F450816

General Info

Members Datasets Scaffolds Average Seq Length
472 195 472 215

Family's Representative Sequence

Representative Sequence 3300025919|Ga0207657_10611932|Ga0207657_106119321
Length 253
Sequence MKPYLCPPEGNVGNDCLLLKAGHDPGLFYNKYSIMKRFLLTGFLMAAVALVIAQTANDPAAKKILDGVSAKFKTYKAVQVQFTLKVEDGKGKLQGSQKGTVYMKGNKYRVSLAGKDNKEMFSDGSTTWTYDKASSEVTIAKTDPSAKTITPQSLLTNFYDKDFLYKLNGEQKDGPRTLQEIEMTPTDKSKTFHKVYVYVDKAKQGIYSTKVLDKNGNKYTYTVNSLNGNAAINDQLFVFDKSKYPGVEEVDLR

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
141 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
192 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 0
Rhizoplane 0.42
Rhizosphere 96.61
Stem 0
Stem Tuber 0
Unclassified 1.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_1310824 2162886011 Bacteria 1141
2 ARcpr5yngRDRAFT_c005752 3300000043 Unclassified 1135
3 JGI24751J29686_10000697 3300002459 Bacteria 8296
4 rootH1_10079318 3300003316 Bacteria 2143
5 Ga0065712_10124090 3300005290 Bacteria 1619
6 Ga0065712_10255476 3300005290 Bacteria 941
7 Ga0070658_10025676 3300005327 Bacteria 4721
8 Ga0070658_10062940 3300005327 Bacteria 3024
9 Ga0070658_10175616 3300005327 Bacteria 1801
10 Ga0070658_10628469 3300005327 Bacteria 931
11 Ga0070676_10001325 3300005328 Bacteria 12443
12 Ga0070676_10039691 3300005328 Bacteria 2723
13 Ga0070676_10165048 3300005328 Bacteria 1428
14 Ga0070676_10204941 3300005328 Bacteria 1295
15 Ga0070683_100000163 3300005329 Bacteria 43905
16 Ga0070683_100002968 3300005329 Bacteria 13603
17 Ga0070683_100102845 3300005329 Bacteria 2691
18 Ga0070690_100007549 3300005330 Bacteria 6224
19 Ga0070690_100055790 3300005330 Bacteria 2531
20 Ga0070690_100205100 3300005330 Bacteria 1374
21 Ga0070670_100008754 3300005331 Bacteria 8643
22 Ga0070670_100081260 3300005331 Bacteria 2785
23 Ga0070670_100321289 3300005331 Bacteria 1356
24 Ga0068869_100002154 3300005334 Bacteria 11840
25 Ga0068869_100076503 3300005334 Bacteria 2488
26 Ga0068869_100077989 3300005334 Bacteria 2466
27 Ga0068869_100102195 3300005334 Unclassified 2169
28 Ga0068869_100116093 3300005334 Unclassified 2042
29 Ga0068869_100362686 3300005334 Bacteria 1184
30 Ga0070666_10000051 3300005335 Bacteria 99740
31 Ga0070666_10043723 3300005335 Bacteria 3000
32 Ga0070680_100044461 3300005336 Bacteria 3609
33 Ga0070682_100243845 3300005337 Bacteria 1291
34 Ga0070682_101022226 3300005337 Unclassified 687
35 Ga0068868_100009542 3300005338 Bacteria 6993
36 Ga0068868_100022248 3300005338 Bacteria 4783
37 Ga0068868_100066867 3300005338 Bacteria 2859
38 Ga0068868_100181328 3300005338 Bacteria 1747
39 Ga0068868_100219385 3300005338 Bacteria 1591
40 Ga0068868_100238580 3300005338 Bacteria 1527
41 Ga0070660_100042613 3300005339 Bacteria 3465
42 Ga0070689_100411509 3300005340 Bacteria 1145
43 Ga0070689_100783032 3300005340 Bacteria 838
44 Ga0070661_100013480 3300005344 Bacteria 5738
45 Ga0070661_100015221 3300005344 Bacteria 5428
46 Ga0070661_100262532 3300005344 Unclassified 1335
47 Ga0070661_100365956 3300005344 Bacteria 1134
48 Ga0070668_100130932 3300005347 Bacteria 2013
49 Ga0070668_100217971 3300005347 Bacteria 1572
