F450886

General Info

Members Datasets Scaffolds Average Seq Length
472 255 944 214

Family's Representative Sequence

Representative Sequence 3300047322|Ga0495680_0304399|Ga0495680_0304399_346_1074
Length 242
Sequence MFQSACTKAAVSASRSADVGIRPHYDLEPMATRGLIFDFNGTLSDDEPILCEIFIQLFAEHGKPLSAQEYFDELAGLSDPEIVRTWLGPDHADVEVVVAERVERYRAAVADGSSVSERTRVAVRYAAERVPLAICSGAAQAEIAPVVEASGLAPLLRGIVASDDVVAGKPHPEGYRRALELLGVAAGDVAVFEDTEAGIAAARAAGVGHVLAMTGTLDANRLRDADELIDHLDVDVIRRLLA

Samples

Sample ID Description Type Environment
1 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
111 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
130 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
131 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
142 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
143 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
144 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
167 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
179 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
180 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
192 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
251 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.11
Rhizosphere 90.68
Stem 0
Stem Tuber 0
Unclassified 8.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495680_0304399 3300047322 Bacteria 1118
2 rootL2_10290870 3300003322 Bacteria 1351
3 Ga0070658_10536607 3300005327 Bacteria 1012
4 Ga0070683_100071298 3300005329 Bacteria 3242
5 Ga0070683_100177538 3300005329 Bacteria 2022
6 Ga0070680_100011877 3300005336 Bacteria 6756
7 Ga0070682_100007130 3300005337 Bacteria 6294
8 Ga0070682_100104712 3300005337 Bacteria 1874
9 Ga0070682_100164106 3300005337 Bacteria 1537
10 Ga0070660_100005959 3300005339 Bacteria 8425
11 Ga0070660_100012405 3300005339 Bacteria 6085
12 Ga0070660_100442074 3300005339 Bacteria 1078
13 Ga0070661_100102950 3300005344 Bacteria 2126
14 Ga0070669_100337624 3300005353 Bacteria 1220
15 Ga0070671_100476496 3300005355 Bacteria 1072
16 Ga0070674_100100285 3300005356 Bacteria 2108
17 Ga0070709_10014042 3300005434 Bacteria 4520
18 Ga0070709_10127849 3300005434 Bacteria 1731
19 Ga0070714_100059342 3300005435 Bacteria 3280
20 Ga0070714_100100247 3300005435 Bacteria 2551
21 Ga0070714_100160715 3300005435 Bacteria 2032
22 Ga0070714_100226675 3300005435 Bacteria 1720
23 Ga0070714_100403400 3300005435 Bacteria 1293
24 Ga0070714_100495730 3300005435 Bacteria 1164
25 Ga0070713_100042317 3300005436 Bacteria 3717
26 Ga0070713_100065601 3300005436 Bacteria 3051
27 Ga0070713_100207010 3300005436 Bacteria 1774
28 Ga0070713_100465041 3300005436 Unclassified 1190
29 Ga0070710_10030364 3300005437 Bacteria 2907
30 Ga0070711_100049491 3300005439 Bacteria 2878
31 Ga0070711_100337651 3300005439 Bacteria 1208
32 Ga0070708_100634634 3300005445 Bacteria 1007
33 Ga0070678_100218487 3300005456 Bacteria 1583
34 Ga0070681_10020985 3300005458 Bacteria 6544
35 Ga0070681_10067218 3300005458 Bacteria 3552
36 Ga0070681_10142456 3300005458 Bacteria 2326
37 Ga0070681_10209821 3300005458 Bacteria 1864
38 Ga0068867_100162948 3300005459 Bacteria 1760
39 Ga0070706_100228857 3300005467 Bacteria 1736
40 Ga0070706_101036750 3300005467 Bacteria 756
41 Ga0070707_100001070 3300005468 Bacteria 27012
42 Ga0070707_100013002 3300005468 Bacteria 7777
43 Ga0070707_100129763 3300005468 Bacteria 2451
44 Ga0070707_100173584 3300005468 Bacteria 2101
45 Ga0070699_100019792 3300005518 Bacteria 5801
46 Ga0070679_100012703 3300005530 Bacteria 8055
47 Ga0070679_100058287 3300005530 Bacteria 3848
48 Ga0070679_100095018 3300005530 Unclassified 2968
49 Ga0070684_100946419 3300005535 Bacteria 808
50 Ga0070686_100292918 3300005544 Bacteria 1204
51 Ga0070693_100244742 3300005547 Bacteria 1186
52 Ga0070704_100110159 3300005549 Bacteria 2094
53 Ga0070704_100392664 3300005549 Unclassified 1182
54 Ga0068855_100272798 3300005563 Unclassified 1881
55 Ga0068855_101328888 3300005563 Bacteria 743
56 Ga0070664_100094981 3300005564 Bacteria 2586
57 Ga0068857_100001044 3300005577 Bacteria 21432
58 Ga0068857_100117637 3300005577 Bacteria 2392
59 Ga0068854_100263598 3300005578 Unclassified 1380
60 Ga0068856_100101866 3300005614 Bacteria 2864
61 Ga0070702_100434043 3300005615 Unclassified 949
62 Ga0068852_100543742 3300005616 Bacteria 1161
63 Ga0068864_100915994 3300005618 Bacteria 866
64 Ga0068861_100059690 3300005719 Bacteria 2921
65 Ga0068851_10093672 3300005834 Unclassified 1585
66 Ga0068863_100106636 3300005841 Bacteria 2666
67 Ga0068858_100215524 3300005842 Bacteria 1817
68 Ga0068858_101271054 3300005842 Bacteria 724
69 Ga0068862_100204515 3300005844 Unclassified 1782
70 Ga0081455_10017265 3300005937 Bacteria 6926
71 Ga0081538_10021201 3300005981 Bacteria 4754
72 Ga0081538_10021747 3300005981 Bacteria 4668
73 Ga0081538_10075099 3300005981 Bacteria 1836
74 Ga0081538_10077752 3300005981 Bacteria 1785
75 Ga0081539_10000294 3300005985 Bacteria 112974
