F450985

General Info

Members Datasets Scaffolds Average Seq Length
473 223 946 315

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10185420|Ga0081455_101854202
Length 339
Sequence MPSLRNVIIIGSGPAGLTAALYSARANLQPLLIEGIEAGGQLMLTTMVENFPGYRDGIMGPDLMAEMRAQAERFGTEIVQGNVTSVDLGSQPMVVKTSEHDYQSKTIIIATGASARLLGLPSERALMGHGVSTCATCDGYFFRGQDIAVVGGGDSAMEEAIFLTRFASKVTVVHRRGTLRASKIMQDKARANDKIAWQLDSEVEEIKDGGKGEVTSMVLRNKRTGGRTEVPVSGVFVAIGHTPNTSMFQGQLELDRNGYIMTHDGSKTSVAGVFACGDVQDHIYRQAITAAGTGCMAALDAEWYLRDNPAVPTPEALEGTGDLAEQQWAPAMPQPTRSV

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
138 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
139 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
140 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
141 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
142 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
143 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
144 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
145 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
147 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
149 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
150 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
153 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
154 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
174 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
223 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 2.75
Rhizosphere 96.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10185420 3300005937 Bacteria 1572
2 JGI24751J29686_10006372 3300002459 Bacteria 2404
3 Ga0065712_10003970 3300005290 Bacteria 5176
4 Ga0065715_10285746 3300005293 Bacteria 1075
5 Ga0070658_10083883 3300005327 Bacteria 2620
6 Ga0070676_10316703 3300005328 Bacteria 1062
7 Ga0070690_100005710 3300005330 Bacteria 7009
8 Ga0070690_100217162 3300005330 Bacteria 1338
9 Ga0070670_100040942 3300005331 Bacteria 3982
10 Ga0070677_10144203 3300005333 Bacteria 1102
11 Ga0070666_10212756 3300005335 Bacteria 1362
12 Ga0070680_100023646 3300005336 Bacteria 4904
13 Ga0070680_100434571 3300005336 Bacteria 1120
14 Ga0070687_100018562 3300005343 Bacteria 3220
15 Ga0070669_100025806 3300005353 Bacteria 4222
16 Ga0070675_100000647 3300005354 Bacteria 24078
17 Ga0070671_100108853 3300005355 Bacteria 2327
18 Ga0070674_100002099 3300005356 Bacteria 10928
19 Ga0070674_100022357 3300005356 Bacteria 4078
20 Ga0070674_100023188 3300005356 Bacteria 4014
21 Ga0070674_100070434 3300005356 Bacteria 2471
22 Ga0070674_100166586 3300005356 Bacteria 1677
23 Ga0070673_100115092 3300005364 Bacteria 2236
24 Ga0070673_100404620 3300005364 Bacteria 1221
25 Ga0070659_100106334 3300005366 Bacteria 2262
26 Ga0070667_100013351 3300005367 Bacteria 6787
27 Ga0070709_10070578 3300005434 Bacteria 2252
28 Ga0070713_100004221 3300005436 Bacteria 9600
29 Ga0070701_10173203 3300005438 Bacteria 1258
30 Ga0070705_100198998 3300005440 Bacteria 1372
31 Ga0070700_100024762 3300005441 Bacteria 3528
32 Ga0070694_100000539 3300005444 Bacteria 20865
33 Ga0070694_100023467 3300005444 Bacteria 3968
34 Ga0070694_100045982 3300005444 Bacteria 2928
35 Ga0070708_100032541 3300005445 Bacteria 4524
36 Ga0070708_100044610 3300005445 Bacteria 3900
37 Ga0070708_100067071 3300005445 Bacteria 3221
38 Ga0070708_100078623 3300005445 Bacteria 2982
39 Ga0070708_100085018 3300005445 Bacteria 2870
40 Ga0070708_100124773 3300005445 Bacteria 2379
41 Ga0070678_100449915 3300005456 Bacteria 1128
42 Ga0070662_100116918 3300005457 Bacteria 2039
43 Ga0070662_100294011 3300005457 Bacteria 1317
44 Ga0070681_10199354 3300005458 Bacteria 1920
45 Ga0070681_10433715 3300005458 Bacteria 1226
46 Ga0068867_100309444 3300005459 Bacteria 1305
47 Ga0070706_100044948 3300005467 Bacteria 4079
48 Ga0070706_100259175 3300005467 Bacteria 1623
49 Ga0070707_100011796 3300005468 Bacteria 8160
50 Ga0070707_100114939 3300005468 Bacteria 2611
51 Ga0070707_100530767 3300005468 Bacteria 1139
52 Ga0070698_100044431 3300005471 Bacteria 4549
53 Ga0070698_100087101 3300005471 Bacteria 3109
54 Ga0070698_100087554 3300005471 Bacteria 3100
55 Ga0070699_100004615 3300005518 Bacteria 12188
56 Ga0070699_100014596 3300005518 Bacteria 6756
57 Ga0070699_100040142 3300005518 Bacteria 4053
58 Ga0070699_100081083 3300005518 Bacteria 2828
59 Ga0070699_100124876 3300005518 Bacteria 2265
60 Ga0070679_100166303 3300005530 Bacteria 2179
61 Ga0070679_100222756 3300005530 Bacteria 1847
62 Ga0070684_100199325 3300005535 Bacteria 1823
63 Ga0070697_100013459 3300005536 Bacteria 6419
64 Ga0070697_100067271 3300005536 Bacteria 2930
65 Ga0070697_100080212 3300005536 Bacteria 2688
66 Ga0070672_100033003 3300005543 Bacteria 3915
67 Ga0070686_100004247 3300005544 Bacteria 7893
68 Ga0070686_100327751 3300005544 Bacteria 1144
69 Ga0070695_100000815 3300005545 Bacteria 16797
70 Ga0070696_100473446 3300005546 Bacteria 992
71 Ga0070665_100000771 3300005548 Bacteria 42242
72 Ga0070665_100013960 3300005548 Bacteria 8078
73 Ga0070704_100009438 3300005549 Bacteria 5893
74 Ga0070704_100018274 3300005549 Bacteria 4479