50 Ga0070668_100781338 3300005347 Bacteria 847
51 Ga0070669_100149455 3300005353 Bacteria 1807
52 Ga0070669_100241834 3300005353 Bacteria 1434
53 Ga0070669_100250908 3300005353 Bacteria 1409
54 Ga0070675_100022391 3300005354 Bacteria 5050
55 Ga0070675_100151137 3300005354 Bacteria 1991
56 Ga0070675_100645866 3300005354 Bacteria 961
57 Ga0070671_100070435 3300005355 Bacteria 2917
58 Ga0070674_100007210 3300005356 Bacteria 6544
59 Ga0070674_100093218 3300005356 Unclassified 2179
60 Ga0070673_100052189 3300005364 Bacteria 3207
61 Ga0070673_100076951 3300005364 Bacteria 2695
62 Ga0070673_100113300 3300005364 Bacteria 2252
63 Ga0070673_100181985 3300005364 Bacteria 1800
64 Ga0070673_100393663 3300005364 Bacteria 1237
65 Ga0070673_100419281 3300005364 Bacteria 1200
66 Ga0070688_100019508 3300005365 Bacteria 3929
67 Ga0070688_100066198 3300005365 Bacteria 2299
68 Ga0070688_100559821 3300005365 Bacteria 870
69 Ga0070659_100528695 3300005366 Bacteria 1008
70 Ga0070659_101024961 3300005366 Unclassified 725
71 Ga0070667_100014132 3300005367 Bacteria 6596
72 Ga0070667_100133205 3300005367 Bacteria 2171
73 Ga0070667_100204235 3300005367 Bacteria 1754
74 Ga0070667_100243184 3300005367 Bacteria 1607
75 Ga0070701_10118879 3300005438 Bacteria 1486
76 Ga0070701_10181469 3300005438 Bacteria 1233
77 Ga0070700_100560312 3300005441 Bacteria 889
78 Ga0070663_100164210 3300005455 Bacteria 1711
79 Ga0070663_100626201 3300005455 Unclassified 907
80 Ga0070678_100069233 3300005456 Bacteria 2634
81 Ga0070678_100326121 3300005456 Unclassified 1313
82 Ga0070662_100011578 3300005457 Bacteria 5821
83 Ga0070662_100911132 3300005457 Unclassified 750
84 Ga0068867_100005521 3300005459 Bacteria 8952
85 Ga0068867_100037474 3300005459 Bacteria 3524
86 Ga0068867_100091448 3300005459 Bacteria 2310
87 Ga0068867_100602426 3300005459 Bacteria 958
88 Ga0070685_10088388 3300005466 Bacteria 1871
89 Ga0070685_10227720 3300005466 Bacteria 1224
90 Ga0070679_100001442 3300005530 Bacteria 21032
91 Ga0070679_100003021 3300005530 Bacteria 15362
92 Ga0070679_100267778 3300005530 Bacteria 1663
93 Ga0070684_100017115 3300005535 Bacteria 5943
94 Ga0070684_100021262 3300005535 Bacteria 5395
95 Ga0070684_100064713 3300005535 Bacteria 3208
96 Ga0068853_100002145 3300005539 Bacteria 14683
97 Ga0068853_100047147 3300005539 Bacteria 3698
98 Ga0068853_100085576 3300005539 Bacteria 2764
99 Ga0068853_100202466 3300005539 Unclassified 1807
100 Ga0070672_100224107 3300005543 Bacteria 1578
101 Ga0070672_100684590 3300005543 Bacteria 897
102 Ga0070672_100986036 3300005543 Bacteria 746
103 Ga0070686_100038233 3300005544 Bacteria 2982
104 Ga0070686_100116157 3300005544 Bacteria 1831
105 Ga0070693_100266426 3300005547 Bacteria 1142
106 Ga0070693_100503818 3300005547 Bacteria 859
107 Ga0070665_100292112 3300005548 Bacteria 1632
108 Ga0070665_100359755 3300005548 Bacteria 1461
109 Ga0070665_100783909 3300005548 Bacteria 966
110 Ga0070665_100885550 3300005548 Bacteria 905
111 Ga0068855_100106649 3300005563 Bacteria 3219
112 Ga0068855_100316191 3300005563 Bacteria 1727