76 Ga0081539_10002271 3300005985 Bacteria 27870
77 Ga0070717_10003334 3300006028 Bacteria 11467
78 Ga0070717_10012327 3300006028 Bacteria 6516
79 Ga0070717_10125621 3300006028 Bacteria 2202
80 Ga0070715_10003920 3300006163 Bacteria 4815
81 Ga0070716_100009390 3300006173 Bacteria 4873
82 Ga0070716_100127939 3300006173 Unclassified 1601
83 Ga0070712_100023110 3300006175 Bacteria 4103
84 Ga0097621_100541311 3300006237 Bacteria 1059
85 Ga0075428_100184313 3300006844 Bacteria 2259
86 Ga0075433_10171241 3300006852 Bacteria 1932
87 Ga0075434_100128425 3300006871 Bacteria 2552
88 Ga0075434_100235230 3300006871 Bacteria 1852
89 Ga0075436_100338267 3300006914 Bacteria 1083
90 Ga0075436_100465172 3300006914 Bacteria 922
91 Ga0105240_10036504 3300009093 Bacteria 6321
92 Ga0111539_10001342 3300009094 Bacteria 32789
93 Ga0111539_10002146 3300009094 Bacteria 26383
94 Ga0105245_10007984 3300009098 Bacteria 9255
95 Ga0105245_10103166 3300009098 Bacteria 2642
96 Ga0105245_10367316 3300009098 Bacteria 1430
97 Ga0105245_10925218 3300009098 Bacteria 914
98 Ga0114129_10105218 3300009147 Bacteria 3900
99 Ga0114129_11537946 3300009147 Unclassified 816
100 Ga0105243_10055615 3300009148 Bacteria 3144
101 Ga0105243_10172503 3300009148 Unclassified 1875
102 Ga0105242_10209114 3300009176 Bacteria 1738
103 Ga0105237_10043243 3300009545 Bacteria 4539
104 Ga0105249_10036566 3300009553 Bacteria 4455
105 Ga0105239_10211386 3300010375 Bacteria 2175
106 Ga0105246_10552994 3300011119 Bacteria 987
107 Ga0157373_10212551 3300013100 Bacteria 1364
108 Ga0157370_10485616 3300013104 Bacteria 1135
109 Ga0157369_10007584 3300013105 Bacteria 12486
110 Ga0157369_10406351 3300013105 Bacteria 1412
111 Ga0157369_10812236 3300013105 Bacteria 960
112 Ga0157374_10030966 3300013296 Bacteria 4859
113 Ga0157374_10072411 3300013296 Bacteria 3251
114 Ga0163162_10107620 3300013306 Bacteria 2884
115 Ga0163162_10411392 3300013306 Bacteria 1485
116 Ga0157372_10592192 3300013307 Bacteria 1292
117 Ga0157377_10091289 3300014745 Bacteria 1799
118 Ga0157376_10035011 3300014969 Bacteria 4059
119 Ga0206356_11017413 3300020070 Bacteria 989
120 Ga0207692_10038005 3300025898 Bacteria 2358
121 Ga0207692_10119885 3300025898 Bacteria 1472
122 Ga0207685_10005154 3300025905 Bacteria 3415
123 Ga0207699_10060111 3300025906 Bacteria 2280
124 Ga0207705_10086648 3300025909 Bacteria 2289
125 Ga0207705_10188049 3300025909 Bacteria 1560
126 Ga0207684_10347019 3300025910 Bacteria 1278
127 Ga0207707_10021737 3300025912 Bacteria 5607
128 Ga0207707_10147478 3300025912 Bacteria 2057
129 Ga0207671_10175656 3300025914 Bacteria 1665
130 Ga0207693_10000946 3300025915 Bacteria 26051
131 Ga0207693_10070489 3300025915 Bacteria 2735
132 Ga0207693_10677181 3300025915 Bacteria 800
133 Ga0207663_10010059 3300025916 Bacteria 5016
134 Ga0207657_10002448 3300025919 Bacteria 20057
135 Ga0207657_10017022 3300025919 Bacteria 6993
136 Ga0207649_10110876 3300025920 Unclassified 1833
137 Ga0207649_10254184 3300025920 Bacteria 1267
138 Ga0207652_10009676 3300025921 Bacteria 7754
139 Ga0207652_10070674 3300025921 Bacteria 3032
140 Ga0207652_10680183 3300025921 Unclassified 919
141 Ga0207646_10000129 3300025922 Bacteria 102411
142 Ga0207646_10073602 3300025922 Bacteria 3052
143 Ga0207646_10189495 3300025922 Bacteria 1857
144 Ga0207681_10280257 3300025923 Bacteria 1312
145 Ga0207687_10069343 3300025927 Bacteria 2514
146 Ga0207687_10207515 3300025927 Bacteria 1535
147 Ga0207687_10310632 3300025927 Unclassified 1273
148 Ga0207700_10104833 3300025928 Bacteria 2263
149 Ga0207700_10737388 3300025928 Bacteria 880
150 Ga0207664_10018521 3300025929 Bacteria 5128
151 Ga0207664_10024247 3300025929 Bacteria 4557
152 Ga0207664_10086585 3300025929 Bacteria 2560
153 Ga0207664_10150003 3300025929 Bacteria 1980
154 Ga0207664_10189670 3300025929 Bacteria 1769
155 Ga0207644_10479453 3300025931 Bacteria 1024
156 Ga0207706_10597053 3300025933 Unclassified 948
157 Ga0207686_10266840 3300025934 Archaea 1258
158 Ga0207686_10373795 3300025934 Bacteria 1079
159 Ga0207709_10242620 3300025935 Bacteria 1312
160 Ga0207665_10003933 3300025939 Bacteria 9948
161 Ga0207689_10041652 3300025942 Bacteria 3800
162 Ga0207661_10041852 3300025944 Bacteria 3609
163 Ga0207661_10224344 3300025944 Bacteria 1662
164 Ga0207661_10279580 3300025944 Bacteria 1491
165 Ga0207661_10371642 3300025944 Unclassified 1293
166 Ga0207661_10522328 3300025944 Bacteria 1086
167 Ga0207679_10018525 3300025945 Bacteria 4666
168 Ga0207712_10072831 3300025961 Bacteria 2475
169 Ga0207712_10421047 3300025961 Unclassified 1127
170 Ga0207668_10672070 3300025972 Bacteria 908
171 Ga0207677_10295237 3300026023 Bacteria 1337
172 Ga0207703_10346067 3300026035 Bacteria 1367
173 Ga0207639_10158294 3300026041 Bacteria 1906
174 Ga0207708_10018003 3300026075 Bacteria 5316
175 Ga0207648_10186355 3300026089 Bacteria 1838
176 Ga0207648_10436932 3300026089 Bacteria 1190
177 Ga0207676_10975160 3300026095 Unclassified 834
178 Ga0207674_10000156 3300026116 Bacteria 80650
