F450869

General Info

Members Datasets Scaffolds Average Seq Length
472 223 944 306

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0009633|Ga0495603_0009633_3987_5006
Length 339
Sequence MVAEATSGVAQQCPAGDAQYDARVRFAISIPQFYADGEFDPAAFRAYLTRVEQLGFDSAWTQEQTLGSKPQLGPIETMTYAAACTERLRLGCVVFVSTLHSPVHLAKSISSLDQISRGRIEVGFGTGGKQRPFAAFGIGPERYVARFYEGIEVMTRLWRDSRVGYSGEFWQLTDAAMEPKPFQKPNPPLWFGGSGRTALRRAVMSPGLFSGFFGAGQVPTASFAEQVRTVRQALAESGRPTNDFTIAKRVYIAVDGDAQRARDRINAELAALYTKRSPEIEAAAIAGTPMDCVRALREGVAAGAELILFTPLFEPAEHAERLASQVMPELEVGLGKDRP

Samples

Sample ID Description Type Environment
1 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
111 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
112 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
113 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
114 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
115 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
116 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
117 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
122 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
123 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
127 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
132 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
144 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
219 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
222 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
223 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 0.42
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 4.24
Rhizosphere 90.04
Stem 0
Stem Tuber 0
Unclassified 2.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495603_0009633 3300046455 Bacteria 5839
2 Ga0070658_10120094 3300005327 Bacteria 2184
3 Ga0070683_100063457 3300005329 Bacteria 3436
4 Ga0070666_10167001 3300005335 Bacteria 1540
5 Ga0070680_100017071 3300005336 Bacteria 5717
6 Ga0070660_100012434 3300005339 Bacteria 6077
7 Ga0070689_100445028 3300005340 Bacteria 1101
8 Ga0070675_100044219 3300005354 Bacteria 3642
9 Ga0070671_100244845 3300005355 Bacteria 1522
10 Ga0070674_100397818 3300005356 Bacteria 1125
11 Ga0070709_10000308 3300005434 Bacteria 30984
12 Ga0070709_10369105 3300005434 Bacteria 1064
13 Ga0070714_100179568 3300005435 Bacteria 1925
14 Ga0070713_100203021 3300005436 Bacteria 1791
15 Ga0070710_10095958 3300005437 Bacteria 1757
16 Ga0070701_10038607 3300005438 Bacteria 2417
17 Ga0070711_100109795 3300005439 Bacteria 2023
18 Ga0070711_100407043 3300005439 Bacteria 1105
19 Ga0070705_100052499 3300005440 Bacteria 2382
20 Ga0070681_10202597 3300005458 Bacteria 1902
21 Ga0070685_10129801 3300005466 Bacteria 1575
22 Ga0070706_100007725 3300005467 Bacteria 10059
23 Ga0070707_100000746 3300005468 Bacteria 32258
24 Ga0070707_100002252 3300005468 Bacteria 18404
25 Ga0070707_100038967 3300005468 Bacteria 4541
26 Ga0070707_100089103 3300005468 Bacteria 2985
27 Ga0070707_100176325 3300005468 Bacteria 2083
28 Ga0070707_100533605 3300005468 Bacteria 1135
29 Ga0070698_100000483 3300005471 Bacteria 42307
30 Ga0070698_100026468 3300005471 Bacteria 6038
31 Ga0070698_100095420 3300005471 Bacteria 2952
32 Ga0070698_100113234 3300005471 Bacteria 2678
33 Ga0070698_100212235 3300005471 Bacteria 1870
34 Ga0070698_100293797 3300005471 Unclassified 1556
35 Ga0070698_100317986 3300005471 Bacteria 1487
36 Ga0070699_100010696 3300005518 Bacteria 7941
37 Ga0070684_100007503 3300005535 Bacteria 8487
38 Ga0070697_100003591 3300005536 Bacteria 11925
39 Ga0068853_100088504 3300005539 Bacteria 2718
40 Ga0070693_100053954 3300005547 Bacteria 2309
41 Ga0070665_100156303 3300005548 Bacteria 2282
42 Ga0070704_100029060 3300005549 Bacteria 3685
43 Ga0070664_100007334 3300005564 Bacteria 8888
44 Ga0068854_100013886 3300005578 Bacteria 5297
45 Ga0068856_100050916 3300005614 Bacteria 4083
46 Ga0068856_100218214 3300005614 Bacteria 1922
47 Ga0070702_100044516 3300005615 Bacteria 2506
48 Ga0068852_100068558 3300005616 Bacteria 3105
49 Ga0068864_100121330 3300005618 Bacteria 2337
50 Ga0068863_100071326 3300005841 Bacteria 3286
51 Ga0068858_100042181 3300005842 Bacteria 4230
52 Ga0068860_100152957 3300005843 Bacteria 2222
53 Ga0068862_100133749 3300005844 Bacteria 2196
54 Ga0081540_1000058 3300005983 Bacteria 120635
55 Ga0081540_1001465 3300005983 Bacteria 20377
56 Ga0070717_10058151 3300006028 Bacteria 3197
57 Ga0070717_10253031 3300006028 Bacteria 1556
58 Ga0070717_10520799 3300006028 Bacteria 1076
59 Ga0070717_10541003 3300006028 Bacteria 1054
60 Ga0070715_10022093 3300006163 Bacteria 2477
