 Ga0207707_10324548
727 Ga0207695_10496744
728 Ga0207660_10252575
729 Ga0207660_10417800
730 Ga0207662_10000202
731 Ga0207662_10010975
732 Ga0207657_10013393
733 Ga0207657_10104512
734 Ga0207657_10175235
735 Ga0207649_10001975
736 Ga0207649_10002504
737 Ga0207649_10115540
738 Ga0207652_10017518
739 Ga0207652_10297158
740 Ga0207646_10001974
741 Ga0207681_10005006
742 Ga0207681_10039757
743 Ga0207694_10379947
744 Ga0207650_10005433
745 Ga0207650_10028128
746 Ga0207650_10101864
747 Ga0207659_10003020
748 Ga0207659_10009179
749 Ga0207659_10090738
750 Ga0207659_10208308
751 Ga0207659_10365545
752 Ga0207659_10798184
753 Ga0207687_10015691
754 Ga0207687_10389340
755 Ga0207644_10106932
756 Ga0207644_10204284
757 Ga0207690_10020042
758 Ga0207690_10029746
759 Ga0207690_10077245
760 Ga0207690_10291605
761 Ga0207690_10373176
762 Ga0207706_10065190
763 Ga0207706_10180159
764 Ga0207686_10044882
765 Ga0207686_10051105
766 Ga0207686_10103570
767 Ga0207670_10578204
768 Ga0207669_10057408
769 Ga0207669_10093133
770 Ga0207669_10183061
771 Ga0207691_10000643
772 Ga0207691_10004117
773 Ga0207691_10085428
774 Ga0207691_10147054
775 Ga0207711_10203256
776 Ga0207711_10347857
777 Ga0207711_10532471
778 Ga0207689_10001995
779 Ga0207689_10031204
780 Ga0207661_10000431
781 Ga0207661_10041593
782 Ga0207661_10045206
783 Ga0207661_10054266
784 Ga0207661_10145981
785 Ga0207661_10337011
786 Ga0207661_10700758
787 Ga0207679_10000787
788 Ga0207679_10002073
789 Ga0207679_10029214
790 Ga0207679_10051507
791 Ga0207679_10134889
792 Ga0207679_10204353
793 Ga0207679_10718937
794 Ga0207667_10231682
795 Ga0207651_10028856
796 Ga0207651_10058380
797 Ga0207651_10129380
798 Ga0207651_10217700
799 Ga0207712_10000577
800 Ga0207712_10028755
801 Ga0207668_10015257
802 Ga0207658_10144259
803 Ga0207658_10619829
804 Ga0207703_10017731
805 Ga0207639_10023306
806 Ga0207639_10135081
807 Ga0207708_10015100
808 Ga0207702_10035624
809 Ga0207702_10042496
810 Ga0207641_10154182
811 Ga0207648_10015944
812 Ga0207648_10030456
813 Ga0207648_10406220
814 Ga0207648_10589128
815 Ga0207676_10000528
816 Ga0207676_10036006
817 Ga0207676_10047731
818 Ga0207676_10417244
819 Ga0207674_10001126
820 Ga0207674_10023246
821 Ga0207674_10029440
822 Ga0207674_10069572
823 Ga0207674_10069607
824 Ga0207674_10184959
825 Ga0207675_100000069
826 Ga0207675_100007147
827 Ga0207683_10236192
828 Ga0207683_10319579
829 Ga0207683_10378864
830 Ga0207698_10016364
831 Ga0207698_10267520
832 Ga0207698_10521559
833 Ga0207698_10840674
834 Ga0209984_1004492
835 Ga0209966_1023419
836 Ga0209998_10004038
837 Ga0268266_10035905
838 Ga0268265_10000327
839 Ga0307408_100226026
840 Ga0307405_10034013
841 Ga0307405_10165117
842 Ga0307405_10325838
843 Ga0307413_10654978
844 Ga0307413_10661163
845 Ga0307413_10976319
846 Ga0307410_10064668
847 Ga0307410_10399624
848 Ga0307406_10001942
849 Ga0307412_10019019
850 Ga0307412_10276213
851 Ga0307416_100001416
852 Ga0307416_100084630
853 Ga0307416_100191627
854 Ga0307416_100345064
855 Ga0307416_101282486
856 Ga0307411_10148638
857 Ga0307415_100153622
858 Ga0307415_100541467
859 Ga0307415_100604625
860 Ga0373931_0029578
861 Ga0373931_0064081
862 Ga0373931_0343439
863 Ga0395899_0007937
864 Ga0395900_0055832
865 Ga0395898_0202602
866 Ga0395905_0023786
867 Ga0395905_0098976
868 Ga0436364_0735003
869 Ga0395901_0004192
870 Ga0436365_0432238
871 Ga0436365_0524664
872 Ga0436365_1595047
873 Ga0439457_028473
874 Ga0451577_0004371
875 Ga0451577_0074400
876 Ga0451577_0081363
877 Ga0451577_0878033
878 Ga0453684_0001810
879 Ga0453684_0067910
880 Ga0451576_0058878
881 Ga0451576_0143659
882 Ga0451576_0168178
883 Ga0466967_0056382
884 Ga0466967_0913473
885 Ga0495629_0027379
886 Ga0495582_0040627
887 Ga0495664_0323473
888 Ga0495620_0073571
889 Ga0495663_0022326
890 Ga0495665_0059705
891 Ga0495587_0289458
892 Ga0495645_0369268
893 Ga0495623_0024305
894 Ga0495658_0207537
895 Ga0495669_0051563
896 Ga0495613_0085278
897 Ga0495581_0100803
898 Ga0495636_0101059
899 Ga0495675_0068143
900 Ga0495593_0237686
901 Ga0496104_0113165
902 Ga0496105_0389424
903 Ga0496108_0036545
904 Ga0496108_0404149
905 Ga0496109_0062287
906 Ga0496112_0007051
907 Ga0496112_0140202
908 Ga0496112_0287654
909 Ga0496113_0008479
910 Ga0496113_0047071
911 Ga0501031_0546072
912 Ga0501033_0025216
913 Ga0501036_0441532
914 Ga0501038_0110623
915 Ga0501038_0233695
916 Ga0501041_0057019
917 Ga0501043_0053197
918 Ga0501047_0274281
919 Ga0501067_0190580
920 Ga0501070_0030112
921 Ga0501070_0669164
922 Ga0501071_0187190
923 Ga0501072_0242897
924 Ga0501077_0102632
925 Ga0501079_0061960
926 Ga0501080_0130369
927 Ga0501081_0225231
928 Ga0501035_0071116
929 Ga0501035_0174858
930 Ga0501045_0205987
931 nmdc:mga05p37_459716_c1
932 nmdc:mga09592_17094_c1
933 nmdc:mga0qj67_29722_c1
934 nmdc:mga0qj67_96800_c1
935 nmdc:mga06r32_1094702_c1
936 nmdc:mga06r32_374457_c1
937 nmdc:mga06r32_52130_c1
938 nmdc:mga06r32_64900_c1
939 nmdc:mga06r32_70872_c1
940 nmdc:mga08y16_40889_c1
941 nmdc:mga08y16_73943_c1
942 nmdc:mga0n895_268389_c1
943 nmdc:mga0n895_4016_c1
944 nmdc:mga0rr50_349420_c1
945 nmdc:mga0a205_997_c1
946 Ga0501082_0143548