179 Ga0207674_10114955 3300026116 Bacteria 2663
180 Ga0207674_10435377 3300026116 Bacteria 1267
181 Ga0207675_100135762 3300026118 Bacteria 2334
182 Ga0207683_10161765 3300026121 Bacteria 2024
183 Ga0207683_10444475 3300026121 Bacteria 1195
184 Ga0207428_10019209 3300027907 Bacteria 5827
185 Ga0265318_10000982 3300028577 Bacteria 18274
186 Ga0265322_10012086 3300028654 Bacteria 2498
187 Ga0265338_10012799 3300028800 Bacteria 9538
188 Ga0265338_10015934 3300028800 Bacteria 8221
189 Ga0265338_10030965 3300028800 Bacteria 5255
190 Ga0265320_10025002 3300031240 Bacteria 3146
191 Ga0265325_10058032 3300031241 Bacteria 1973
192 Ga0265325_10089825 3300031241 Bacteria 1516
193 Ga0265325_10183803 3300031241 Bacteria 972
194 Ga0265340_10095990 3300031247 Bacteria 1381
195 Ga0265331_10093158 3300031250 Bacteria 1391
196 Ga0265327_10066981 3300031251 Bacteria 1810
197 Ga0265316_10155126 3300031344 Bacteria 1713
198 Ga0265316_10401872 3300031344 Bacteria 986
199 Ga0265313_10014451 3300031595 Bacteria 4663
200 Ga0265313_10090631 3300031595 Bacteria 1373
201 Ga0265314_10037107 3300031711 Bacteria 3534
202 Ga0265342_10026467 3300031712 Bacteria 3634
203 Ga0307405_10026687 3300031731 Bacteria 3336
204 Ga0307413_10033957 3300031824 Bacteria 2910
205 Ga0307410_10008058 3300031852 Bacteria 5817
206 Ga0307406_10006759 3300031901 Bacteria 6343
207 Ga0307409_100674707 3300031995 Bacteria 1030
208 Ga0307416_100203428 3300032002 Bacteria 1881
209 Ga0307415_100002785 3300032126 Bacteria 8755
210 Ga0373928_0047560 3300035084 Bacteria 1004
211 Ga0373945_0050902 3300035116 Bacteria 1523
212 Ga0373924_0184496 3300035410 Bacteria 918
213 Ga0373931_0378656 3300035691 Bacteria 892
214 Ga0373947_0002689 3300035725 Bacteria 10678
215 Ga0373937_0007821 3300036401 Bacteria 9266
216 Ga0373937_0365153 3300036401 Bacteria 1368
217 Ga0373925_0012171 3300037068 Bacteria 6228
218 Ga0373925_0873765 3300037068 Bacteria 741
219 Ga0395899_0012204 3300037312 Bacteria 6579
220 Ga0395899_0023301 3300037312 Bacteria 4692
221 Ga0395899_0044589 3300037312 Bacteria 3304
222 Ga0395899_0084829 3300037312 Unclassified 2302
223 Ga0395900_0026329 3300037418 Bacteria 5956
224 Ga0395900_0072573 3300037418 Bacteria 3538
225 Ga0395900_0187758 3300037418 Bacteria 2097
226 Ga0395900_0189274 3300037418 Bacteria 2088
227 Ga0395898_0002944 3300037466 Bacteria 19369
228 Ga0395898_0032552 3300037466 Bacteria 5205
229 Ga0395898_0071449 3300037466 Bacteria 3353
230 Ga0395898_0650039 3300037466 Bacteria 997
231 Ga0395905_0014115 3300037471 Bacteria 7636
232 Ga0395905_0064087 3300037471 Bacteria 3438
233 Ga0395905_0095978 3300037471 Bacteria 2783
234 Ga0395905_0190233 3300037471 Unclassified 1925
235 Ga0395901_0013902 3300038443 Bacteria 8190
236 Ga0395901_0236061 3300038443 Bacteria 1908
237 Ga0395901_0600757 3300038443 Bacteria 1109
238 Ga0395901_0641185 3300038443 Bacteria 1067
239 Ga0395901_1110998 3300038443 Bacteria 760
240 Ga0436360_0559017 3300039438 Bacteria 3798
241 Ga0439466_0047022 3300041411 Bacteria 1423
242 Ga0439445_0030429 3300042004 Unclassified 1399
243 Ga0450923_048752 3300042125 Bacteria 905
244 Ga0466961_0051231 3300044693 Bacteria 2637
245 Ga0466961_0084314 3300044693 Unclassified 2010
246 Ga0466963_0003110 3300044694 Bacteria 9411
247 Ga0466963_0052891 3300044694 Bacteria 2695
248 Ga0466963_0069221 3300044694 Bacteria 2371
249 Ga0466963_0343787 3300044694 Bacteria 1050
250 Ga0466963_0434175 3300044694 Bacteria 926
251 Ga0466963_0455159 3300044694 Bacteria 903
252 Ga0466964_0009743 3300044706 Bacteria 3619
253 Ga0466964_0043419 3300044706 Bacteria 1823
254 Ga0466964_0313085 3300044706 Bacteria 795
255 Ga0466971_0001860 3300044719 Bacteria 8982
256 Ga0466971_0016190 3300044719 Bacteria 3285
257 Ga0466968_0015906 3300044735 Bacteria 2988
258 Ga0466968_0022537 3300044735 Bacteria 2560
259 Ga0466957_0007796 3300044842 Bacteria 6063
260 Ga0466957_0025490 3300044842 Bacteria 3505
261 Ga0466957_0052632 3300044842 Bacteria 2479
262 Ga0466957_0061608 3300044842 Bacteria 2303
263 Ga0466957_0148682 3300044842 Bacteria 1513
264 Ga0466957_0247574 3300044842 Bacteria 1184
265 Ga0466960_0026572 3300044901 Bacteria 2631
266 Ga0466959_0000274 3300045049 Bacteria 31486
267 Ga0466959_0119494 3300045049 Bacteria 1875
268 Ga0466959_0220859 3300045049 Bacteria 1314
269 Ga0451576_0092640 3300045051 Bacteria 3143
270 Ga0466958_0002650 3300045836 Bacteria 9045
271 Ga0466958_0006089 3300045836 Bacteria 6541
272 Ga0466958_0011853 3300045836 Bacteria 4922
273 Ga0466958_0171047 3300045836 Bacteria 1376
274 Ga0466958_0367468 3300045836 Bacteria 927
275 Ga0466967_0016540 3300045976 Bacteria 5821
276 Ga0466967_0118514 3300045976 Bacteria 2442
277 Ga0466967_0132688 3300045976 Bacteria 2313
278 Ga0466967_0222321 3300045976 Bacteria 1795
279 Ga0466967_0240889 3300045976 Bacteria 1725
280 Ga0466967_0309268 3300045976 Bacteria 1522
281 Ga0466967_0338318 3300045976 Bacteria 1455
282 Ga0466967_0368291 3300045976 Bacteria 1393