61 Ga0070715_10042712 3300006163 Bacteria 1907
62 Ga0070716_100137041 3300006173 Bacteria 1556
63 Ga0070712_100144648 3300006175 Bacteria 1818
64 Ga0068871_100128646 3300006358 Bacteria 2145
65 Ga0075428_100024744 3300006844 Bacteria 6643
66 Ga0075430_100089938 3300006846 Bacteria 2568
67 Ga0075433_10042961 3300006852 Bacteria 3923
68 Ga0075434_100005737 3300006871 Bacteria 11333
69 Ga0075434_100156698 3300006871 Bacteria 2296
70 Ga0075429_100195981 3300006880 Bacteria 1769
71 Ga0068865_100060332 3300006881 Bacteria 2655
72 Ga0075436_100009801 3300006914 Bacteria 6550
73 Ga0075436_100145270 3300006914 Bacteria 1668
74 Ga0075436_100164534 3300006914 Bacteria 1565
75 Ga0075436_100229779 3300006914 Unclassified 1318
76 Ga0075435_100014874 3300007076 Bacteria 5834
77 Ga0075435_100100561 3300007076 Bacteria 2395
78 Ga0075435_100305696 3300007076 Bacteria 1360
79 Ga0099795_10036044 3300007788 Bacteria 1733
80 Ga0105251_10056808 3300009011 Bacteria 1851
81 Ga0105244_10143759 3300009036 Bacteria 1146
82 Ga0105240_10275913 3300009093 Bacteria 1934
83 Ga0114129_10057278 3300009147 Bacteria 5455
84 Ga0114129_10282278 3300009147 Bacteria 2218
85 Ga0105241_10055954 3300009174 Bacteria 3023
86 Ga0105241_10131663 3300009174 Bacteria 2026
87 Ga0105242_10021328 3300009176 Bacteria 5084
88 Ga0105248_10113462 3300009177 Bacteria 3056
89 Ga0099796_10109526 3300010159 Bacteria 1049
90 Ga0157341_1003690 3300012494 Bacteria 1080
91 Ga0157371_10028221 3300013102 Bacteria 4066
92 Ga0157378_10040691 3300013297 Bacteria 4122
93 Ga0163162_10300749 3300013306 Bacteria 1736
94 Ga0163162_10302363 3300013306 Bacteria 1732
95 Ga0157377_10014119 3300014745 Bacteria 4058
96 Ga0157379_10071935 3300014968 Bacteria 3094
97 Ga0157379_10252901 3300014968 Bacteria 1600
98 Ga0157376_10165391 3300014969 Bacteria 2009
99 Ga0157376_10366875 3300014969 Bacteria 1383
100 Ga0183367_1011 3300015688 Bacteria 397353
101 Ga0163161_10192511 3300017792 Unclassified 1568
102 Ga0197907_10687577 3300020069 Bacteria 1771
103 Ga0197907_11115886 3300020069 Bacteria 2522
104 Ga0213874_10088971 3300021377 Unclassified 1011
105 Ga0213876_10031838 3300021384 Bacteria 2782
106 Ga0213876_10073560 3300021384 Bacteria 1805
107 Ga0213875_10000545 3300021388 Bacteria 30871
108 Ga0213875_10000846 3300021388 Bacteria 22615
109 Ga0213875_10004042 3300021388 Bacteria 8162
110 Ga0213875_10029678 3300021388 Bacteria 2593
111 Ga0207426_1041222 3300025302 Bacteria 1432
112 Ga0207653_10004194 3300025885 Bacteria 4523
113 Ga0207692_10022127 3300025898 Bacteria 2921
114 Ga0207692_10038382 3300025898 Bacteria 2349
115 Ga0207692_10045627 3300025898 Bacteria 2193
116 Ga0207692_10069084 3300025898 Bacteria 1855
117 Ga0207692_10103374 3300025898 Bacteria 1568
118 Ga0207692_10119826 3300025898 Bacteria 1472
119 Ga0207692_10142428 3300025898 Bacteria 1365
120 Ga0207688_10012427 3300025901 Bacteria 4631
121 Ga0207685_10053359 3300025905 Bacteria 1570
122 Ga0207699_10002722 3300025906 Bacteria 8357
123 Ga0207699_10036153 3300025906 Bacteria 2814
124 Ga0207699_10064973 3300025906 Bacteria 2210
125 Ga0207684_10004514 3300025910 Bacteria 13080
126 Ga0207654_10140429 3300025911 Bacteria 1540
127 Ga0207707_10316403 3300025912 Bacteria 1348
128 Ga0207693_10022762 3300025915 Bacteria 4975
129 Ga0207693_10025340 3300025915 Bacteria 4703
130 Ga0207693_10043921 3300025915 Bacteria 3512
131 Ga0207663_10047603 3300025916 Bacteria 2648
132 Ga0207663_10108816 3300025916 Bacteria 1877
133 Ga0207662_10020818 3300025918 Bacteria 3745
134 Ga0207657_10001214 3300025919 Bacteria 27453
135 Ga0207646_10000259 3300025922 Bacteria 72047
136 Ga0207646_10001795 3300025922 Bacteria 25949
137 Ga0207646_10020779 3300025922 Bacteria 6079
138 Ga0207646_10037821 3300025922 Bacteria 4349
139 Ga0207687_10154437 3300025927 Bacteria 1755
140 Ga0207700_10043840 3300025928 Bacteria 3289
141 Ga0207700_10088487 3300025928 Bacteria 2438
142 Ga0207700_10241314 3300025928 Bacteria 1540
143 Ga0207700_10317524 3300025928 Bacteria 1349
144 Ga0207664_10022753 3300025929 Bacteria 4685
145 Ga0207664_10027753 3300025929 Bacteria 4296
146 Ga0207664_10148077 3300025929 Bacteria 1992
147 Ga0207664_10233110 3300025929 Bacteria 1601
148 Ga0207690_10408275 3300025932 Bacteria 1084
149 Ga0207706_10104752 3300025933 Bacteria 2489
150 Ga0207669_10142581 3300025937 Bacteria 1666
151 Ga0207665_10004461 3300025939 Bacteria 9293
152 Ga0207665_10022183 3300025939 Bacteria 4174
153 Ga0207665_10033683 3300025939 Bacteria 3397
154 Ga0207665_10079584 3300025939 Unclassified 2253
155 Ga0207665_10095049 3300025939 Bacteria 2071