75 Ga0070704_100048668 3300005549 Bacteria 2969
76 Ga0070704_100096686 3300005549 Bacteria 2214
77 Ga0068857_100103243 3300005577 Bacteria 2560
78 Ga0068854_100028019 3300005578 Bacteria 3888
79 Ga0068859_100048348 3300005617 Bacteria 4273
80 Ga0068859_100064107 3300005617 Bacteria 3707
81 Ga0068859_100092001 3300005617 Bacteria 3084
82 Ga0068859_100127949 3300005617 Bacteria 2610
83 Ga0068859_100503216 3300005617 Bacteria 1307
84 Ga0068864_100007993 3300005618 Bacteria 8721
85 Ga0068861_100101688 3300005719 Bacteria 2287
86 Ga0068861_100353348 3300005719 Bacteria 1290
87 Ga0068863_100004024 3300005841 Bacteria 14515
88 Ga0068858_100004236 3300005842 Bacteria 14116
89 Ga0068858_100118038 3300005842 Bacteria 2480
90 Ga0068858_100140039 3300005842 Bacteria 2271
91 Ga0068858_100143738 3300005842 Bacteria 2240
92 Ga0068860_100088821 3300005843 Bacteria 2942
93 Ga0068862_100128643 3300005844 Bacteria 2238
94 Ga0068862_100224523 3300005844 Bacteria 1702
95 Ga0081538_10016148 3300005981 Bacteria 5740
96 Ga0075368_10096496 3300006042 Bacteria 1212
97 Ga0075432_10019274 3300006058 Bacteria 2330
98 Ga0097621_100041369 3300006237 Bacteria 3710
99 Ga0097621_100211467 3300006237 Bacteria 1687
100 Ga0097621_100242225 3300006237 Bacteria 1577
101 Ga0068871_100013993 3300006358 Bacteria 5969
102 Ga0075428_100000003 3300006844 Bacteria 365483
103 Ga0075428_100017990 3300006844 Bacteria 7809
104 Ga0075428_100108374 3300006844 Bacteria 3027
105 Ga0075428_100456412 3300006844 Bacteria 1369
106 Ga0075430_100026510 3300006846 Bacteria 4929
107 Ga0075430_100181583 3300006846 Bacteria 1750
108 Ga0075431_100000072 3300006847 Bacteria 58754
109 Ga0075431_100040671 3300006847 Bacteria 4791
110 Ga0075431_100155698 3300006847 Bacteria 2351
111 Ga0075433_10003370 3300006852 Bacteria 12351
112 Ga0075433_10014649 3300006852 Bacteria 6413
113 Ga0075433_10038914 3300006852 Bacteria 4110
114 Ga0075433_10039426 3300006852 Bacteria 4084
115 Ga0075433_10085132 3300006852 Bacteria 2791
116 Ga0075433_10146340 3300006852 Bacteria 2100
117 Ga0075433_10322403 3300006852 Bacteria 1367
118 Ga0075433_10345290 3300006852 Bacteria 1315
119 Ga0075434_100007059 3300006871 Bacteria 10368
120 Ga0075434_100010070 3300006871 Bacteria 8852
121 Ga0075434_100019748 3300006871 Bacteria 6524
122 Ga0075434_100032830 3300006871 Bacteria 5120
123 Ga0075434_100061070 3300006871 Bacteria 3749
124 Ga0075434_100113712 3300006871 Bacteria 2719
125 Ga0075429_100016367 3300006880 Bacteria 6427
126 Ga0075429_100091375 3300006880 Bacteria 2656
127 Ga0068865_100145859 3300006881 Bacteria 1790
128 Ga0068865_100154425 3300006881 Bacteria 1744
129 Ga0068865_100317958 3300006881 Bacteria 1251
130 Ga0075436_100003909 3300006914 Bacteria 10209
131 Ga0075436_100027045 3300006914 Bacteria 3950
132 Ga0075436_100034357 3300006914 Bacteria 3496
133 Ga0075436_100055301 3300006914 Bacteria 2740
134 Ga0075436_100161975 3300006914 Bacteria 1577
135 Ga0075436_100313134 3300006914 Bacteria 1127
136 Ga0097620_100048349 3300006931 Bacteria 4273
137 Ga0097620_100064105 3300006931 Bacteria 3707
138 Ga0097620_100091999 3300006931 Bacteria 3084
139 Ga0097620_100127949 3300006931 Bacteria 2610
140 Ga0097620_100503226 3300006931 Bacteria 1307
141 Ga0075435_100000111 3300007076 Bacteria 44957
142 Ga0075435_100000810 3300007076 Bacteria 19471
143 Ga0075435_100009027 3300007076 Bacteria 7189
144 Ga0075435_100015330 3300007076 Bacteria 5759
145 Ga0075435_100093793 3300007076 Bacteria 2480
146 Ga0075435_100192920 3300007076 Bacteria 1725
147 Ga0075435_100395655 3300007076 Bacteria 1188
148 Ga0075435_100435800 3300007076 Bacteria 1129
149 Ga0075435_100482169 3300007076 Bacteria 1071
150 Ga0099794_10038222 3300007265 Bacteria 2273
151 Ga0105240_10059583 3300009093 Bacteria 4763
152 Ga0105240_10185190 3300009093 Bacteria 2453
153 Ga0111539_10000001 3300009094 Bacteria 1035431
154 Ga0111539_10000238 3300009094 Bacteria 65613
155 Ga0111539_10000827 3300009094 Bacteria 40203
156 Ga0111539_10004174 3300009094 Bacteria 18954
157 Ga0111539_10032764 3300009094 Bacteria 6311
158 Ga0111539_10176809 3300009094 Bacteria 2493
159 Ga0111539_10591834 3300009094 Bacteria 1292
160 Ga0111539_10765107 3300009094 Bacteria 1124
161 Ga0105245_10275849 3300009098 Bacteria 1642
162 Ga0105247_10026129 3300009101 Bacteria 3525
163 Ga0105247_10159485 3300009101 Bacteria 1492
164 Ga0114129_10002549 3300009147 Bacteria 25304
165 Ga0114129_10010179 3300009147 Bacteria 13406
166 Ga0114129_10046703 3300009147 Bacteria 6085
167 Ga0114129_10084789 3300009147 Bacteria 4398
168 Ga0114129_10084958 3300009147 Bacteria 4392
169 Ga0114129_10096563 3300009147 Bacteria 4091
170 Ga0114129_10183420 3300009147 Bacteria 2846
171 Ga0114129_10268434 3300009147 Bacteria 2284
172 Ga0114129_10300457 3300009147 Bacteria 2140
173 Ga0114129_10302351 3300009147 Bacteria 2132
174 Ga0114129_10359084 3300009147 Bacteria 1928
175 Ga0114129_10407818 3300009147 Bacteria 1790
176 Ga0114129_10490390 3300009147 Bacteria 1606
177 Ga0105243_10009141 3300009148 Bacteria 7567
178 Ga0105241_10071097 3300009174 Bacteria 2701
179 Ga0105242_10032323 3300009176 Bacteria 4184