283 Ga0495592_0171502 3300046454 Bacteria 1485
284 Ga0495592_0210257 3300046454 Bacteria 1307
285 Ga0495592_0264661 3300046454 Unclassified 1131
286 Ga0495591_047220 3300046458 Unclassified 1193
287 Ga0495629_0047782 3300046459 Bacteria 3001
288 Ga0495629_0083355 3300046459 Bacteria 2231
289 Ga0495641_0014909 3300046461 Bacteria 4185
290 Ga0495641_0050662 3300046461 Bacteria 1897
291 Ga0495641_0099968 3300046461 Bacteria 1294
292 Ga0495651_0011238 3300046462 Bacteria 6880
293 Ga0495651_0270563 3300046462 Unclassified 1152
294 Ga0495653_0063961 3300046463 Bacteria 2773
295 Ga0495653_0103146 3300046463 Bacteria 2063
296 Ga0495653_0118924 3300046463 Bacteria 1886
297 Ga0495653_0123186 3300046463 Bacteria 1844
298 Ga0495582_0041585 3300046473 Bacteria 2532
299 Ga0495582_0052151 3300046473 Bacteria 2256
300 Ga0495582_0185533 3300046473 Bacteria 1186
301 Ga0495639_0010239 3300046475 Bacteria 4034
302 Ga0495664_0008329 3300046477 Bacteria 5781
303 Ga0495664_0226211 3300046477 Unclassified 1132
304 Ga0495664_0441603 3300046477 Unclassified 779
305 Ga0495584_0003575 3300046491 Bacteria 8487
306 Ga0495596_0053840 3300046500 Bacteria 1574
307 Ga0495607_0017883 3300046501 Bacteria 4536
308 Ga0495608_0016627 3300046511 Bacteria 5091
309 Ga0495608_0017693 3300046511 Bacteria 4928
310 Ga0495608_0220780 3300046511 Bacteria 1189
311 Ga0495608_0334793 3300046511 Bacteria 933
312 Ga0495618_0008408 3300046514 Bacteria 6246
313 Ga0495618_0115489 3300046514 Bacteria 1719
314 Ga0495618_0306445 3300046514 Unclassified 986
315 Ga0495628_0172831 3300046516 Bacteria 1638
316 Ga0495628_0278861 3300046516 Unclassified 1242
317 Ga0495630_0020194 3300046517 Bacteria 4909
318 Ga0495630_0128929 3300046517 Bacteria 1920
319 Ga0495630_0239621 3300046517 Bacteria 1386
320 Ga0495644_0002677 3300046523 Bacteria 7086
321 Ga0495652_0089724 3300046529 Bacteria 2516
322 Ga0495665_0004800 3300046531 Bacteria 7298
323 Ga0495640_0080164 3300046533 Bacteria 2172
324 Ga0495640_0115024 3300046533 Bacteria 1753
325 Ga0495586_0032293 3300046535 Bacteria 2806
326 Ga0495587_0024004 3300046536 Bacteria 3742
327 Ga0495598_0011631 3300046537 Bacteria 2140
328 Ga0495609_0041822 3300046538 Unclassified 2059
329 Ga0495597_0082991 3300046542 Unclassified 1369
330 Ga0495645_0199976 3300046543 Bacteria 1356
331 Ga0495667_0011859 3300046559 Bacteria 5905
332 Ga0495634_0071024 3300046642 Bacteria 2293
333 Ga0495634_0190699 3300046642 Bacteria 1279
334 Ga0495611_0035465 3300046648 Bacteria 2210
335 Ga0495635_0124446 3300046663 Bacteria 1758
336 Ga0495635_0156157 3300046663 Bacteria 1553
337 Ga0495659_0021613 3300046664 Bacteria 2170
338 Ga0495661_0028047 3300046665 Bacteria 3610
339 Ga0495657_0206731 3300046675 Bacteria 1194
340 Ga0495657_0471708 3300046675 Bacteria 733
341 Ga0495599_0106213 3300046678 Bacteria 1750
342 Ga0495623_0025993 3300046679 Bacteria 3770
343 Ga0495646_0039389 3300046680 Bacteria 2914
344 Ga0495646_0184219 3300046680 Unclassified 1144
345 Ga0495647_0000641 3300046681 Bacteria 10349
346 Ga0495658_0002001 3300046683 Bacteria 10383
347 Ga0495658_0088559 3300046683 Unclassified 1830
348 Ga0495613_0014326 3300046689 Bacteria 5884
349 Ga0495624_0007539 3300046690 Bacteria 7633
350 Ga0495624_0049977 3300046690 Bacteria 2650
351 Ga0495624_0134576 3300046690 Unclassified 1515
352 Ga0495670_0110959 3300046691 Bacteria 1419
353 Ga0495600_0065095 3300046809 Bacteria 2383
354 Ga0495600_0086069 3300046809 Bacteria 2051
355 Ga0495604_0002667 3300047317 Bacteria 14322
356 Ga0495604_0556655 3300047317 Unclassified 739
357 Ga0495636_0094489 3300047318 Bacteria 1301
358 Ga0495674_0049646 3300047319 Bacteria 3706
359 Ga0495674_0123354 3300047319 Bacteria 2187
360 Ga0495674_0295596 3300047319 Bacteria 1323
361 Ga0495674_0373432 3300047319 Bacteria 1155
362 Ga0495676_0040997 3300047321 Bacteria 3815
363 Ga0495676_0053261 3300047321 Bacteria 3226
364 Ga0495680_0015616 3300047322 Bacteria 6547
365 Ga0495680_0016089 3300047322 Bacteria 6431
366 Ga0495680_0016396 3300047322 Bacteria 6367
367 Ga0495680_0194094 3300047322 Bacteria 1460
368 Ga0495683_0147143 3300047323 Bacteria 1100
369 Ga0495675_0080133 3300047444 Bacteria 2056
370 Ga0495684_0003191 3300047471 Bacteria 12859
371 Ga0495684_0018293 3300047471 Bacteria 5400
372 Ga0495684_0023874 3300047471 Bacteria 4702
373 Ga0495684_0070531 3300047471 Bacteria 2657
374 Ga0495684_0395677 3300047471 Bacteria 971
375 Ga0495684_0422529 3300047471 Bacteria 931
376 Ga0495593_0002352 3300047673 Bacteria 11355
377 Ga0495593_0126287 3300047673 Bacteria 1300
378 Ga0495602_0115363 3300048088 Bacteria 2173
379 Ga0495602_0310945 3300048088 Bacteria 1150
380 Ga0495602_0393450 3300048088 Bacteria 990
381 Ga0495614_0023076 3300048089 Bacteria 2683
382 Ga0496100_0021732 3300048903 Bacteria 3870
383 Ga0496101_0012833 3300048904 Bacteria 5602
384 Ga0496101_0178693 3300048904 Bacteria 1634
385 Ga0496102_0013576 3300048905 Bacteria 7059
386 Ga0496102_0041363 3300048905 Bacteria 4172