156 Ga0207665_10140471 3300025939 Bacteria 1722
157 Ga0207691_10120406 3300025940 Bacteria 2327
158 Ga0207689_10012149 3300025942 Bacteria 7371
159 Ga0207679_10199984 3300025945 Bacteria 1668
160 Ga0207678_10005359 3300026067 Bacteria 11488
161 Ga0207708_10193323 3300026075 Bacteria 1621
162 Ga0207702_10008414 3300026078 Bacteria 8703
163 Ga0207702_10078933 3300026078 Bacteria 2851
164 Ga0207648_10189839 3300026089 Bacteria 1820
165 Ga0207674_10007256 3300026116 Bacteria 12923
166 Ga0207675_100009695 3300026118 Bacteria 9009
167 Ga0207683_10001498 3300026121 Bacteria 21070
168 Ga0268265_10457307 3300028380 Bacteria 1194
169 Ga0265336_10021123 3300028666 Bacteria 2083
170 Ga0265338_10008574 3300028800 Bacteria 12372
171 Ga0373930_0013854 3300034816 Bacteria 1493
172 Ga0373958_0003814 3300034819 Bacteria 2198
173 Ga0373938_0004867 3300034957 Bacteria 2261
174 Ga0373926_0000397 3300035083 Bacteria 11183
175 Ga0373926_0001682 3300035083 Bacteria 6847
176 Ga0373926_0016843 3300035083 Bacteria 2504
177 Ga0373928_0047033 3300035084 Bacteria 1008
178 Ga0373934_0000153 3300035086 Bacteria 25139
179 Ga0373944_0007622 3300035089 Bacteria 2905
180 Ga0373944_0009114 3300035089 Bacteria 2686
181 Ga0373944_0038343 3300035089 Bacteria 1471
182 Ga0373949_0009251 3300035090 Bacteria 2159
183 Ga0373923_0000534 3300035111 Bacteria 9254
184 Ga0373923_0013041 3300035111 Bacteria 3088
185 Ga0373923_0014402 3300035111 Bacteria 2970
186 Ga0373932_0006507 3300035112 Bacteria 2763
187 Ga0373936_0002226 3300035113 Bacteria 7240
188 Ga0373936_0004744 3300035113 Bacteria 5134
189 Ga0373936_0073222 3300035113 Bacteria 1415
190 Ga0373939_0003458 3300035114 Bacteria 3704
191 Ga0373945_0000043 3300035116 Bacteria 26347
192 Ga0373945_0009817 3300035116 Bacteria 3139
193 Ga0373953_0000034 3300035117 Bacteria 35875
194 Ga0373953_0005258 3300035117 Bacteria 4185
195 Ga0373953_0019169 3300035117 Bacteria 2541
196 Ga0373954_0006974 3300035118 Bacteria 4933
197 Ga0373954_0009211 3300035118 Bacteria 4343
198 Ga0373954_0067934 3300035118 Unclassified 1690
199 Ga0373956_0000539 3300035119 Bacteria 15475
200 Ga0373956_0028951 3300035119 Bacteria 2413
201 Ga0373957_0000023 3300035120 Bacteria 39727
202 Ga0373957_0013573 3300035120 Bacteria 2766
203 Ga0373957_0024126 3300035120 Bacteria 2182
204 Ga0373960_0013513 3300035121 Bacteria 2050
205 Ga0373943_0000228 3300035170 Bacteria 22923
206 Ga0373943_0006840 3300035170 Bacteria 5117
207 Ga0373946_0001313 3300035171 Bacteria 8597
208 Ga0373946_0003037 3300035171 Bacteria 5947
209 Ga0373955_0009088 3300035172 Bacteria 4640
210 Ga0373955_0019559 3300035172 Bacteria 3387
211 Ga0373955_0028415 3300035172 Bacteria 2898
212 Ga0373955_0138768 3300035172 Bacteria 1424
213 Ga0373942_0051819 3300035207 Bacteria 1153
214 Ga0373942_0054853 3300035207 Bacteria 1127
215 Ga0373924_0003766 3300035410 Bacteria 5242
216 Ga0373924_0004733 3300035410 Bacteria 4776
217 Ga0373931_0020400 3300035691 Bacteria 3316
218 Ga0373931_0065178 3300035691 Bacteria 1973
219 Ga0373931_0209824 3300035691 Bacteria 1167
220 Ga0373935_0001212 3300035692 Bacteria 14220
221 Ga0373935_0003198 3300035692 Bacteria 9450
222 Ga0373935_0041628 3300035692 Bacteria 2886
223 Ga0373927_0002356 3300035695 Bacteria 13773
224 Ga0373927_0005116 3300035695 Bacteria 9076
225 Ga0373933_0000284 3300035724 Bacteria 32713
226 Ga0373933_0012770 3300035724 Bacteria 4642
227 Ga0373933_0013106 3300035724 Bacteria 4591
228 Ga0373933_0016074 3300035724 Bacteria 4180
229 Ga0373933_0028861 3300035724 Bacteria 3203
230 Ga0373947_0000027 3300035725 Bacteria 81186
231 Ga0373947_0013229 3300035725 Bacteria 4729
232 Ga0373947_0022386 3300035725 Bacteria 3665
233 Ga0373937_0000163 3300036401 Bacteria 64367
234 Ga0373937_0011556 3300036401 Bacteria 7749
235 Ga0373937_0020010 3300036401 Bacteria 5995
236 Ga0373937_0078491 3300036401 Bacteria 3051
237 Ga0373925_0001447 3300037068 Bacteria 20522
238 Ga0373925_0014338 3300037068 Bacteria 5734
239 Ga0373925_0019054 3300037068 Bacteria 4989
240 Ga0373925_0036329 3300037068 Bacteria 3636
241 Ga0373925_0072010 3300037068 Bacteria 2614
242 Ga0373925_0173688 3300037068 Bacteria 1702
243 Ga0436364_0002069 3300037853 Bacteria 5221
244 Ga0436364_0113831 3300037853 Unclassified 1427
245 Ga0436364_0260163 3300037853 Bacteria 5911
246 Ga0436364_0370862 3300037853 Bacteria 1694
247 Ga0436364_0388822 3300037853 Bacteria 1141
248 Ga0436364_0513584 3300037853 Bacteria 44658
249 Ga0436364_0668079 3300037853 Bacteria 2395
250 Ga0436364_1103488 3300037853 Bacteria 12630