180 Ga0105242_10094726 3300009176 Bacteria 2519
181 Ga0105248_10022329 3300009177 Bacteria 7018
182 Ga0105248_10033931 3300009177 Bacteria 5703
183 Ga0105248_10079589 3300009177 Bacteria 3683
184 Ga0105248_10125883 3300009177 Bacteria 2891
185 Ga0105248_10166242 3300009177 Bacteria 2487
186 Ga0105248_10220601 3300009177 Bacteria 2135
187 Ga0105248_10255673 3300009177 Bacteria 1972
188 Ga0105248_10655231 3300009177 Bacteria 1185
189 Ga0105249_10045298 3300009553 Bacteria 4000
190 Ga0105249_10160666 3300009553 Bacteria 2171
191 Ga0105249_10173772 3300009553 Bacteria 2091
192 Ga0157371_10269845 3300013102 Bacteria 1228
193 Ga0157374_10002165 3300013296 Bacteria 16562
194 Ga0157374_10035609 3300013296 Bacteria 4555
195 Ga0157374_10152617 3300013296 Bacteria 2246
196 Ga0157378_10004845 3300013297 Bacteria 11800
197 Ga0157378_10593507 3300013297 Bacteria 1118
198 Ga0163162_10066865 3300013306 Bacteria 3644
199 Ga0163162_10102842 3300013306 Bacteria 2950
200 Ga0163162_10464174 3300013306 Bacteria 1398
201 Ga0157375_10303562 3300013308 Bacteria 1760
202 Ga0163163_10014722 3300014325 Bacteria 7196
203 Ga0163163_10070744 3300014325 Bacteria 3475
204 Ga0163163_10078025 3300014325 Bacteria 3308
205 Ga0157380_10000913 3300014326 Bacteria 18608
206 Ga0157380_10004916 3300014326 Bacteria 9317
207 Ga0157380_10102203 3300014326 Bacteria 2390
208 Ga0157380_10260463 3300014326 Bacteria 1575
209 Ga0157377_10172127 3300014745 Bacteria 1355
210 Ga0157379_10012693 3300014968 Bacteria 7363
211 Ga0157379_10053981 3300014968 Bacteria 3590
212 Ga0157376_10018030 3300014969 Bacteria 5400
213 Ga0157376_10035742 3300014969 Bacteria 4021
214 Ga0157376_10046931 3300014969 Bacteria 3565
215 Ga0207680_10152108 3300025903 Bacteria 1543
216 Ga0207699_10037693 3300025906 Bacteria 2765
217 Ga0207643_10172458 3300025908 Bacteria 1306
218 Ga0207684_10004177 3300025910 Bacteria 13717
219 Ga0207684_10033331 3300025910 Bacteria 4379
220 Ga0207684_10122656 3300025910 Bacteria 2228
221 Ga0207654_10017021 3300025911 Bacteria 3794
222 Ga0207707_10217647 3300025912 Bacteria 1663
223 Ga0207695_10126163 3300025913 Bacteria 2521
224 Ga0207660_10085505 3300025917 Bacteria 2327
225 Ga0207662_10006467 3300025918 Bacteria 6327
226 Ga0207657_10008966 3300025919 Bacteria 10106
227 Ga0207646_10019571 3300025922 Bacteria 6288
228 Ga0207646_10037673 3300025922 Bacteria 4359
229 Ga0207646_10052394 3300025922 Bacteria 3651
230 Ga0207646_10168120 3300025922 Bacteria 1980
231 Ga0207646_10395510 3300025922 Bacteria 1248
232 Ga0207646_10451241 3300025922 Bacteria 1160
233 Ga0207681_10007925 3300025923 Bacteria 6495
234 Ga0207659_10001565 3300025926 Bacteria 13581
235 Ga0207687_10159403 3300025927 Bacteria 1730
236 Ga0207700_10124554 3300025928 Bacteria 2094
237 Ga0207644_10200932 3300025931 Bacteria 1572
238 Ga0207686_10016274 3300025934 Bacteria 4172
239 Ga0207670_10223894 3300025936 Bacteria 1441
240 Ga0207670_10242670 3300025936 Bacteria 1389
241 Ga0207669_10022483 3300025937 Bacteria 3351
242 Ga0207669_10034198 3300025937 Bacteria 2877
243 Ga0207669_10159512 3300025937 Bacteria 1591
244 Ga0207669_10216488 3300025937 Bacteria 1402
245 Ga0207704_10042950 3300025938 Bacteria 2665
246 Ga0207704_10166574 3300025938 Bacteria 1575
247 Ga0207665_10050700 3300025939 Bacteria 2792
248 Ga0207691_10285907 3300025940 Bacteria 1418
249 Ga0207711_10022277 3300025941 Bacteria 5297
250 Ga0207711_10053644 3300025941 Bacteria 3457
251 Ga0207711_10167153 3300025941 Bacteria 1994
252 Ga0207711_10228384 3300025941 Bacteria 1704
253 Ga0207711_10372907 3300025941 Bacteria 1323
254 Ga0207711_10562836 3300025941 Bacteria 1063
255 Ga0207689_10022865 3300025942 Bacteria 5251
256 Ga0207679_10067882 3300025945 Bacteria 2677
257 Ga0207667_10402344 3300025949 Bacteria 1394
258 Ga0207651_10277997 3300025960 Bacteria 1382
259 Ga0207712_10093761 3300025961 Bacteria 2216
260 Ga0207712_10284136 3300025961 Bacteria 1351
261 Ga0207640_10019459 3300025981 Bacteria 4011
262 Ga0207640_10046696 3300025981 Bacteria 2789
263 Ga0207703_10029761 3300026035 Bacteria 4310
264 Ga0207703_10089247 3300026035 Bacteria 2589
265 Ga0207703_10117230 3300026035 Bacteria 2281
266 Ga0207703_10201146 3300026035 Bacteria 1770
267 Ga0207703_10451909 3300026035 Bacteria 1200
268 Ga0207708_10128649 3300026075 Bacteria 1978
269 Ga0207708_10510761 3300026075 Bacteria 1008
270 Ga0207702_10090609 3300026078 Bacteria 2676
271 Ga0207641_10001443 3300026088 Bacteria 23349
272 Ga0207641_10359227 3300026088 Bacteria 1390
273 Ga0207648_10058005 3300026089 Bacteria 3377
274 Ga0207648_10105958 3300026089 Bacteria 2466
275 Ga0207648_10160594 3300026089 Bacteria 1985
276 Ga0207676_10005302 3300026095 Bacteria 9133
277 Ga0207676_10013484 3300026095 Bacteria 5872
278 Ga0207674_10097991 3300026116 Bacteria 2916
279 Ga0207675_100009768 3300026118 Bacteria 8982
280 Ga0207675_100029092 3300026118 Bacteria 5149
281 Ga0207683_10242964 3300026121 Bacteria 1642
282 Ga0209974_10016911 3300027876 Bacteria 2421
283 Ga0207428_10000002 3300027907 Bacteria 854851
284 Ga0207428_10000054 3300027907 Bacteria 175237