387 Ga0496102_0210051 3300048905 Unclassified 1835
388 Ga0496102_0356403 3300048905 Bacteria 1377
389 Ga0496104_0007404 3300048907 Bacteria 9697
390 Ga0496104_0041715 3300048907 Bacteria 4304
391 Ga0496105_0034477 3300048908 Unclassified 4163
392 Ga0496105_0069486 3300048908 Bacteria 2910
393 Ga0496105_0124110 3300048908 Bacteria 2128
394 Ga0496105_0607841 3300048908 Bacteria 848
395 Ga0496106_0011148 3300048909 Bacteria 6650
396 Ga0496106_0019007 3300048909 Bacteria 5092
397 Ga0496107_0008507 3300048910 Bacteria 7103
398 Ga0496107_0018508 3300048910 Bacteria 4905
399 Ga0496108_0002372 3300048911 Bacteria 15085
400 Ga0496108_0003783 3300048911 Bacteria 12111
401 Ga0496108_0081635 3300048911 Bacteria 2740
402 Ga0496109_0001585 3300048912 Bacteria 18980
403 Ga0496109_0005647 3300048912 Bacteria 10464
404 Ga0496109_0007413 3300048912 Bacteria 9284
405 Ga0496109_0311691 3300048912 Bacteria 1485
406 Ga0496109_0355679 3300048912 Bacteria 1383
407 Ga0496110_0000112 3300048913 Bacteria 44496
408 Ga0496110_0037101 3300048913 Bacteria 4235
409 Ga0496111_0000091 3300048914 Bacteria 38326
410 Ga0496111_0013160 3300048914 Bacteria 5623
411 Ga0496111_0129001 3300048914 Bacteria 1870
412 Ga0496112_0029106 3300048915 Bacteria 5339
413 Ga0496112_0328109 3300048915 Bacteria 1474
414 Ga0496113_0048163 3300048916 Bacteria 3171
415 Ga0496113_0146515 3300048916 Bacteria 1860
416 Ga0496113_0213803 3300048916 Bacteria 1535
417 Ga0496114_0004118 3300048917 Bacteria 11248
418 Ga0496114_0033657 3300048917 Bacteria 4224
419 Ga0496114_0343828 3300048917 Bacteria 1319
420 Ga0496115_0045528 3300048918 Bacteria 3503
421 Ga0496115_0060598 3300048918 Bacteria 3049
422 Ga0496115_0112864 3300048918 Bacteria 2233
423 Ga0496115_0116178 3300048918 Bacteria 2200
424 Ga0496115_0563897 3300048918 Bacteria 909
425 Ga0501031_0083035 3300049568 Bacteria 2088
426 Ga0501036_0075121 3300049572 Bacteria 2858
427 Ga0501038_0241627 3300049574 Bacteria 1433
428 Ga0501039_0114120 3300049575 Bacteria 2113
429 Ga0501041_0075370 3300049577 Bacteria 2074
430 Ga0501042_0066718 3300049578 Bacteria 2572
431 Ga0501046_0108910 3300049580 Bacteria 2118
432 Ga0501048_0064595 3300049582 Bacteria 2588
433 Ga0501067_0006085 3300049583 Bacteria 6691
434 Ga0501067_0034697 3300049583 Bacteria 2800
435 Ga0501068_0039680 3300049584 Bacteria 2824
436 Ga0501069_0023630 3300049585 Bacteria 3352
437 Ga0501070_0063073 3300049586 Bacteria 3070
438 Ga0501070_0158887 3300049586 Bacteria 1864
439 Ga0501071_0047120 3300049587 Bacteria 3097
440 Ga0501071_0811350 3300049587 Bacteria 721
441 Ga0501072_0052231 3300049588 Bacteria 3218
442 Ga0501072_0196706 3300049588 Bacteria 1608
443 Ga0501074_0100231 3300049590 Bacteria 2073
444 Ga0501074_0332350 3300049590 Unclassified 1079
445 Ga0501075_0006106 3300049591 Bacteria 8273
446 Ga0501076_0028218 3300049592 Bacteria 4356
447 Ga0501077_0108085 3300049593 Bacteria 1762
448 Ga0501079_0040503 3300049741 Bacteria 3593
449 Ga0501080_0181994 3300049742 Bacteria 1933
450 Ga0501081_0014199 3300049743 Bacteria 5251
451 Ga0501083_0060926 3300049744 Bacteria 2521
452 Ga0501045_0021130 3300049824 Bacteria 4654
453 nmdc:mga05p37_260743_c1 3300050507 Bacteria 2074
454 nmdc:mga08y16_49133_c1 3300050511 Bacteria 4415
455 nmdc:mga0n895_288414_c1 3300050512 Bacteria 1664
456 nmdc:mga0n895_45838_c1 3300050512 Bacteria 4269
457 nmdc:mga0a205_221493_c1 3300050515 Bacteria 1777
458 Ga0495612_0013011 3300053078 Bacteria 3352
459 Ga0495612_0043272 3300053078 Bacteria 1840
460 Ga0495595_0019696 3300053084 Bacteria 2931
461 Ga0495595_0025368 3300053084 Bacteria 2627
462 Ga0495595_0067393 3300053084 Bacteria 1687
463 Ga0495595_0082937 3300053084 Unclassified 1529
464 Ga0495619_0007846 3300053085 Bacteria 6753
465 Ga0495619_0184274 3300053085 Bacteria 1444
466 Ga0495619_0253171 3300053085 Bacteria 1220
467 Ga0495619_0291035 3300053085 Bacteria 1131
468 Ga0501084_0156540 3300054114 Bacteria 1921
469 Ga0501082_0379430 3300060353 Bacteria 1233
470 Ga0466962_0037326 3300061719 Bacteria 2326
471 Ga0466962_0069136 3300061719 Bacteria 1687
472 Ga0466962_0138589 3300061719 Bacteria 1178
473 Ga0495680_0304399
474 rootL2_10290870
475 Ga0070658_10536607
476 Ga0070683_100071298
477 Ga0070683_100177538
478 Ga0070680_100011877
479 Ga0070682_100007130
480 Ga0070682_100104712
481 Ga0070682_100164106
482 Ga0070660_100005959
483 Ga0070660_100012405
484 Ga0070660_100442074
485 Ga0070661_100102950
486 Ga0070669_100337624
487 Ga0070671_100476496
488 Ga0070674_100100285
489 Ga0070709_10014042
490 Ga0070709_10127849
491 Ga0070714_100059342
492 Ga0070714_100100247
493 Ga0070714_100160715
494 Ga0070714_100226675
495 Ga0070714_100403400
496 Ga0070714_100495730
497 Ga0070713_100042317
498 Ga0070713_100065601
499 Ga0070713_100207010
500 Ga0070713_100465041
501 Ga0070710_10030364
502 Ga0070711_100049491
503 Ga0070711_100337651
504 Ga0070708_100634634
505 Ga0070678_100218487
506 Ga0070681_10020985
507 Ga0070681_10067218