251 Ga0436364_1249662 3300037853 Bacteria 9169
252 Ga0436364_1476073 3300037853 Bacteria 87559
253 Ga0436365_1247093 3300039437 Bacteria 6257
254 Ga0436365_1687996 3300039437 Bacteria 3082
255 Ga0436365_1842971 3300039437 Bacteria 2835
256 Ga0436365_1853335 3300039437 Bacteria 1597
257 Ga0436363_0490223 3300039450 Bacteria 45099
258 Ga0436363_0962085 3300039450 Bacteria 1105
259 Ga0436362_0702882 3300039453 Bacteria 3436
260 Ga0466965_0112099 3300044683 Bacteria 1402
261 Ga0466963_0000432 3300044694 Bacteria 19341
262 Ga0466963_0011608 3300044694 Bacteria 5362
263 Ga0466963_0062359 3300044694 Bacteria 2494
264 Ga0466963_0097117 3300044694 Bacteria 2013
265 Ga0466963_0129218 3300044694 Bacteria 1744
266 Ga0466971_0044384 3300044719 Bacteria 1996
267 Ga0466971_0046370 3300044719 Bacteria 1953
268 Ga0466971_0048072 3300044719 Bacteria 1918
269 Ga0466970_0144227 3300044765 Bacteria 1313
270 Ga0466957_0093891 3300044842 Bacteria 1883
271 Ga0466959_0017959 3300045049 Bacteria 5190
272 Ga0466959_0032218 3300045049 Bacteria 3880
273 Ga0466959_0033735 3300045049 Bacteria 3785
274 Ga0466959_0073163 3300045049 Unclassified 2480
275 Ga0466959_0078960 3300045049 Bacteria 2373
276 Ga0466959_0082047 3300045049 Bacteria 2323
277 Ga0466959_0103022 3300045049 Bacteria 2042
278 Ga0466959_0272397 3300045049 Bacteria 1163
279 Ga0466958_0003984 3300045836 Bacteria 7741
280 Ga0466958_0015680 3300045836 Bacteria 4349
281 Ga0466958_0035089 3300045836 Bacteria 2995
282 Ga0466967_0038197 3300045976 Bacteria 4116
283 Ga0466967_0093273 3300045976 Bacteria 2739
284 Ga0466967_0225941 3300045976 Bacteria 1781
285 Ga0466967_0623435 3300045976 Bacteria 1065
286 Ga0495592_0000043 3300046454 Bacteria 122354
287 Ga0495629_0004327 3300046459 Bacteria 10645
288 Ga0495629_0007429 3300046459 Bacteria 8071
289 Ga0495641_0009162 3300046461 Bacteria 5918
290 Ga0495641_0017156 3300046461 Bacteria 3783
291 Ga0495651_0000138 3300046462 Bacteria 54067
292 Ga0495651_0002484 3300046462 Bacteria 14255
293 Ga0495651_0032713 3300046462 Bacteria 4055
294 Ga0495653_0002501 3300046463 Bacteria 14639
295 Ga0495653_0014625 3300046463 Bacteria 6402
296 Ga0495653_0042558 3300046463 Bacteria 3536
297 Ga0495653_0058328 3300046463 Bacteria 2934
298 Ga0495580_0013131 3300046472 Bacteria 6341
299 Ga0495582_0008498 3300046473 Bacteria 5664
300 Ga0495639_0004747 3300046475 Bacteria 5843
301 Ga0495639_0010836 3300046475 Bacteria 3927
302 Ga0495662_0010024 3300046476 Bacteria 4649
303 Ga0495662_0010461 3300046476 Bacteria 4542
304 Ga0495664_0001772 3300046477 Bacteria 11459
305 Ga0495664_0009292 3300046477 Bacteria 5497
306 Ga0495664_0011976 3300046477 Bacteria 4900
307 Ga0495664_0020982 3300046477 Bacteria 3771
308 Ga0495664_0081233 3300046477 Bacteria 1943
309 Ga0495594_0001024 3300046499 Bacteria 14559
310 Ga0495594_0020176 3300046499 Bacteria 3549
311 Ga0495608_0000016 3300046511 Bacteria 196738
312 Ga0495608_0033944 3300046511 Bacteria 3445
313 Ga0495608_0048959 3300046511 Bacteria 2807
314 Ga0495608_0050722 3300046511 Bacteria 2752
315 Ga0495608_0054053 3300046511 Bacteria 2655
316 Ga0495618_0005128 3300046514 Bacteria 8001
317 Ga0495618_0012945 3300046514 Bacteria 5071
318 Ga0495618_0017140 3300046514 Bacteria 4439
319 Ga0495618_0102134 3300046514 Bacteria 1835
320 Ga0495628_0000034 3300046516 Bacteria 115264
321 Ga0495628_0024679 3300046516 Bacteria 4917
322 Ga0495630_0013352 3300046517 Bacteria 5978
323 Ga0495630_0022863 3300046517 Bacteria 4617
324 Ga0495630_0174139 3300046517 Bacteria 1640
325 Ga0495666_0003551 3300046526 Bacteria 7882
326 Ga0495652_0001347 3300046529 Bacteria 27374
327 Ga0495652_0006375 3300046529 Bacteria 10982
328 Ga0495652_0038530 3300046529 Bacteria 4140
329 Ga0495652_0058381 3300046529 Bacteria 3266
330 Ga0495652_0142084 3300046529 Bacteria 1887
331 Ga0495652_0249745 3300046529 Unclassified 1315
332 Ga0495665_0003541 3300046531 Bacteria 8482
333 Ga0495665_0011714 3300046531 Bacteria 4751
334 Ga0495665_0015505 3300046531 Bacteria 4104
335 Ga0495640_0006874 3300046533 Bacteria 8963
336 Ga0495640_0040371 3300046533 Bacteria 3268
337 Ga0495640_0070436 3300046533 Bacteria 2349
338 Ga0495586_0021805 3300046535 Bacteria 3418
339 Ga0495586_0118831 3300046535 Bacteria 1475
340 Ga0495587_0000044 3300046536 Bacteria 108443
341 Ga0495587_0024772 3300046536 Bacteria 3674
342 Ga0495587_0024944 3300046536 Bacteria 3660
343 Ga0495587_0107581 3300046536 Bacteria 1603
344 Ga0495645_0005536 3300046543 Bacteria 8685
345 Ga0495645_0010516 3300046543 Bacteria 6489
346 Ga0495645_0097904 3300046543 Bacteria 2088