113 Ga0070664_100003401 3300005564 Bacteria 12846
114 Ga0070664_101189329 3300005564 Bacteria 719
115 Ga0068857_100041415 3300005577 Bacteria 4085
116 Ga0068857_100861997 3300005577 Bacteria 867
117 Ga0068854_100094647 3300005578 Bacteria 2228
118 Ga0068854_100141627 3300005578 Unclassified 1846
119 Ga0068854_100477340 3300005578 Unclassified 1046
120 Ga0068854_100701700 3300005578 Bacteria 873
121 Ga0068856_100032156 3300005614 Bacteria 5136
122 Ga0070702_100005619 3300005615 Bacteria 5863
123 Ga0068852_100003114 3300005616 Bacteria 11552
124 Ga0068852_100015143 3300005616 Bacteria 5968
125 Ga0068852_100173333 3300005616 Bacteria 2024
126 Ga0068852_100256435 3300005616 Bacteria 1677
127 Ga0068852_100279782 3300005616 Bacteria 1608
128 Ga0068859_100000023 3300005617 Bacteria 221914
129 Ga0068859_100009583 3300005617 Bacteria 9780
130 Ga0068859_100032476 3300005617 Bacteria 5243
131 Ga0068859_100051366 3300005617 Bacteria 4144
132 Ga0068859_100237199 3300005617 Bacteria 1913
133 Ga0068859_100275598 3300005617 Bacteria 1774
134 Ga0068859_100932416 3300005617 Unclassified 952
135 Ga0068864_100002925 3300005618 Bacteria 14126
136 Ga0068864_100004156 3300005618 Bacteria 11886
137 Ga0068864_100108282 3300005618 Bacteria 2473
138 Ga0068864_100261178 3300005618 Bacteria 1611
139 Ga0068861_100017003 3300005719 Bacteria 5158
140 Ga0068861_100096355 3300005719 Bacteria 2344
141 Ga0068861_100448367 3300005719 Bacteria 1156
142 Ga0068861_100787563 3300005719 Unclassified 891
143 Ga0068851_10012087 3300005834 Bacteria 4064
144 Ga0068851_10047113 3300005834 Bacteria 2182
145 Ga0068851_10080001 3300005834 Bacteria 1705
146 Ga0068851_10106571 3300005834 Bacteria 1492
147 Ga0068851_10204394 3300005834 Bacteria 1104
148 Ga0068851_10382932 3300005834 Unclassified 824
149 Ga0068870_10097830 3300005840 Bacteria 1652
150 Ga0068863_100008666 3300005841 Bacteria 9940
151 Ga0068863_100010607 3300005841 Bacteria 8944
152 Ga0068863_100189682 3300005841 Bacteria 1975
153 Ga0068863_100312418 3300005841 Unclassified 1526
154 Ga0068858_100044704 3300005842 Bacteria 4105
155 Ga0068858_100066694 3300005842 Bacteria 3333
156 Ga0068858_100138918 3300005842 Unclassified 2281
157 Ga0068860_100000982 3300005843 Bacteria 31595
158 Ga0068860_100002944 3300005843 Bacteria 17607
159 Ga0068860_100010290 3300005843 Bacteria 9252
160 Ga0068860_100045870 3300005843 Bacteria 4168
161 Ga0068860_100196119 3300005843 Bacteria 1955
162 Ga0068860_100262923 3300005843 Bacteria 1682
163 Ga0068860_100286513 3300005843 Bacteria 1611
164 Ga0068860_100674934 3300005843 Bacteria 1042
165 Ga0068862_100042218 3300005844 Bacteria 3884
166 Ga0068862_100069807 3300005844 Bacteria 3033
167 Ga0068862_100408071 3300005844 Bacteria 1272
168 Ga0097621_100018843 3300006237 Bacteria 5283
169 Ga0097621_100116128 3300006237 Bacteria 2266
170 Ga0097621_100193836 3300006237 Unclassified 1761
171 Ga0068871_100014336 3300006358 Bacteria 5905
172 Ga0068871_100429837 3300006358 Unclassified 1180
173 Ga0068871_100635081 3300006358 Bacteria 974
174 Ga0068865_100084570 3300006881 Bacteria 2286
175 Ga0068865_100319926 3300006881 Unclassified 1247