508 Ga0070681_10142456
509 Ga0070681_10209821
510 Ga0068867_100162948
511 Ga0070706_100228857
512 Ga0070706_101036750
513 Ga0070707_100001070
514 Ga0070707_100013002
515 Ga0070707_100129763
516 Ga0070707_100173584
517 Ga0070699_100019792
518 Ga0070679_100012703
519 Ga0070679_100058287
520 Ga0070679_100095018
521 Ga0070684_100946419
522 Ga0070686_100292918
523 Ga0070693_100244742
524 Ga0070704_100110159
525 Ga0070704_100392664
526 Ga0068855_100272798
527 Ga0068855_101328888
528 Ga0070664_100094981
529 Ga0068857_100001044
530 Ga0068857_100117637
531 Ga0068854_100263598
532 Ga0068856_100101866
533 Ga0070702_100434043
534 Ga0068852_100543742
535 Ga0068864_100915994
536 Ga0068861_100059690
537 Ga0068851_10093672
538 Ga0068863_100106636
539 Ga0068858_100215524
540 Ga0068858_101271054
541 Ga0068862_100204515
542 Ga0081455_10017265
543 Ga0081538_10021201
544 Ga0081538_10021747
545 Ga0081538_10075099
546 Ga0081538_10077752
547 Ga0081539_10000294
548 Ga0081539_10002271
549 Ga0070717_10003334
550 Ga0070717_10012327
551 Ga0070717_10125621
552 Ga0070715_10003920
553 Ga0070716_100009390
554 Ga0070716_100127939
555 Ga0070712_100023110
556 Ga0097621_100541311
557 Ga0075428_100184313
558 Ga0075433_10171241
559 Ga0075434_100128425
560 Ga0075434_100235230
561 Ga0075436_100338267
562 Ga0075436_100465172
563 Ga0105240_10036504
564 Ga0111539_10001342
565 Ga0111539_10002146
566 Ga0105245_10007984
567 Ga0105245_10103166
568 Ga0105245_10367316
569 Ga0105245_10925218
570 Ga0114129_10105218
571 Ga0114129_11537946
572 Ga0105243_10055615
573 Ga0105243_10172503
574 Ga0105242_10209114
575 Ga0105237_10043243
576 Ga0105249_10036566
577 Ga0105239_10211386
578 Ga0105246_10552994
579 Ga0157373_10212551
580 Ga0157370_10485616
581 Ga0157369_10007584
582 Ga0157369_10406351
583 Ga0157369_10812236
584 Ga0157374_10030966
585 Ga0157374_10072411
586 Ga0163162_10107620
587 Ga0163162_10411392
588 Ga0157372_10592192
589 Ga0157377_10091289
590 Ga0157376_10035011
591 Ga0206356_11017413
592 Ga0207692_10038005
593 Ga0207692_10119885
594 Ga0207685_10005154
595 Ga0207699_10060111
596 Ga0207705_10086648
597 Ga0207705_10188049
598 Ga0207684_10347019
599 Ga0207707_10021737
600 Ga0207707_10147478
601 Ga0207671_10175656
602 Ga0207693_10000946
603 Ga0207693_10070489
604 Ga0207693_10677181
605 Ga0207663_10010059
606 Ga0207657_10002448
607 Ga0207657_10017022
608 Ga0207649_10110876
609 Ga0207649_10254184
610 Ga0207652_10009676
611 Ga0207652_10070674
612 Ga0207652_10680183
613 Ga0207646_10000129
614 Ga0207646_10073602
615 Ga0207646_10189495
616 Ga0207681_10280257
617 Ga0207687_10069343
618 Ga0207687_10207515
619 Ga0207687_10310632
620 Ga0207700_10104833
621 Ga0207700_10737388
622 Ga0207664_10018521
623 Ga0207664_10024247
624 Ga0207664_10086585
625 Ga0207664_10150003
626 Ga0207664_10189670
627 Ga0207644_10479453
628 Ga0207706_10597053
629 Ga0207686_10266840
630 Ga0207686_10373795
631 Ga0207709_10242620
632 Ga0207665_10003933
633 Ga0207689_10041652
634 Ga0207661_10041852
635 Ga0207661_10224344
636 Ga0207661_10279580
637 Ga0207661_10371642
638 Ga0207661_10522328
639 Ga0207679_10018525
640 Ga0207712_10072831
641 Ga0207712_10421047
642 Ga0207668_10672070
643 Ga0207677_10295237
644 Ga0207703_10346067
645 Ga0207639_10158294
646 Ga0207708_10018003
647 Ga0207648_10186355
648 Ga0207648_10436932
649 Ga0207676_10975160
650 Ga0207674_10000156
651 Ga0207674_10114955
652 Ga0207674_10435377
653 Ga0207675_100135762
654 Ga0207683_10161765
655 Ga0207683_10444475
656 Ga0207428_10019209
657 Ga0265318_10000982
658 Ga0265322_10012086
659 Ga0265338_10012799
660 Ga0265338_10015934
661 Ga0265338_10030965
662 Ga0265320_10025002
663 Ga0265325_10058032
664 Ga0265325_10089825
665 Ga0265325_10183803
666 Ga0265340_10095990
667 Ga0265331_10093158
668 Ga0265327_10066981
669 Ga0265316_10155126
670 Ga0265316_10401872
671 Ga0265313_10014451
672 Ga0265313_10090631
673 Ga0265314_10037107
674 Ga0265342_10026467
675 Ga0307405_10026687
676 Ga0307413_10033957
677 Ga0307410_10008058
678 Ga0307406_10006759
679 Ga0307409_100674707
680 Ga0307416_100203428
681 Ga0307415_100002785
682 Ga0373928_0047560
683 Ga0373945_0050902
684 Ga0373924_0184496
685 Ga0373931_0378656
686 Ga0373947_0002689
687 Ga0373937_0007821
688 Ga0373937_0365153
689 Ga0373925_0012171
690 Ga0373925_0873765
691 Ga0395899_0012204
692 Ga0395899_0023301
693 Ga0395899_0044589
694 Ga0395899_0084829
695 Ga0395900_0026329
696 Ga0395900_0072573
697 Ga0395900_0187758
698 Ga0395900_0189274
699 Ga0395898_0002944
700 Ga0395898_0032552
701 Ga0395898_0071449
702 Ga0395898_0650039
703 Ga0395905_0014115
704 Ga0395905_0064087
705 Ga0395905_0095978
706 Ga0395905_0190233
707 Ga0395901_0013902
708 Ga0395901_0236061
709 Ga0395901_0600757
710 Ga0395901_0641185
711 Ga0395901_1110998
712 Ga0436360_0559017
713 Ga0439466_0047022
714 Ga0439445_0030429
715 Ga0450923_048752
716 Ga0466961_0051231
717 Ga0466961_0084314
718 Ga0466963_0003110
719 Ga0466963_0052891
720 Ga0466963_0069221
721 Ga0466963_0343787