285 Ga0207428_10002086 3300027907 Bacteria 20130
286 Ga0207428_10003212 3300027907 Bacteria 15972
287 Ga0207428_10042966 3300027907 Bacteria 3653
288 Ga0207428_10090168 3300027907 Bacteria 2382
289 Ga0268266_10003281 3300028379 Bacteria 16279
290 Ga0268265_10017146 3300028380 Bacteria 4991
291 Ga0268265_10205765 3300028380 Bacteria 1711
292 Ga0268264_10104327 3300028381 Bacteria 2471
293 Ga0268264_10143714 3300028381 Bacteria 2131
294 Ga0307408_100119672 3300031548 Bacteria 2038
295 Ga0307408_100224354 3300031548 Bacteria 1535
296 Ga0307410_10064510 3300031852 Bacteria 2517
297 Ga0307406_10095276 3300031901 Bacteria 2014
298 Ga0307407_10060086 3300031903 Bacteria 2217
299 Ga0307416_100571314 3300032002 Bacteria 1207
300 Ga0373930_0000697 3300034816 Bacteria 4719
301 Ga0373948_0002506 3300034817 Bacteria 2727
302 Ga0373958_0018223 3300034819 Bacteria 1270
303 Ga0373959_0001519 3300034820 Bacteria 3698
304 Ga0373938_0002592 3300034957 Bacteria 2914
305 Ga0373929_0013702 3300035085 Bacteria 1557
306 Ga0373949_0004859 3300035090 Bacteria 3043
307 Ga0373951_0015273 3300035091 Bacteria 1728
308 Ga0373923_0109693 3300035111 Bacteria 1224
309 Ga0373932_0001911 3300035112 Bacteria 5562
310 Ga0373936_0090375 3300035113 Bacteria 1283
311 Ga0373939_0020814 3300035114 Bacteria 1787
312 Ga0373941_0003424 3300035115 Bacteria 3592
313 Ga0373960_0001571 3300035121 Bacteria 5097
314 Ga0373946_0016584 3300035171 Bacteria 2808
315 Ga0373961_0001372 3300035241 Bacteria 7304
316 Ga0373962_0021861 3300035242 Bacteria 1691
317 Ga0373924_0071867 3300035410 Bacteria 1460
318 Ga0373931_0015000 3300035691 Bacteria 3797
319 Ga0373931_0049040 3300035691 Bacteria 2240
320 Ga0373931_0069862 3300035691 Bacteria 1914
321 Ga0373927_0119777 3300035695 Bacteria 1718
322 Ga0373937_0297260 3300036401 Bacteria 1526
323 Ga0373937_0341205 3300036401 Bacteria 1419
324 Ga0373925_0007435 3300037068 Bacteria 7992
325 Ga0451577_0000844 3300042876 Bacteria 45822
326 Ga0451577_0067126 3300042876 Bacteria 3199
327 Ga0453683_0157238 3300044673 Bacteria 1437
328 Ga0453684_0130822 3300044712 Bacteria 3011
329 Ga0451576_0001424 3300045051 Bacteria 40965
330 Ga0451576_0345179 3300045051 Bacteria 1559
331 Ga0495592_0018363 3300046454 Bacteria 5318
332 Ga0495629_0070779 3300046459 Bacteria 2434
333 Ga0495580_0001114 3300046472 Bacteria 23622
334 Ga0495582_0127316 3300046473 Bacteria 1438
335 Ga0495639_0167267 3300046475 Bacteria 1066
336 Ga0495608_0062166 3300046511 Bacteria 2454
337 Ga0495628_0084785 3300046516 Bacteria 2458
338 Ga0495628_0423207 3300046516 Bacteria 970
339 Ga0495630_0006053 3300046517 Bacteria 8570
340 Ga0495645_0172974 3300046543 Bacteria 1485
341 Ga0495667_0099656 3300046559 Bacteria 1880
342 Ga0495657_0194358 3300046675 Bacteria 1239
343 Ga0495647_0039820 3300046681 Bacteria 1783
344 Ga0495669_0109870 3300046684 Bacteria 1287
345 Ga0495613_0001615 3300046689 Bacteria 17153
346 Ga0495600_0042052 3300046809 Bacteria 2978
347 Ga0495604_0079335 3300047317 Bacteria 2462
348 Ga0495674_0010439 3300047319 Bacteria 8793
349 Ga0496101_0000773 3300048904 Bacteria 18926
350 Ga0496102_0032067 3300048905 Bacteria 4719
351 Ga0496104_0048058 3300048907 Bacteria 4023
352 Ga0496104_0133289 3300048907 Bacteria 2387
353 Ga0496104_0364203 3300048907 Bacteria 1358
354 Ga0496106_0134316 3300048909 Bacteria 1942
355 Ga0496108_0006865 3300048911 Bacteria 9212
356 Ga0496109_0572768 3300048912 Bacteria 1064
357 Ga0496112_0005637 3300048915 Bacteria 10867
358 Ga0496112_0466922 3300048915 Bacteria 1199
359 Ga0496112_0758114 3300048915 Bacteria 896
360 Ga0496114_0000233 3300048917 Bacteria 40546
361 Ga0496114_0031034 3300048917 Bacteria 4396
362 Ga0501033_0107401 3300049570 Bacteria 2033
363 Ga0501033_0144496 3300049570 Bacteria 1719
364 Ga0501036_0061562 3300049572 Bacteria 3179
365 Ga0501038_0071937 3300049574 Bacteria 2932
366 Ga0501038_0240299 3300049574 Bacteria 1438
367 Ga0501039_0092433 3300049575 Bacteria 2358
368 Ga0501040_0021277 3300049576 Bacteria 4330
369 Ga0501040_0028487 3300049576 Bacteria 3766
370 Ga0501040_0076392 3300049576 Bacteria 2316
371 Ga0501040_0108644 3300049576 Bacteria 1939
372 Ga0501041_0002515 3300049577 Bacteria 10444
373 Ga0501070_0398624 3300049586 Bacteria 1113
374 Ga0501071_0017276 3300049587 Bacteria 4973
375 Ga0501071_0080197 3300049587 Bacteria 2386
376 Ga0501071_0097470 3300049587 Bacteria 2165
377 Ga0501072_0026622 3300049588 Bacteria 4509
378 Ga0501074_0069357 3300049590 Bacteria 2535
379 Ga0501075_0009690 3300049591 Bacteria 6748
380 Ga0501075_0026565 3300049591 Bacteria 4264
381 Ga0501075_0081303 3300049591 Bacteria 2453
382 Ga0501075_0102530 3300049591 Bacteria 2173
383 Ga0501076_0038133 3300049592 Bacteria 3772
384 Ga0501076_0038921 3300049592 Bacteria 3732
385 Ga0501077_0014912 3300049593 Bacteria 4886
386 Ga0501077_0043188 3300049593 Bacteria 2865
387 Ga0501077_0053586 3300049593 Bacteria 2561
388 Ga0501077_0162010 3300049593 Bacteria 1420
389 Ga0501079_0007858 3300049741 Bacteria 8078
390 Ga0501079_0010024 3300049741 Bacteria 7193
391 Ga0501079_0026677 3300049741 Bacteria 4430
392 Ga0501079_0197626 3300049741 Bacteria 1570