176 Ga0068865_100587260 3300006881 Unclassified 940
177 Ga0097620_100000023 3300006931 Bacteria 221914
178 Ga0097620_100009583 3300006931 Bacteria 9780
179 Ga0097620_100032475 3300006931 Bacteria 5243
180 Ga0097620_100051365 3300006931 Bacteria 4144
181 Ga0097620_100237206 3300006931 Bacteria 1913
182 Ga0097620_100275619 3300006931 Bacteria 1774
183 Ga0097620_100932427 3300006931 Unclassified 952
184 Ga0105251_10076507 3300009011 Bacteria 1553
185 Ga0105240_10100691 3300009093 Bacteria 3516
186 Ga0105240_10126882 3300009093 Bacteria 3065
187 Ga0105247_10012562 3300009101 Bacteria 5087
188 Ga0105247_10161803 3300009101 Bacteria 1482
189 Ga0105243_10305542 3300009148 Bacteria 1443
190 Ga0105241_10003636 3300009174 Bacteria 11443
191 Ga0105241_10094242 3300009174 Bacteria 2368
192 Ga0105241_10175514 3300009174 Bacteria 1773
193 Ga0105241_10502235 3300009174 Bacteria 1082
194 Ga0105241_10680451 3300009174 Bacteria 937
195 Ga0105242_10040136 3300009176 Bacteria 3771
196 Ga0105242_10240374 3300009176 Unclassified 1627
197 Ga0105248_10698319 3300009177 Bacteria 1145
198 Ga0105237_10002490 3300009545 Bacteria 22826
199 Ga0105237_10008015 3300009545 Bacteria 11497
200 Ga0105249_10003768 3300009553 Bacteria 13084
201 Ga0105249_10043401 3300009553 Bacteria 4089
202 Ga0105249_10056871 3300009553 Bacteria 3582
203 Ga0105249_10095840 3300009553 Bacteria 2783
204 Ga0105249_10170736 3300009553 Bacteria 2108
205 Ga0105239_10165961 3300010375 Bacteria 2469
206 Ga0105239_10277519 3300010375 Bacteria 1886
207 Ga0105239_10389060 3300010375 Bacteria 1577
208 Ga0105239_11122919 3300010375 Bacteria 905
209 Ga0105246_10013049 3300011119 Bacteria 5199
210 Ga0105246_10030935 3300011119 Bacteria 3539
211 Ga0105246_10605882 3300011119 Bacteria 947
212 Ga0157373_10003214 3300013100 Bacteria 12356
213 Ga0157373_10010365 3300013100 Bacteria 6861
214 Ga0157371_10001525 3300013102 Bacteria 23896
215 Ga0157371_10007179 3300013102 Bacteria 9051
216 Ga0157371_10013861 3300013102 Bacteria 6107
217 Ga0157371_10080098 3300013102 Bacteria 2313
218 Ga0157371_10182665 3300013102 Bacteria 1500
219 Ga0157371_10604113 3300013102 Unclassified 816
220 Ga0157370_10043363 3300013104 Unclassified 4330
221 Ga0157370_10210171 3300013104 Bacteria 1803
222 Ga0157374_10005863 3300013296 Bacteria 10374
223 Ga0157374_10029588 3300013296 Bacteria 4962
224 Ga0157374_10211073 3300013296 Bacteria 1903
225 Ga0157374_10347145 3300013296 Bacteria 1474
226 Ga0157374_10846301 3300013296 Bacteria 931
227 Ga0157378_10006118 3300013297 Bacteria 10537
228 Ga0157378_10008930 3300013297 Bacteria 8725
229 Ga0157378_10140950 3300013297 Bacteria 2239
230 Ga0157378_10192120 3300013297 Bacteria 1926
231 Ga0157378_10205085 3300013297 Bacteria 1867
232 Ga0157378_10298813 3300013297 Unclassified 1557
233 Ga0163162_10000798 3300013306 Bacteria 29316
234 Ga0163162_10041859 3300013306 Bacteria 4583
235 Ga0163162_10058353 3300013306 Bacteria 3888
236 Ga0163162_10088913 3300013306 Bacteria 3169
237 Ga0163162_10290588 3300013306 Bacteria 1767
238 Ga0163162_10819694 3300013306 Bacteria 1047