347 Ga0495645_0123795 3300046543 Bacteria 1818
348 Ga0495622_0058719 3300046557 Bacteria 1782
349 Ga0495622_0067778 3300046557 Bacteria 1649
350 Ga0495667_0000052 3300046559 Bacteria 108432
351 Ga0495667_0006252 3300046559 Bacteria 8073
352 Ga0495667_0006255 3300046559 Bacteria 8072
353 Ga0495667_0014502 3300046559 Bacteria 5324
354 Ga0495667_0026851 3300046559 Unclassified 3879
355 Ga0495667_0061954 3300046559 Bacteria 2451
356 Ga0495667_0115730 3300046559 Bacteria 1732
357 Ga0495634_0017382 3300046642 Bacteria 5132
358 Ga0495634_0065227 3300046642 Bacteria 2413
359 Ga0495635_0000755 3300046663 Bacteria 21004
360 Ga0495635_0024800 3300046663 Bacteria 4178
361 Ga0495635_0074820 3300046663 Bacteria 2320
362 Ga0495635_0122070 3300046663 Bacteria 1777
363 Ga0495635_0146848 3300046663 Unclassified 1605
364 Ga0495635_0245603 3300046663 Bacteria 1207
365 Ga0495657_0000015 3300046675 Bacteria 187657
366 Ga0495657_0026662 3300046675 Bacteria 4089
367 Ga0495657_0038478 3300046675 Bacteria 3291
368 Ga0495657_0071436 3300046675 Bacteria 2265
369 Ga0495657_0178060 3300046675 Bacteria 1306
370 Ga0495657_0204718 3300046675 Bacteria 1201
371 Ga0495599_0000035 3300046678 Bacteria 103981
372 Ga0495599_0015499 3300046678 Bacteria 4731
373 Ga0495599_0046372 3300046678 Bacteria 2725
374 Ga0495599_0110364 3300046678 Bacteria 1713
375 Ga0495599_0130324 3300046678 Bacteria 1562
376 Ga0495623_0001173 3300046679 Bacteria 17776
377 Ga0495623_0015153 3300046679 Bacteria 4984
378 Ga0495623_0070039 3300046679 Bacteria 2185
379 Ga0495646_0018027 3300046680 Bacteria 4470
380 Ga0495646_0073928 3300046680 Bacteria 2001
381 Ga0495646_0130684 3300046680 Bacteria 1414
382 Ga0495647_0004716 3300046681 Bacteria 4447
383 Ga0495658_0009355 3300046683 Bacteria 4882
384 Ga0495613_0015869 3300046689 Bacteria 5608
385 Ga0495613_0043990 3300046689 Bacteria 3304
386 Ga0495624_0006702 3300046690 Bacteria 8137
387 Ga0495624_0010943 3300046690 Bacteria 6253
388 Ga0495624_0028208 3300046690 Bacteria 3670
389 Ga0495600_0001224 3300046809 Bacteria 14068
390 Ga0495600_0097243 3300046809 Bacteria 1919
391 Ga0495600_0226247 3300046809 Bacteria 1195
392 Ga0495581_0004991 3300047315 Bacteria 7683
393 Ga0495581_0012235 3300047315 Bacteria 4969
394 Ga0495604_0000048 3300047317 Bacteria 108810
395 Ga0495604_0027683 3300047317 Bacteria 4506
396 Ga0495604_0115802 3300047317 Bacteria 1947
397 Ga0495674_0000397 3300047319 Bacteria 39073
398 Ga0495674_0016788 3300047319 Bacteria 6829
399 Ga0495674_0079507 3300047319 Bacteria 2815
400 Ga0495674_0095610 3300047319 Unclassified 2533
401 Ga0495676_0006653 3300047321 Bacteria 10656
402 Ga0495676_0016573 3300047321 Bacteria 6534
403 Ga0495676_0023882 3300047321 Bacteria 5297
404 Ga0495676_0138379 3300047321 Bacteria 1747
405 Ga0495680_0000069 3300047322 Bacteria 88766
406 Ga0495680_0002788 3300047322 Bacteria 17615
407 Ga0495680_0009147 3300047322 Bacteria 8940
408 Ga0495680_0010319 3300047322 Bacteria 8334
409 Ga0495680_0014262 3300047322 Bacteria 6891
410 Ga0495675_0000620 3300047444 Bacteria 22765
411 Ga0495675_0011495 3300047444 Bacteria 5557
412 Ga0495675_0048890 3300047444 Bacteria 2690
413 Ga0495684_0001030 3300047471 Bacteria 22650
414 Ga0495684_0036517 3300047471 Bacteria 3766
415 Ga0495684_0054590 3300047471 Bacteria 3047
416 Ga0495593_0017386 3300047673 Bacteria 4048
417 Ga0495593_0018842 3300047673 Bacteria 3874
418 Ga0495593_0020348 3300047673 Bacteria 3717
419 Ga0495602_0000200 3300048088 Bacteria 55719
420 Ga0495602_0011332 3300048088 Bacteria 9222
421 Ga0495602_0082680 3300048088 Bacteria 2694
422 Ga0495602_0164791 3300048088 Bacteria 1726
423 Ga0495614_0030853 3300048089 Bacteria 2307
424 Ga0496101_0203429 3300048904 Bacteria 1531
425 Ga0496102_0420806 3300048905 Bacteria 1255
426 Ga0496104_0001422 3300048907 Bacteria 20726
427 Ga0496104_0032070 3300048907 Bacteria 4889
428 Ga0496104_0060519 3300048907 Bacteria 3587
429 Ga0496105_0009501 3300048908 Bacteria 7609
430 Ga0496105_0010902 3300048908 Bacteria 7160
431 Ga0496105_0163093 3300048908 Bacteria 1829
432 Ga0496106_0030381 3300048909 Bacteria 4030
433 Ga0496106_0057619 3300048909 Bacteria 2938
434 Ga0496107_0046830 3300048910 Bacteria 3112
435 Ga0496109_0045460 3300048912 Bacteria 3985
436 Ga0496109_0293596 3300048912 Bacteria 1532
437 Ga0496110_0056724 3300048913 Bacteria 3447
438 Ga0496110_0116767 3300048913 Bacteria 2402
439 Ga0496113_0003629 3300048916 Bacteria 9275
440 Ga0496114_0026015 3300048917 Bacteria 4787
441 Ga0496114_0031767 3300048917 Bacteria 4344
442 Ga0496114_0259577 3300048917 Bacteria 1529