393 Ga0501079_0265235 3300049741 Bacteria 1342
394 Ga0501079_0330709 3300049741 Bacteria 1193
395 Ga0501080_0044140 3300049742 Bacteria 4150
396 Ga0501081_0001773 3300049743 Bacteria 13376
397 Ga0501081_0034017 3300049743 Bacteria 3466
398 Ga0501081_0039120 3300049743 Bacteria 3244
399 Ga0501081_0344660 3300049743 Bacteria 1097
400 Ga0501083_0052702 3300049744 Bacteria 2733
401 Ga0501035_0252700 3300049822 Bacteria 1496
402 Ga0501045_0007431 3300049824 Bacteria 7614
403 Ga0501045_0067297 3300049824 Bacteria 2630
404 nmdc:mga05p37_13544_c1 3300050507 Bacteria 9778
405 nmdc:mga05p37_15680_c1 3300050507 Bacteria 9109
406 nmdc:mga05p37_235466_c1 3300050507 Bacteria 2204
407 nmdc:mga05p37_240666_c1 3300050507 Bacteria 2176
408 nmdc:mga05p37_248946_c1 3300050507 Bacteria 2132
409 nmdc:mga05p37_254865_c1 3300050507 Bacteria 2103
410 nmdc:mga05p37_317095_c1 3300050507 Bacteria 1846
411 nmdc:mga05p37_346570_c1 3300050507 Bacteria 1750
412 nmdc:mga05p37_421673_c1 3300050507 Bacteria 1553
413 nmdc:mga05p37_45139_c1 3300050507 Bacteria 5422
414 nmdc:mga05p37_626998_c1 3300050507 Bacteria 1209
415 nmdc:mga09592_30220_c1 3300050508 Bacteria 4507
416 nmdc:mga09592_69037_c1 3300050508 Bacteria 2998
417 nmdc:mga06r32_173064_c1 3300050510 Bacteria 2143
418 nmdc:mga06r32_352149_c1 3300050510 Bacteria 1457
419 nmdc:mga06r32_75691_c1 3300050510 Bacteria 3267
420 nmdc:mga06r32_80538_c1 3300050510 Bacteria 3169
421 nmdc:mga06r32_987_c1 3300050510 Bacteria 25489
422 nmdc:mga08y16_101662_c1 3300050511 Bacteria 2993
423 nmdc:mga08y16_1197_c1 3300050511 Bacteria 25596
424 nmdc:mga08y16_13575_c1 3300050511 Bacteria 8573
425 nmdc:mga08y16_20418_c1 3300050511 Bacteria 6992
426 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
427 nmdc:mga08y16_44855_c1 3300050511 Bacteria 4634
428 nmdc:mga0n895_127624_c1 3300050512 Bacteria 2567
429 nmdc:mga0n895_18764_c1 3300050512 Bacteria 6410
430 nmdc:mga0n895_289970_c1 3300050512 Bacteria 1659
431 nmdc:mga0n895_362399_c1 3300050512 Bacteria 1468
432 nmdc:mga0n895_45488_c1 3300050512 Bacteria 4284
433 nmdc:mga0n895_46427_c1 3300050512 Bacteria 4244
434 nmdc:mga0n895_5949_c1 3300050512 Bacteria 10264
435 nmdc:mga0n895_87429_c1 3300050512 Bacteria 3114
436 nmdc:mga0rr50_168777_c1 3300050513 Bacteria 1781
437 nmdc:mga0rr50_215406_c1 3300050513 Bacteria 1584
438 nmdc:mga0rr50_30525_c1 3300050513 Bacteria 3817
439 nmdc:mga0rr50_3_c1 3300050513 Bacteria 353622
440 nmdc:mga0rr50_40183_c1 3300050513 Bacteria 3400
441 nmdc:mga0rr50_43000_c1 3300050513 Bacteria 3303
442 nmdc:mga0rr50_5622_c1 3300050513 Bacteria 7505
443 nmdc:mga0rr50_62931_c1 3300050513 Bacteria 2801
444 nmdc:mga08x19_239783_c1 3300050514 Bacteria 1250
445 nmdc:mga08x19_262152_c1 3300050514 Bacteria 1195
446 nmdc:mga08x19_627_c1 3300050514 Bacteria 22773
447 nmdc:mga08x19_96312_c1 3300050514 Bacteria 1959
448 nmdc:mga0a205_10023_c1 3300050515 Bacteria 8693
449 nmdc:mga0a205_1085_c1 3300050515 Bacteria 22566
450 nmdc:mga0a205_130443_c1 3300050515 Bacteria 2414
451 nmdc:mga0a205_257415_c1 3300050515 Bacteria 1623
452 nmdc:mga0a205_273574_c1 3300050515 Bacteria 1565
453 nmdc:mga0a205_307759_c1 3300050515 Bacteria 1457
454 nmdc:mga0a205_45151_c1 3300050515 Bacteria 4248
455 nmdc:mga0a205_57111_c1 3300050515 Bacteria 3769
456 nmdc:mga0a205_58999_c1 3300050515 Bacteria 3707
457 nmdc:mga0a205_66025_c1 3300050515 Bacteria 3496
458 Ga0495601_0002222 3300053077 Bacteria 10929
459 Ga0495655_0086779 3300053083 Bacteria 905
460 Ga0495619_0022423 3300053085 Bacteria 4041
461 Ga0495619_0198688 3300053085 Bacteria 1388
462 Ga0500556_0005539 3300053104 Bacteria 3566
463 Ga0501084_0037230 3300054114 Bacteria 4064
464 Ga0501084_0219316 3300054114 Bacteria 1605
465 Ga0501084_0342409 3300054114 Bacteria 1263
466 Ga0590071_023702 3300059421 Bacteria 1453
467 Ga0501082_0016127 3300060353 Bacteria 6426
468 Ga0501082_0027944 3300060353 Bacteria 4859
469 Ga0501082_0209844 3300060353 Bacteria 1694
470 Ga0530510_0000169 3300061734 Bacteria 39699
471 Ga0530510_0021607 3300061734 Bacteria 4578
472 Ga0530510_0054422 3300061734 Bacteria 2891
473 2997459013 2997451912 Bacteria 8492419
474 Ga0081455_10185420
475 JGI24751J29686_10006372
476 Ga0065712_10003970
477 Ga0065715_10285746
478 Ga0070658_10083883
479 Ga0070676_10316703
480 Ga0070690_100005710
481 Ga0070690_100217162
482 Ga0070670_100040942
483 Ga0070677_10144203
484 Ga0070666_10212756
485 Ga0070680_100023646
486 Ga0070680_100434571
487 Ga0070687_100018562
488 Ga0070669_100025806
489 Ga0070675_100000647
490 Ga0070671_100108853
491 Ga0070674_100002099
492 Ga0070674_100022357
493 Ga0070674_100023188
494 Ga0070674_100070434
495 Ga0070674_100166586
496 Ga0070673_100115092
497 Ga0070673_100404620
498 Ga0070659_100106334
499 Ga0070667_100013351
500 Ga0070709_10070578
501 Ga0070713_100004221
502 Ga0070701_10173203
503 Ga0070705_100198998
504 Ga0070700_100024762
505 Ga0070694_100000539
506 Ga0070694_100023467
507 Ga0070694_100045982
508 Ga0070708_100032541
509 Ga0070708_100044610
510 Ga0070708_100067071
511 Ga0070708_100078623
512 Ga0070708_100085018
513 Ga0070708_100124773