239 Ga0163162_10909483 3300013306 Bacteria 993
240 Ga0157372_10050572 3300013307 Bacteria 4623
241 Ga0157372_10306183 3300013307 Bacteria 1849
242 Ga0157372_10769556 3300013307 Bacteria 1119
243 Ga0157375_10160367 3300013308 Unclassified 2390
244 Ga0157375_10287748 3300013308 Bacteria 1806
245 Ga0157375_10352945 3300013308 Bacteria 1636
246 Ga0157375_10357516 3300013308 Bacteria 1626
247 Ga0157375_10684350 3300013308 Bacteria 1180
248 Ga0163163_10000457 3300014325 Bacteria 37238
249 Ga0163163_10044180 3300014325 Bacteria 4370
250 Ga0163163_10052852 3300014325 Bacteria 4009
251 Ga0163163_10325190 3300014325 Bacteria 1592
252 Ga0163163_10479039 3300014325 Unclassified 1305
253 Ga0163163_10508638 3300014325 Unclassified 1266
254 Ga0163163_10516217 3300014325 Bacteria 1257
255 Ga0157380_10645220 3300014326 Bacteria 1055
256 Ga0157377_10003543 3300014745 Bacteria 7066
257 Ga0157377_10098707 3300014745 Bacteria 1736
258 Ga0157377_10336118 3300014745 Bacteria 1009
259 Ga0157377_10602734 3300014745 Bacteria 784
260 Ga0157379_10105531 3300014968 Bacteria 2529
261 Ga0157379_10429884 3300014968 Bacteria 1217
262 Ga0157376_10002968 3300014969 Bacteria 11631
263 Ga0157376_10179380 3300014969 Bacteria 1935
264 Ga0157376_10433214 3300014969 Unclassified 1278
265 Ga0163161_10005625 3300017792 Bacteria 8693
266 Ga0207697_10066068 3300025315 Bacteria 1510
267 Ga0207656_10031181 3300025321 Unclassified 2207
268 Ga0207656_10038955 3300025321 Bacteria 2008
269 Ga0207656_10298621 3300025321 Unclassified 797
270 Ga0207642_10337681 3300025899 Bacteria 885
271 Ga0207642_10376992 3300025899 Unclassified 843
272 Ga0207688_10011124 3300025901 Bacteria 4896
273 Ga0207680_10000053 3300025903 Bacteria 55149
274 Ga0207680_10041946 3300025903 Bacteria 2673
275 Ga0207647_10132119 3300025904 Bacteria 1467
276 Ga0207645_10000713 3300025907 Bacteria 27669
277 Ga0207645_10024429 3300025907 Bacteria 3918
278 Ga0207705_10032240 3300025909 Bacteria 3743
279 Ga0207705_10188288 3300025909 Bacteria 1559
280 Ga0207654_10068394 3300025911 Bacteria 2101
281 Ga0207695_10012215 3300025913 Bacteria 10314
282 Ga0207671_10011923 3300025914 Bacteria 7029
283 Ga0207671_10022167 3300025914 Bacteria 4806
284 Ga0207660_10016446 3300025917 Bacteria 4897
285 Ga0207662_10154665 3300025918 Bacteria 1461
286 Ga0207657_10074056 3300025919 Bacteria 2876
287 Ga0207657_10611932 3300025919 Bacteria 850
288 Ga0207649_10073283 3300025920 Bacteria 2193
289 Ga0207649_10317749 3300025920 Unclassified 1143
290 Ga0207649_10349219 3300025920 Bacteria 1094
291 Ga0207652_10000045 3300025921 Bacteria 125343
292 Ga0207652_10022706 3300025921 Bacteria 5195
293 Ga0207681_10109044 3300025923 Bacteria 2011
294 Ga0207681_10217849 3300025923 Bacteria 1475
295 Ga0207681_10456091 3300025923 Bacteria 1041
296 Ga0207681_10493027 3300025923 Bacteria 1002
297 Ga0207650_10115723 3300025925 Bacteria 2081
298 Ga0207650_10278261 3300025925 Bacteria 1362
299 Ga0207650_10365047 3300025925 Bacteria 1190
300 Ga0207659_10057168 3300025926 Bacteria 2796
301 Ga0207659_10130354 3300025926 Bacteria 1940
302 Ga0207659_10168604 3300025926 Bacteria 1725