443 Ga0496115_0061230 3300048918 Bacteria 3034
444 Ga0501034_0547304 3300049571 Bacteria 1067
445 nmdc:mga05p37_47889_c1 3300050507 Bacteria 5257
446 nmdc:mga09592_11244_c1 3300050508 Bacteria 7281
447 nmdc:mga06r32_83904_c1 3300050510 Bacteria 3105
448 nmdc:mga08y16_38604_c1 3300050511 Bacteria 5013
449 nmdc:mga0n895_13965_c1 3300050512 Bacteria 7274
450 nmdc:mga0n895_16226_c1 3300050512 Bacteria 6828
451 nmdc:mga0n895_34669_c1 3300050512 Bacteria 4861
452 nmdc:mga0rr50_381554_c1 3300050513 Bacteria 1188
453 nmdc:mga0rr50_4959_c1 3300050513 Bacteria 7881
454 nmdc:mga08x19_7035_c1 3300050514 Bacteria 6678
455 nmdc:mga08x19_9057_c1 3300050514 Bacteria 5942
456 nmdc:mga0a205_186909_c1 3300050515 Bacteria 1964
457 nmdc:mga0a205_73736_c1 3300050515 Bacteria 3298
458 Ga0495601_0060327 3300053077 Bacteria 2407
459 Ga0495601_0215423 3300053077 Bacteria 1254
460 Ga0495612_0005872 3300053078 Bacteria 5064
461 Ga0495612_0011635 3300053078 Bacteria 3546
462 Ga0495612_0137978 3300053078 Bacteria 1056
463 Ga0495595_0000122 3300053084 Bacteria 33351
464 Ga0495595_0001955 3300053084 Bacteria 8005
465 Ga0495595_0007927 3300053084 Bacteria 4349
466 Ga0495619_0009861 3300053085 Bacteria 6021
467 Ga0495619_0037395 3300053085 Bacteria 3162
468 Ga0495619_0133938 3300053085 Unclassified 1704
469 Ga0495619_0265710 3300053085 Bacteria 1189
470 2884695921 2884693830 Bacteria 11273186
471 2895447759 2895442618 Bacteria 11027144
472 2899368191 2899359706 Bacteria 10940472
473 Ga0495603_0009633
474 Ga0070658_10120094
475 Ga0070683_100063457
476 Ga0070666_10167001
477 Ga0070680_100017071
478 Ga0070660_100012434
479 Ga0070689_100445028
480 Ga0070675_100044219
481 Ga0070671_100244845
482 Ga0070674_100397818
483 Ga0070709_10000308
484 Ga0070709_10369105
485 Ga0070714_100179568
486 Ga0070713_100203021
487 Ga0070710_10095958
488 Ga0070701_10038607
489 Ga0070711_100109795
490 Ga0070711_100407043
491 Ga0070705_100052499
492 Ga0070681_10202597
493 Ga0070685_10129801
494 Ga0070706_100007725
495 Ga0070707_100000746
496 Ga0070707_100002252
497 Ga0070707_100038967
498 Ga0070707_100089103
499 Ga0070707_100176325
500 Ga0070707_100533605
501 Ga0070698_100000483
502 Ga0070698_100026468
503 Ga0070698_100095420
504 Ga0070698_100113234
505 Ga0070698_100212235
506 Ga0070698_100293797
507 Ga0070698_100317986
508 Ga0070699_100010696
509 Ga0070684_100007503
510 Ga0070697_100003591
511 Ga0068853_100088504
512 Ga0070693_100053954
513 Ga0070665_100156303
514 Ga0070704_100029060
515 Ga0070664_100007334
516 Ga0068854_100013886
517 Ga0068856_100050916
518 Ga0068856_100218214
519 Ga0070702_100044516
520 Ga0068852_100068558
521 Ga0068864_100121330
522 Ga0068863_100071326
523 Ga0068858_100042181
524 Ga0068860_100152957
525 Ga0068862_100133749
526 Ga0081540_1000058
527 Ga0081540_1001465
528 Ga0070717_10058151
529 Ga0070717_10253031
530 Ga0070717_10520799
531 Ga0070717_10541003
532 Ga0070715_10022093
533 Ga0070715_10042712
534 Ga0070716_100137041
535 Ga0070712_100144648
536 Ga0068871_100128646
537 Ga0075428_100024744
538 Ga0075430_100089938
539 Ga0075433_10042961
540 Ga0075434_100005737
541 Ga0075434_100156698
542 Ga0075429_100195981
543 Ga0068865_100060332
544 Ga0075436_100009801
545 Ga0075436_100145270
546 Ga0075436_100164534
547 Ga0075436_100229779
548 Ga0075435_100014874
549 Ga0075435_100100561
550 Ga0075435_100305696
551 Ga0099795_10036044
552 Ga0105251_10056808
553 Ga0105244_10143759
554 Ga0105240_10275913
555 Ga0114129_10057278
556 Ga0114129_10282278
557 Ga0105241_10055954
558 Ga0105241_10131663
559 Ga0105242_10021328
560 Ga0105248_10113462
561 Ga0099796_10109526
562 Ga0157341_1003690
563 Ga0157371_10028221
564 Ga0157378_10040691
565 Ga0163162_10300749
566 Ga0163162_10302363
567 Ga0157377_10014119
568 Ga0157379_10071935
569 Ga0157379_10252901
570 Ga0157376_10165391
571 Ga0157376_10366875
572 Ga0183367_1011
573 Ga0163161_10192511
574 Ga0197907_10687577
575 Ga0197907_11115886
576 Ga0213874_10088971
577 Ga0213876_10031838
578 Ga0213876_10073560
579 Ga0213875_10000545
580 Ga0213875_10000846
581 Ga0213875_10004042
582 Ga0213875_10029678
583 Ga0207426_1041222
584 Ga0207653_10004194
585 Ga0207692_10022127
586 Ga0207692_10038382
587 Ga0207692_10045627
588 Ga0207692_10069084
589 Ga0207692_10103374
590 Ga0207692_10119826
591 Ga0207692_10142428
592 Ga0207688_10012427
593 Ga0207685_10053359
594 Ga0207699_10002722
595 Ga0207699_10036153
596 Ga0207699_10064973
597 Ga0207684_10004514
598 Ga0207654_10140429
599 Ga0207707_10316403
600 Ga0207693_10022762
601 Ga0207693_10025340
602 Ga0207693_10043921
603 Ga0207663_10047603
604 Ga0207663_10108816