722 Ga0466963_0434175
723 Ga0466963_0455159
724 Ga0466964_0009743
725 Ga0466964_0043419
726 Ga0466964_0313085
727 Ga0466971_0001860
728 Ga0466971_0016190
729 Ga0466968_0015906
730 Ga0466968_0022537
731 Ga0466957_0007796
732 Ga0466957_0025490
733 Ga0466957_0052632
734 Ga0466957_0061608
735 Ga0466957_0148682
736 Ga0466957_0247574
737 Ga0466960_0026572
738 Ga0466959_0000274
739 Ga0466959_0119494
740 Ga0466959_0220859
741 Ga0451576_0092640
742 Ga0466958_0002650
743 Ga0466958_0006089
744 Ga0466958_0011853
745 Ga0466958_0171047
746 Ga0466958_0367468
747 Ga0466967_0016540
748 Ga0466967_0118514
749 Ga0466967_0132688
750 Ga0466967_0222321
751 Ga0466967_0240889
752 Ga0466967_0309268
753 Ga0466967_0338318
754 Ga0466967_0368291
755 Ga0495592_0171502
756 Ga0495592_0210257
757 Ga0495592_0264661
758 Ga0495591_047220
759 Ga0495629_0047782
760 Ga0495629_0083355
761 Ga0495641_0014909
762 Ga0495641_0050662
763 Ga0495641_0099968
764 Ga0495651_0011238
765 Ga0495651_0270563
766 Ga0495653_0063961
767 Ga0495653_0103146
768 Ga0495653_0118924
769 Ga0495653_0123186
770 Ga0495582_0041585
771 Ga0495582_0052151
772 Ga0495582_0185533
773 Ga0495639_0010239
774 Ga0495664_0008329
775 Ga0495664_0226211
776 Ga0495664_0441603
777 Ga0495584_0003575
778 Ga0495596_0053840
779 Ga0495607_0017883
780 Ga0495608_0016627
781 Ga0495608_0017693
782 Ga0495608_0220780
783 Ga0495608_0334793
784 Ga0495618_0008408
785 Ga0495618_0115489
786 Ga0495618_0306445
787 Ga0495628_0172831
788 Ga0495628_0278861
789 Ga0495630_0020194
790 Ga0495630_0128929
791 Ga0495630_0239621
792 Ga0495644_0002677
793 Ga0495652_0089724
794 Ga0495665_0004800
795 Ga0495640_0080164
796 Ga0495640_0115024
797 Ga0495586_0032293
798 Ga0495587_0024004
799 Ga0495598_0011631
800 Ga0495609_0041822
801 Ga0495597_0082991
802 Ga0495645_0199976
803 Ga0495667_0011859
804 Ga0495634_0071024
805 Ga0495634_0190699
806 Ga0495611_0035465
807 Ga0495635_0124446
808 Ga0495635_0156157
809 Ga0495659_0021613
810 Ga0495661_0028047
811 Ga0495657_0206731
812 Ga0495657_0471708
813 Ga0495599_0106213
814 Ga0495623_0025993
815 Ga0495646_0039389
816 Ga0495646_0184219
817 Ga0495647_0000641
818 Ga0495658_0002001
819 Ga0495658_0088559
820 Ga0495613_0014326
821 Ga0495624_0007539
822 Ga0495624_0049977
823 Ga0495624_0134576
824 Ga0495670_0110959
825 Ga0495600_0065095
826 Ga0495600_0086069
827 Ga0495604_0002667
828 Ga0495604_0556655
829 Ga0495636_0094489
830 Ga0495674_0049646
831 Ga0495674_0123354
832 Ga0495674_0295596
833 Ga0495674_0373432
834 Ga0495676_0040997
835 Ga0495676_0053261
836 Ga0495680_0015616
837 Ga0495680_0016089
838 Ga0495680_0016396
839 Ga0495680_0194094
840 Ga0495683_0147143
841 Ga0495675_0080133
842 Ga0495684_0003191
843 Ga0495684_0018293
844 Ga0495684_0023874
845 Ga0495684_0070531
846 Ga0495684_0395677
847 Ga0495684_0422529
848 Ga0495593_0002352
849 Ga0495593_0126287
850 Ga0495602_0115363
851 Ga0495602_0310945
852 Ga0495602_0393450
853 Ga0495614_0023076
854 Ga0496100_0021732
855 Ga0496101_0012833
856 Ga0496101_0178693
857 Ga0496102_0013576
858 Ga0496102_0041363
859 Ga0496102_0210051
860 Ga0496102_0356403
861 Ga0496104_0007404
862 Ga0496104_0041715
863 Ga0496105_0034477
864 Ga0496105_0069486
865 Ga0496105_0124110
866 Ga0496105_0607841
867 Ga0496106_0011148
868 Ga0496106_0019007
869 Ga0496107_0008507
870 Ga0496107_0018508
871 Ga0496108_0002372
872 Ga0496108_0003783
873 Ga0496108_0081635
874 Ga0496109_0001585
875 Ga0496109_0005647
876 Ga0496109_0007413
877 Ga0496109_0311691
878 Ga0496109_0355679
879 Ga0496110_0000112
880 Ga0496110_0037101
881 Ga0496111_0000091
882 Ga0496111_0013160
883 Ga0496111_0129001
884 Ga0496112_0029106
885 Ga0496112_0328109
886 Ga0496113_0048163
887 Ga0496113_0146515
888 Ga0496113_0213803
889 Ga0496114_0004118
890 Ga0496114_0033657
891 Ga0496114_0343828
892 Ga0496115_0045528
893 Ga0496115_0060598
894 Ga0496115_0112864
895 Ga0496115_0116178
896 Ga0496115_0563897
897 Ga0501031_0083035
898 Ga0501036_0075121
899 Ga0501038_0241627
900 Ga0501039_0114120
901 Ga0501041_0075370
902 Ga0501042_0066718
903 Ga0501046_0108910
904 Ga0501048_0064595
905 Ga0501067_0006085
906 Ga0501067_0034697
907 Ga0501068_0039680
908 Ga0501069_0023630
909 Ga0501070_0063073
910 Ga0501070_0158887
911 Ga0501071_0047120
912 Ga0501071_0811350
913 Ga0501072_0052231
914 Ga0501072_0196706
915 Ga0501074_0100231
916 Ga0501074_0332350
917 Ga0501075_0006106
918 Ga0501076_0028218
919 Ga0501077_0108085
920 Ga0501079_0040503
921 Ga0501080_0181994
922 Ga0501081_0014199
923 Ga0501083_0060926
924 Ga0501045_0021130
925 nmdc:mga05p37_260743_c1
926 nmdc:mga08y16_49133_c1
927 nmdc:mga0n895_288414_c1
928 nmdc:mga0n895_45838_c1
929 nmdc:mga0a205_221493_c1
930 Ga0495612_0013011
931 Ga0495612_0043272
932 Ga0495595_0019696
933 Ga0495595_0025368
934 Ga0495595_0067393
935 Ga0495595_0082937
936 Ga0495619_0007846
937 Ga0495619_0184274
938 Ga0495619_0253171
939 Ga0495619_0291035
940 Ga0501084_0156540
941 Ga0501082_0379430
942 Ga0466962_0037326
943 Ga0466962_0069136
944 Ga0466962_0138589