303 Ga0207659_10529365 3300025926 Bacteria 1000
304 Ga0207644_10069571 3300025931 Bacteria 2570
305 Ga0207690_10378847 3300025932 Bacteria 1124
306 Ga0207706_10001885 3300025933 Bacteria 20569
307 Ga0207706_10070566 3300025933 Bacteria 3073
308 Ga0207706_10096610 3300025933 Bacteria 2598
309 Ga0207706_10642399 3300025933 Bacteria 909
310 Ga0207686_10037874 3300025934 Bacteria 2913
311 Ga0207670_10023950 3300025936 Bacteria 3808
312 Ga0207670_10104348 3300025936 Bacteria 2030
313 Ga0207669_10010987 3300025937 Bacteria 4384
314 Ga0207669_10474033 3300025937 Bacteria 996
315 Ga0207691_10092990 3300025940 Bacteria 2700
316 Ga0207691_10209697 3300025940 Bacteria 1693
317 Ga0207689_10004231 3300025942 Bacteria 13055
318 Ga0207689_10006306 3300025942 Bacteria 10506
319 Ga0207689_10008218 3300025942 Bacteria 9094
320 Ga0207689_10018291 3300025942 Bacteria 5914
321 Ga0207689_10026108 3300025942 Bacteria 4891
322 Ga0207689_10032751 3300025942 Bacteria 4321
323 Ga0207689_10039167 3300025942 Bacteria 3924
324 Ga0207689_10045837 3300025942 Bacteria 3615
325 Ga0207661_10072653 3300025944 Bacteria 2815
326 Ga0207661_10083702 3300025944 Bacteria 2640
327 Ga0207661_10151429 3300025944 Bacteria 2005
328 Ga0207661_10499820 3300025944 Bacteria 1111
329 Ga0207679_10001677 3300025945 Bacteria 13793
330 Ga0207679_10011282 3300025945 Bacteria 5779
331 Ga0207679_10090182 3300025945 Unclassified 2369
332 Ga0207679_10210856 3300025945 Bacteria 1629
333 Ga0207667_10053539 3300025949 Bacteria 4246
334 Ga0207667_10145479 3300025949 Bacteria 2440
335 Ga0207667_10322647 3300025949 Bacteria 1577
336 Ga0207651_10075315 3300025960 Bacteria 2408
337 Ga0207651_10107769 3300025960 Bacteria 2083
338 Ga0207651_10148701 3300025960 Bacteria 1820
339 Ga0207651_10180430 3300025960 Bacteria 1674
340 Ga0207651_10537534 3300025960 Bacteria 1015
341 Ga0207651_10693835 3300025960 Bacteria 896
342 Ga0207712_10001102 3300025961 Bacteria 18895
343 Ga0207712_10057325 3300025961 Bacteria 2748
344 Ga0207668_10328125 3300025972 Unclassified 1272
345 Ga0207668_10651153 3300025972 Bacteria 922
346 Ga0207640_10215699 3300025981 Bacteria 1465
347 Ga0207640_10426139 3300025981 Unclassified 1087
348 Ga0207640_10653724 3300025981 Unclassified 896
349 Ga0207658_10033227 3300025986 Bacteria 3679
350 Ga0207658_10096741 3300025986 Bacteria 2303
351 Ga0207658_10179026 3300025986 Bacteria 1753
352 Ga0207658_10183382 3300025986 Bacteria 1734
353 Ga0207658_10517879 3300025986 Unclassified 1064
354 Ga0207677_10006263 3300026023 Bacteria 6509
355 Ga0207677_10281571 3300026023 Bacteria 1365
356 Ga0207703_10017807 3300026035 Bacteria 5548
357 Ga0207703_10036338 3300026035 Bacteria 3921
358 Ga0207703_10300516 3300026035 Bacteria 1464
359 Ga0207703_10424889 3300026035 Bacteria 1237
360 Ga0207639_10063348 3300026041 Bacteria 2863
361 Ga0207639_10106058 3300026041 Bacteria 2280
362 Ga0207639_10341747 3300026041 Bacteria 1334
363 Ga0207678_10053667 3300026067 Bacteria 3473
364 Ga0207678_10491066 3300026067 Bacteria 1070
365 Ga0207708_10062674 3300026075 Bacteria 2840
366 Ga0207702_10083491 3300026078 Bacteria 2779