605 Ga0207662_10020818
606 Ga0207657_10001214
607 Ga0207646_10000259
608 Ga0207646_10001795
609 Ga0207646_10020779
610 Ga0207646_10037821
611 Ga0207687_10154437
612 Ga0207700_10043840
613 Ga0207700_10088487
614 Ga0207700_10241314
615 Ga0207700_10317524
616 Ga0207664_10022753
617 Ga0207664_10027753
618 Ga0207664_10148077
619 Ga0207664_10233110
620 Ga0207690_10408275
621 Ga0207706_10104752
622 Ga0207669_10142581
623 Ga0207665_10004461
624 Ga0207665_10022183
625 Ga0207665_10033683
626 Ga0207665_10079584
627 Ga0207665_10095049
628 Ga0207665_10140471
629 Ga0207691_10120406
630 Ga0207689_10012149
631 Ga0207679_10199984
632 Ga0207678_10005359
633 Ga0207708_10193323
634 Ga0207702_10008414
635 Ga0207702_10078933
636 Ga0207648_10189839
637 Ga0207674_10007256
638 Ga0207675_100009695
639 Ga0207683_10001498
640 Ga0268265_10457307
641 Ga0265336_10021123
642 Ga0265338_10008574
643 Ga0373930_0013854
644 Ga0373958_0003814
645 Ga0373938_0004867
646 Ga0373926_0000397
647 Ga0373926_0001682
648 Ga0373926_0016843
649 Ga0373928_0047033
650 Ga0373934_0000153
651 Ga0373944_0007622
652 Ga0373944_0009114
653 Ga0373944_0038343
654 Ga0373949_0009251
655 Ga0373923_0000534
656 Ga0373923_0013041
657 Ga0373923_0014402
658 Ga0373932_0006507
659 Ga0373936_0002226
660 Ga0373936_0004744
661 Ga0373936_0073222
662 Ga0373939_0003458
663 Ga0373945_0000043
664 Ga0373945_0009817
665 Ga0373953_0000034
666 Ga0373953_0005258
667 Ga0373953_0019169
668 Ga0373954_0006974
669 Ga0373954_0009211
670 Ga0373954_0067934
671 Ga0373956_0000539
672 Ga0373956_0028951
673 Ga0373957_0000023
674 Ga0373957_0013573
675 Ga0373957_0024126
676 Ga0373960_0013513
677 Ga0373943_0000228
678 Ga0373943_0006840
679 Ga0373946_0001313
680 Ga0373946_0003037
681 Ga0373955_0009088
682 Ga0373955_0019559
683 Ga0373955_0028415
684 Ga0373955_0138768
685 Ga0373942_0051819
686 Ga0373942_0054853
687 Ga0373924_0003766
688 Ga0373924_0004733
689 Ga0373931_0020400
690 Ga0373931_0065178
691 Ga0373931_0209824
692 Ga0373935_0001212
693 Ga0373935_0003198
694 Ga0373935_0041628
695 Ga0373927_0002356
696 Ga0373927_0005116
697 Ga0373933_0000284
698 Ga0373933_0012770
699 Ga0373933_0013106
700 Ga0373933_0016074
701 Ga0373933_0028861
702 Ga0373947_0000027
703 Ga0373947_0013229
704 Ga0373947_0022386
705 Ga0373937_0000163
706 Ga0373937_0011556
707 Ga0373937_0020010
708 Ga0373937_0078491
709 Ga0373925_0001447
710 Ga0373925_0014338
711 Ga0373925_0019054
712 Ga0373925_0036329
713 Ga0373925_0072010
714 Ga0373925_0173688
715 Ga0436364_0002069
716 Ga0436364_0113831
717 Ga0436364_0260163
718 Ga0436364_0370862
719 Ga0436364_0388822
720 Ga0436364_0513584
721 Ga0436364_0668079
722 Ga0436364_1103488
723 Ga0436364_1249662
724 Ga0436364_1476073
725 Ga0436365_1247093
726 Ga0436365_1687996
727 Ga0436365_1842971
728 Ga0436365_1853335
729 Ga0436363_0490223
730 Ga0436363_0962085
731 Ga0436362_0702882
732 Ga0466965_0112099
733 Ga0466963_0000432
734 Ga0466963_0011608
735 Ga0466963_0062359
736 Ga0466963_0097117
737 Ga0466963_0129218
738 Ga0466971_0044384
739 Ga0466971_0046370
740 Ga0466971_0048072
741 Ga0466970_0144227
742 Ga0466957_0093891
743 Ga0466959_0017959
744 Ga0466959_0032218
745 Ga0466959_0033735
746 Ga0466959_0073163
747 Ga0466959_0078960
748 Ga0466959_0082047
749 Ga0466959_0103022
750 Ga0466959_0272397
751 Ga0466958_0003984
752 Ga0466958_0015680
753 Ga0466958_0035089
754 Ga0466967_0038197
755 Ga0466967_0093273
756 Ga0466967_0225941
757 Ga0466967_0623435
758 Ga0495592_0000043
759 Ga0495629_0004327
760 Ga0495629_0007429
761 Ga0495641_0009162
762 Ga0495641_0017156
763 Ga0495651_0000138
764 Ga0495651_0002484
765 Ga0495651_0032713
766 Ga0495653_0002501
767 Ga0495653_0014625
768 Ga0495653_0042558
769 Ga0495653_0058328
770 Ga0495580_0013131
771 Ga0495582_0008498
772 Ga0495639_0004747
773 Ga0495639_0010836
774 Ga0495662_0010024
775 Ga0495662_0010461
776 Ga0495664_0001772
777 Ga0495664_0009292
778 Ga0495664_0011976
779 Ga0495664_0020982
780 Ga0495664_0081233
781 Ga0495594_0001024
782 Ga0495594_0020176
783 Ga0495608_0000016
784 Ga0495608_0033944
785 Ga0495608_0048959
786 Ga0495608_0050722
787 Ga0495608_0054053
788 Ga0495618_0005128
789 Ga0495618_0012945
790 Ga0495618_0017140
791 Ga0495618_0102134
792 Ga0495628_0000034
793 Ga0495628_0024679
794 Ga0495630_0013352
795 Ga0495630_0022863
796 Ga0495630_0174139
797 Ga0495666_0003551
798 Ga0495652_0001347
799 Ga0495652_0006375
800 Ga0495652_0038530
801 Ga0495652_0058381
802 Ga0495652_0142084
803 Ga0495652_0249745
804 Ga0495665_0003541
805 Ga0495665_0011714
806 Ga0495665_0015505
807 Ga0495640_0006874
808 Ga0495640_0040371