514 Ga0070678_100449915
515 Ga0070662_100116918
516 Ga0070662_100294011
517 Ga0070681_10199354
518 Ga0070681_10433715
519 Ga0068867_100309444
520 Ga0070706_100044948
521 Ga0070706_100259175
522 Ga0070707_100011796
523 Ga0070707_100114939
524 Ga0070707_100530767
525 Ga0070698_100044431
526 Ga0070698_100087101
527 Ga0070698_100087554
528 Ga0070699_100004615
529 Ga0070699_100014596
530 Ga0070699_100040142
531 Ga0070699_100081083
532 Ga0070699_100124876
533 Ga0070679_100166303
534 Ga0070679_100222756
535 Ga0070684_100199325
536 Ga0070697_100013459
537 Ga0070697_100067271
538 Ga0070697_100080212
539 Ga0070672_100033003
540 Ga0070686_100004247
541 Ga0070686_100327751
542 Ga0070695_100000815
543 Ga0070696_100473446
544 Ga0070665_100000771
545 Ga0070665_100013960
546 Ga0070704_100009438
547 Ga0070704_100018274
548 Ga0070704_100048668
549 Ga0070704_100096686
550 Ga0068857_100103243
551 Ga0068854_100028019
552 Ga0068859_100048348
553 Ga0068859_100064107
554 Ga0068859_100092001
555 Ga0068859_100127949
556 Ga0068859_100503216
557 Ga0068864_100007993
558 Ga0068861_100101688
559 Ga0068861_100353348
560 Ga0068863_100004024
561 Ga0068858_100004236
562 Ga0068858_100118038
563 Ga0068858_100140039
564 Ga0068858_100143738
565 Ga0068860_100088821
566 Ga0068862_100128643
567 Ga0068862_100224523
568 Ga0081538_10016148
569 Ga0075368_10096496
570 Ga0075432_10019274
571 Ga0097621_100041369
572 Ga0097621_100211467
573 Ga0097621_100242225
574 Ga0068871_100013993
575 Ga0075428_100000003
576 Ga0075428_100017990
577 Ga0075428_100108374
578 Ga0075428_100456412
579 Ga0075430_100026510
580 Ga0075430_100181583
581 Ga0075431_100000072
582 Ga0075431_100040671
583 Ga0075431_100155698
584 Ga0075433_10003370
585 Ga0075433_10014649
586 Ga0075433_10038914
587 Ga0075433_10039426
588 Ga0075433_10085132
589 Ga0075433_10146340
590 Ga0075433_10322403
591 Ga0075433_10345290
592 Ga0075434_100007059
593 Ga0075434_100010070
594 Ga0075434_100019748
595 Ga0075434_100032830
596 Ga0075434_100061070
597 Ga0075434_100113712
598 Ga0075429_100016367
599 Ga0075429_100091375
600 Ga0068865_100145859
601 Ga0068865_100154425
602 Ga0068865_100317958
603 Ga0075436_100003909
604 Ga0075436_100027045
605 Ga0075436_100034357
606 Ga0075436_100055301
607 Ga0075436_100161975
608 Ga0075436_100313134
609 Ga0097620_100048349
610 Ga0097620_100064105
611 Ga0097620_100091999
612 Ga0097620_100127949
613 Ga0097620_100503226
614 Ga0075435_100000111
615 Ga0075435_100000810
616 Ga0075435_100009027
617 Ga0075435_100015330
618 Ga0075435_100093793
619 Ga0075435_100192920
620 Ga0075435_100395655
621 Ga0075435_100435800
622 Ga0075435_100482169
623 Ga0099794_10038222
624 Ga0105240_10059583
625 Ga0105240_10185190
626 Ga0111539_10000001
627 Ga0111539_10000238
628 Ga0111539_10000827
629 Ga0111539_10004174
630 Ga0111539_10032764
631 Ga0111539_10176809
632 Ga0111539_10591834
633 Ga0111539_10765107
634 Ga0105245_10275849
635 Ga0105247_10026129
636 Ga0105247_10159485
637 Ga0114129_10002549
638 Ga0114129_10010179
639 Ga0114129_10046703
640 Ga0114129_10084789
641 Ga0114129_10084958
642 Ga0114129_10096563
643 Ga0114129_10183420
644 Ga0114129_10268434
645 Ga0114129_10300457
646 Ga0114129_10302351
647 Ga0114129_10359084
648 Ga0114129_10407818
649 Ga0114129_10490390
650 Ga0105243_10009141
651 Ga0105241_10071097
652 Ga0105242_10032323
653 Ga0105242_10094726
654 Ga0105248_10022329
655 Ga0105248_10033931
656 Ga0105248_10079589
657 Ga0105248_10125883
658 Ga0105248_10166242
659 Ga0105248_10220601
660 Ga0105248_10255673
661 Ga0105248_10655231
662 Ga0105249_10045298
663 Ga0105249_10160666
664 Ga0105249_10173772
665 Ga0157371_10269845
666 Ga0157374_10002165
667 Ga0157374_10035609
668 Ga0157374_10152617
669 Ga0157378_10004845
670 Ga0157378_10593507
671 Ga0163162_10066865
672 Ga0163162_10102842
673 Ga0163162_10464174
674 Ga0157375_10303562
675 Ga0163163_10014722
676 Ga0163163_10070744
677 Ga0163163_10078025
678 Ga0157380_10000913
679 Ga0157380_10004916
680 Ga0157380_10102203
681 Ga0157380_10260463
682 Ga0157377_10172127
683 Ga0157379_10012693
684 Ga0157379_10053981
685 Ga0157376_10018030
686 Ga0157376_10035742
687 Ga0157376_10046931
688 Ga0207680_10152108
689 Ga0207699_10037693
690 Ga0207643_10172458
691 Ga0207684_10004177
692 Ga0207684_10033331
693 Ga0207684_10122656
694 Ga0207654_10017021
695 Ga0207707_10217647
696 Ga0207695_10126163
697 Ga0207660_10085505
698 Ga0207662_10006467
699 Ga0207657_10008966
700 Ga0207646_10019571
701 Ga0207646_10037673
702 Ga0207646_10052394
703 Ga0207646_10168120
704 Ga0207646_10395510
705 Ga0207646_10451241
706 Ga0207681_10007925
707 Ga0207659_10001565
708 Ga0207687_10159403
709 Ga0207700_10124554
710 Ga0207644_10200932
711 Ga0207686_10016274
712 Ga0207670_10223894
713 Ga0207670_10242670
714 Ga0207669_10022483
715 Ga0207669_10034198
716 Ga0207669_10159512
717 Ga0207669_10216488
718 Ga0207704_10042950
719 Ga0207704_10166574
720 Ga0207665_10050700
721 Ga0207691_10285907
722 Ga0207711_10022277
723 Ga0207711_10053644
724 Ga0207711_10167153
725 Ga0207711_10228384
726 Ga0207711_10372907
727 Ga0207711_10562836
728 Ga0207689_10022865
729 Ga0207679_10067882
730 Ga0207667_10402344