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00814

TsaD

tRNA N6-adenosine threonylcarbamoyltransferase

39

151

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vrt-assembly1.cif.gz_A crystal structure of e. coli rnase e possessing m1 rna fragments - catalytic domain 0.9106 5 33
8a5d-assembly1.cif.gz_U structure of arp4-ies4-n-actin-arp8-ino80hsa subcomplex (a-module) of chaetomium thermophilum ino80 0.83 5 33
2vrt-assembly4.cif.gz_D crystal structure of e. coli rnase e possessing m1 rna fragments - catalytic domain 0.8259 5 37
2gel-assembly1.cif.gz_A 2.05a crystal structure of salmonella typhimurium yeaz, form b 0.822 5 203
6g63-assembly1.cif.gz_L rnase e in complex with srna rrpa 0.8185 5 38
ID Description Score Start End Superfamily
af_P76256_2_102_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9309 6 103 3.30.420.40
2floD02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Exopolyphosphatase. Domain 2 0.9104 5 33 3.30.420.150
af_Q9VV41_3_120_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.91 6 97 3.30.420.40
af_Q9NPF4_5_132_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9036 8 97 3.30.420.40
af_P76256_2_128_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8985 6 129 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A661J980-F1-model_v4 tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB 0.9614 5 104 GO:0002949
GO:0005829
GO:0016740
AF-A0A382ESK2-F1-model_v4 Gcp-like domain-containing protein 0.9543 5 104 GO:0002949
GO:0005829
AF-A0A2D6ILX3-F1-model_v4 tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB 0.9338 5 97 GO:0002949
GO:0016740
AF-A0A356FXF3-F1-model_v4 tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB 0.9287 3 92 GO:0002949
GO:0005829
GO:0016740
AF-X1QRW8-F1-model_v4 Gcp-like domain-containing protein 0.9258 6 96 GO:0002949
GO:0005829

Map