809 Ga0495640_0070436
810 Ga0495586_0021805
811 Ga0495586_0118831
812 Ga0495587_0000044
813 Ga0495587_0024772
814 Ga0495587_0024944
815 Ga0495587_0107581
816 Ga0495645_0005536
817 Ga0495645_0010516
818 Ga0495645_0097904
819 Ga0495645_0123795
820 Ga0495622_0058719
821 Ga0495622_0067778
822 Ga0495667_0000052
823 Ga0495667_0006252
824 Ga0495667_0006255
825 Ga0495667_0014502
826 Ga0495667_0026851
827 Ga0495667_0061954
828 Ga0495667_0115730
829 Ga0495634_0017382
830 Ga0495634_0065227
831 Ga0495635_0000755
832 Ga0495635_0024800
833 Ga0495635_0074820
834 Ga0495635_0122070
835 Ga0495635_0146848
836 Ga0495635_0245603
837 Ga0495657_0000015
838 Ga0495657_0026662
839 Ga0495657_0038478
840 Ga0495657_0071436
841 Ga0495657_0178060
842 Ga0495657_0204718
843 Ga0495599_0000035
844 Ga0495599_0015499
845 Ga0495599_0046372
846 Ga0495599_0110364
847 Ga0495599_0130324
848 Ga0495623_0001173
849 Ga0495623_0015153
850 Ga0495623_0070039
851 Ga0495646_0018027
852 Ga0495646_0073928
853 Ga0495646_0130684
854 Ga0495647_0004716
855 Ga0495658_0009355
856 Ga0495613_0015869
857 Ga0495613_0043990
858 Ga0495624_0006702
859 Ga0495624_0010943
860 Ga0495624_0028208
861 Ga0495600_0001224
862 Ga0495600_0097243
863 Ga0495600_0226247
864 Ga0495581_0004991
865 Ga0495581_0012235
866 Ga0495604_0000048
867 Ga0495604_0027683
868 Ga0495604_0115802
869 Ga0495674_0000397
870 Ga0495674_0016788
871 Ga0495674_0079507
872 Ga0495674_0095610
873 Ga0495676_0006653
874 Ga0495676_0016573
875 Ga0495676_0023882
876 Ga0495676_0138379
877 Ga0495680_0000069
878 Ga0495680_0002788
879 Ga0495680_0009147
880 Ga0495680_0010319
881 Ga0495680_0014262
882 Ga0495675_0000620
883 Ga0495675_0011495
884 Ga0495675_0048890
885 Ga0495684_0001030
886 Ga0495684_0036517
887 Ga0495684_0054590
888 Ga0495593_0017386
889 Ga0495593_0018842
890 Ga0495593_0020348
891 Ga0495602_0000200
892 Ga0495602_0011332
893 Ga0495602_0082680
894 Ga0495602_0164791
895 Ga0495614_0030853
896 Ga0496101_0203429
897 Ga0496102_0420806
898 Ga0496104_0001422
899 Ga0496104_0032070
900 Ga0496104_0060519
901 Ga0496105_0009501
902 Ga0496105_0010902
903 Ga0496105_0163093
904 Ga0496106_0030381
905 Ga0496106_0057619
906 Ga0496107_0046830
907 Ga0496109_0045460
908 Ga0496109_0293596
909 Ga0496110_0056724
910 Ga0496110_0116767
911 Ga0496113_0003629
912 Ga0496114_0026015
913 Ga0496114_0031767
914 Ga0496114_0259577
915 Ga0496115_0061230
916 Ga0501034_0547304
917 nmdc:mga05p37_47889_c1
918 nmdc:mga09592_11244_c1
919 nmdc:mga06r32_83904_c1
920 nmdc:mga08y16_38604_c1
921 nmdc:mga0n895_13965_c1
922 nmdc:mga0n895_16226_c1
923 nmdc:mga0n895_34669_c1
924 nmdc:mga0rr50_381554_c1
925 nmdc:mga0rr50_4959_c1
926 nmdc:mga08x19_7035_c1
927 nmdc:mga08x19_9057_c1
928 nmdc:mga0a205_186909_c1
929 nmdc:mga0a205_73736_c1
930 Ga0495601_0060327
931 Ga0495601_0215423
932 Ga0495612_0005872
933 Ga0495612_0011635
934 Ga0495612_0137978
935 Ga0495595_0000122
936 Ga0495595_0001955
937 Ga0495595_0007927
938 Ga0495619_0009861
939 Ga0495619_0037395
940 Ga0495619_0133938
941 Ga0495619_0265710
942 2884695921
943 2895447759
944 2899368191

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

23

306

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xkj-assembly1.cif.gz_B bacterial luciferase beta2 homodimer 0.8692 1 296
1luc-assembly1.cif.gz_A bacterial luciferase 0.8656 1 305
3fgc-assembly1.cif.gz_A crystal structure of the bacterial luciferase:flavin complex reveals the basis of intersubunit communication 0.863 1 305
1luc-assembly1.cif.gz_A bacterial luciferase 0.8629 1 305
6fri-assembly2.cif.gz_D structure of luxb from photobacterium leiognathi 0.8619 1 303
ID Description Score Start End Superfamily
1bslA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8682 1 296 3.20.20.30
6friA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8661 1 283 3.20.20.30
1rhcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8534 2 305 3.20.20.30
af_I6X9T8_35_343_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.851 28 305 3.20.20.30
3fgcC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8492 1 305 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A829Q7A8-F1-model_v4 Luciferase-like monooxygenase family protein 0.9852 1 105 GO:0004497
GO:0005829
GO:0016705
AF-A0A2A7MZL8-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9808 2 305 GO:0008726
GO:0046306
AF-A0A1V3WND4-F1-model_v4 Luciferase-like monooxygenase family protein 0.9799 1 186 GO:0008726
GO:0046306
AF-A0A7I7Y7G3-F1-model_v4 Luciferase-like protein 0.9785 2 305 GO:0008726
GO:0046306
AF-A0A0G3IRX9-F1-model_v4 Luciferase 0.9785 1 305 GO:0008726
GO:0046306

Map