731 Ga0207651_10277997
732 Ga0207712_10093761
733 Ga0207712_10284136
734 Ga0207640_10019459
735 Ga0207640_10046696
736 Ga0207703_10029761
737 Ga0207703_10089247
738 Ga0207703_10117230
739 Ga0207703_10201146
740 Ga0207703_10451909
741 Ga0207708_10128649
742 Ga0207708_10510761
743 Ga0207702_10090609
744 Ga0207641_10001443
745 Ga0207641_10359227
746 Ga0207648_10058005
747 Ga0207648_10105958
748 Ga0207648_10160594
749 Ga0207676_10005302
750 Ga0207676_10013484
751 Ga0207674_10097991
752 Ga0207675_100009768
753 Ga0207675_100029092
754 Ga0207683_10242964
755 Ga0209974_10016911
756 Ga0207428_10000002
757 Ga0207428_10000054
758 Ga0207428_10002086
759 Ga0207428_10003212
760 Ga0207428_10042966
761 Ga0207428_10090168
762 Ga0268266_10003281
763 Ga0268265_10017146
764 Ga0268265_10205765
765 Ga0268264_10104327
766 Ga0268264_10143714
767 Ga0307408_100119672
768 Ga0307408_100224354
769 Ga0307410_10064510
770 Ga0307406_10095276
771 Ga0307407_10060086
772 Ga0307416_100571314
773 Ga0373930_0000697
774 Ga0373948_0002506
775 Ga0373958_0018223
776 Ga0373959_0001519
777 Ga0373938_0002592
778 Ga0373929_0013702
779 Ga0373949_0004859
780 Ga0373951_0015273
781 Ga0373923_0109693
782 Ga0373932_0001911
783 Ga0373936_0090375
784 Ga0373939_0020814
785 Ga0373941_0003424
786 Ga0373960_0001571
787 Ga0373946_0016584
788 Ga0373961_0001372
789 Ga0373962_0021861
790 Ga0373924_0071867
791 Ga0373931_0015000
792 Ga0373931_0049040
793 Ga0373931_0069862
794 Ga0373927_0119777
795 Ga0373937_0297260
796 Ga0373937_0341205
797 Ga0373925_0007435
798 Ga0451577_0000844
799 Ga0451577_0067126
800 Ga0453683_0157238
801 Ga0453684_0130822
802 Ga0451576_0001424
803 Ga0451576_0345179
804 Ga0495592_0018363
805 Ga0495629_0070779
806 Ga0495580_0001114
807 Ga0495582_0127316
808 Ga0495639_0167267
809 Ga0495608_0062166
810 Ga0495628_0084785
811 Ga0495628_0423207
812 Ga0495630_0006053
813 Ga0495645_0172974
814 Ga0495667_0099656
815 Ga0495657_0194358
816 Ga0495647_0039820
817 Ga0495669_0109870
818 Ga0495613_0001615
819 Ga0495600_0042052
820 Ga0495604_0079335
821 Ga0495674_0010439
822 Ga0496101_0000773
823 Ga0496102_0032067
824 Ga0496104_0048058
825 Ga0496104_0133289
826 Ga0496104_0364203
827 Ga0496106_0134316
828 Ga0496108_0006865
829 Ga0496109_0572768
830 Ga0496112_0005637
831 Ga0496112_0466922
832 Ga0496112_0758114
833 Ga0496114_0000233
834 Ga0496114_0031034
835 Ga0501033_0107401
836 Ga0501033_0144496
837 Ga0501036_0061562
838 Ga0501038_0071937
839 Ga0501038_0240299
840 Ga0501039_0092433
841 Ga0501040_0021277
842 Ga0501040_0028487
843 Ga0501040_0076392
844 Ga0501040_0108644
845 Ga0501041_0002515
846 Ga0501070_0398624
847 Ga0501071_0017276
848 Ga0501071_0080197
849 Ga0501071_0097470
850 Ga0501072_0026622
851 Ga0501074_0069357
852 Ga0501075_0009690
853 Ga0501075_0026565
854 Ga0501075_0081303
855 Ga0501075_0102530
856 Ga0501076_0038133
857 Ga0501076_0038921
858 Ga0501077_0014912
859 Ga0501077_0043188
860 Ga0501077_0053586
861 Ga0501077_0162010
862 Ga0501079_0007858
863 Ga0501079_0010024
864 Ga0501079_0026677
865 Ga0501079_0197626
866 Ga0501079_0265235
867 Ga0501079_0330709
868 Ga0501080_0044140
869 Ga0501081_0001773
870 Ga0501081_0034017
871 Ga0501081_0039120
872 Ga0501081_0344660
873 Ga0501083_0052702
874 Ga0501035_0252700
875 Ga0501045_0007431
876 Ga0501045_0067297
877 nmdc:mga05p37_13544_c1
878 nmdc:mga05p37_15680_c1
879 nmdc:mga05p37_235466_c1
880 nmdc:mga05p37_240666_c1
881 nmdc:mga05p37_248946_c1
882 nmdc:mga05p37_254865_c1
883 nmdc:mga05p37_317095_c1
884 nmdc:mga05p37_346570_c1
885 nmdc:mga05p37_421673_c1
886 nmdc:mga05p37_45139_c1
887 nmdc:mga05p37_626998_c1
888 nmdc:mga09592_30220_c1
889 nmdc:mga09592_69037_c1
890 nmdc:mga06r32_173064_c1
891 nmdc:mga06r32_352149_c1
892 nmdc:mga06r32_75691_c1
893 nmdc:mga06r32_80538_c1
894 nmdc:mga06r32_987_c1
895 nmdc:mga08y16_101662_c1
896 nmdc:mga08y16_1197_c1
897 nmdc:mga08y16_13575_c1
898 nmdc:mga08y16_20418_c1
899 nmdc:mga08y16_3_c1
900 nmdc:mga08y16_44855_c1
901 nmdc:mga0n895_127624_c1
902 nmdc:mga0n895_18764_c1
903 nmdc:mga0n895_289970_c1
904 nmdc:mga0n895_362399_c1
905 nmdc:mga0n895_45488_c1
906 nmdc:mga0n895_46427_c1
907 nmdc:mga0n895_5949_c1
908 nmdc:mga0n895_87429_c1
909 nmdc:mga0rr50_168777_c1
910 nmdc:mga0rr50_215406_c1
911 nmdc:mga0rr50_30525_c1
912 nmdc:mga0rr50_3_c1
913 nmdc:mga0rr50_40183_c1
914 nmdc:mga0rr50_43000_c1
915 nmdc:mga0rr50_5622_c1
916 nmdc:mga0rr50_62931_c1
917 nmdc:mga08x19_239783_c1
918 nmdc:mga08x19_262152_c1
919 nmdc:mga08x19_627_c1
920 nmdc:mga08x19_96312_c1
921 nmdc:mga0a205_10023_c1
922 nmdc:mga0a205_1085_c1
923 nmdc:mga0a205_130443_c1
924 nmdc:mga0a205_257415_c1
925 nmdc:mga0a205_273574_c1
926 nmdc:mga0a205_307759_c1
927 nmdc:mga0a205_45151_c1
928 nmdc:mga0a205_57111_c1
929 nmdc:mga0a205_58999_c1
930 nmdc:mga0a205_66025_c1
931 Ga0495601_0002222
932 Ga0495655_0086779
933 Ga0495619_0022423
934 Ga0495619_0198688
935 Ga0500556_0005539
936 Ga0501084_0037230
937 Ga0501084_0219316
938 Ga0501084_0342409
939 Ga0590071_023702
940 Ga0501082_0016127
941 Ga0501082_0027944
942 Ga0501082_0209844
943 Ga0530510_0000169
944 Ga0530510_0021607
945 Ga0530510_0054422
946 2997459013