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

35

212

0.95

PF13242

Hydrolase_like

HAD-hyrolase-like

166

238

0.9

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

32

206

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ex7-assembly1.cif.gz_A crystal structure of the alnumycin p phosphatase in complex with free phosphate 0.8712 5 217
2hdo-assembly1.cif.gz_A crystal structure of putative phosphoglycolate phosphatase (np_784602.1) from lactobacillus plantarum at 1.50 a resolution 0.8547 2 214
2hdo-assembly1.cif.gz_A crystal structure of putative phosphoglycolate phosphatase (np_784602.1) from lactobacillus plantarum at 1.50 a resolution 0.851 2 214
4uas-assembly2.cif.gz_B crystal structure of cbby from rhodobacter sphaeroides in complex with phosphate 0.839 4 205
2hsz-assembly2.cif.gz_B crystal structure of a predicted phosphoglycolate phosphatase (hs_0176) from haemophilus somnus 129pt at 1.90 a resolution 0.8313 1 211
ID Description Score Start End Superfamily
af_Q652P6_229_339_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9346 98 205 3.40.50.1000
af_D7SFJ0_151_278_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9041 88 205 3.40.50.1000
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8938 88 183 3.40.50.1000
af_Q652P6_229_339_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8867 98 205 3.40.50.1000
1z4nB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8818 104 209 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A537WD44-F1-model_v4 HAD family phosphatase 0.9698 2 214 GO:0003824
AF-A0A538JIZ3-F1-model_v4 HAD family phosphatase 0.9696 2 214 GO:0003824
AF-A0A537WD44-F1-model_v4 HAD family phosphatase 0.948 2 214 GO:0003824
AF-A0A538JIZ3-F1-model_v4 HAD family phosphatase 0.9478 2 214 GO:0003824
AF-A0A538JE58-F1-model_v4 HAD family phosphatase 0.9399 5 159 GO:0003824

Map