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

146

224

0.97

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

5

294

0.92

PF00890

FAD_binding_2

FAD binding domain

6

46

0.9

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

58

277

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uwy-assembly1.cif.gz_A-2 the crystal structure of thioredoxin reductase from streptococcus pyogenes mgas5005 0.9433 1 308
5uwy-assembly1.cif.gz_A-2 the crystal structure of thioredoxin reductase from streptococcus pyogenes mgas5005 0.9404 1 308
4gcm-assembly1.cif.gz_A crystal structure of a thioredoxine reductase (trxb) from staphylococcus aureus subsp. aureus mu50 at 1.80 a resolution 0.9382 6 306
2q7v-assembly1.cif.gz_B crystal structure of deinococcus radiodurans thioredoxin reductase 0.9364 6 308
5uth-assembly1.cif.gz_A crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad 0.9342 3 306
ID Description Score Start End Superfamily
5uthA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9689 116 240 3.50.50.60
2q0kA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9638 116 240 3.50.50.60
5uthA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9613 116 240 3.50.50.60
3f8rD02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9583 116 240 3.50.50.60
2q0kA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9563 116 240 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A3C0YJU2-F1-model_v4 deleted 0.996 134 203
AF-A0A3C0YJU2-F1-model_v4 deleted 0.9821 134 203
AF-A0A3D5UWY6-F1-model_v4 Thioredoxin-disulfide reductase 0.9803 141 232 GO:0016491
AF-K1UEN0-F1-model_v4 Protein containing Pyridine nucleotide-disulfide oxidoreductase, NAD-binding region domain protein (EC 1.-.-.-) 0.9741 139 206 GO:0016491
AF-A0A7H4N4U0-F1-model_v4 Alkyl hydroperoxide reductase protein F (EC 1.8.1.-) 0.9664 118 200 GO:0016668

Map