367 Ga0207641_10000202 3300026088 Bacteria 79668
368 Ga0207641_10021200 3300026088 Bacteria 5342
369 Ga0207641_10172561 3300026088 Bacteria 1975
370 Ga0207641_10214875 3300026088 Bacteria 1780
371 Ga0207648_10006817 3300026089 Bacteria 11319
372 Ga0207648_10082249 3300026089 Bacteria 2808
373 Ga0207648_10162731 3300026089 Bacteria 1971
374 Ga0207648_10277489 3300026089 Unclassified 1498
375 Ga0207648_10428514 3300026089 Bacteria 1202
376 Ga0207648_10438400 3300026089 Unclassified 1188
377 Ga0207676_10196680 3300026095 Bacteria 1778
378 Ga0207676_10214437 3300026095 Unclassified 1710
379 Ga0207676_10639615 3300026095 Bacteria 1025
380 Ga0207674_10007789 3300026116 Bacteria 12460
381 Ga0207674_10753315 3300026116 Bacteria 940
382 Ga0207675_100030578 3300026118 Bacteria 5017
383 Ga0207675_100040981 3300026118 Bacteria 4325
384 Ga0207675_100176410 3300026118 Bacteria 2045
385 Ga0207683_10008436 3300026121 Bacteria 8820
386 Ga0207683_10013033 3300026121 Bacteria 7095
387 Ga0207698_10003490 3300026142 Bacteria 9482
388 Ga0207698_10073227 3300026142 Bacteria 2727
389 Ga0207698_10109781 3300026142 Bacteria 2309
390 Ga0268266_10099028 3300028379 Bacteria 2566
391 Ga0268266_10110768 3300028379 Bacteria 2432
392 Ga0268266_10166767 3300028379 Bacteria 1996
393 Ga0268266_10288744 3300028379 Bacteria 1527
394 Ga0268265_10239184 3300028380 Bacteria 1601
395 Ga0268265_10435732 3300028380 Bacteria 1220
396 Ga0268264_10001699 3300028381 Bacteria 20272
397 Ga0268264_10001731 3300028381 Bacteria 20053
398 Ga0268264_10001913 3300028381 Bacteria 18815
399 Ga0268264_10069166 3300028381 Unclassified 2985
400 Ga0268264_10213012 3300028381 Bacteria 1774
401 Ga0268264_10436942 3300028381 Bacteria 1265
402 Ga0268264_10971662 3300028381 Unclassified 855
403 Ga0307517_10002335 3300028786 Bacteria 30606
404 Ga0307515_10000002 3300028794 Bacteria 1231751
405 Ga0307515_10000076 3300028794 Bacteria 228736
406 Ga0265327_10024764 3300031251 Bacteria 3515
407 Ga0307509_10091360 3300031507 Bacteria 3116
408 Ga0307509_10172463 3300031507 Bacteria 2040
409 Ga0307509_10431501 3300031507 Bacteria 1016
410 Ga0265313_10058156 3300031595 Bacteria 1823
411 Ga0307508_10003608 3300031616 Bacteria 15547
412 Ga0307516_10008501 3300031730 Bacteria 11601
413 Ga0307406_10626235 3300031901 Unclassified 890
414 Ga0307414_10170652 3300032004 Bacteria 1739
415 Ga0373955_0039844 3300035172 Bacteria 2510
416 Ga0373924_0007228 3300035410 Bacteria 4003
417 Ga0373935_0315737 3300035692 Unclassified 1108
418 Ga0373937_0005153 3300036401 Bacteria 11144
419 Ga0373925_0246234 3300037068 Unclassified 1433
420 Ga0395899_0555235 3300037312 Unclassified 737
421 Ga0395900_0012586 3300037418 Bacteria 8657
422 Ga0439446_0020183 3300042156 Bacteria 1876
423 Ga0451577_0003916 3300042876 Bacteria 16080
424 Ga0451577_0344357 3300042876 Bacteria 1352
425 Ga0453684_1529590 3300044712 Bacteria 687
426 Ga0495580_0465839 3300046472 Unclassified 847
427 Ga0495664_0399607 3300046477 Unclassified 825
428 Ga0495608_0223901 3300046511 Unclassified 1179
429 Ga0495618_0012660 3300046514 Bacteria 5125
430 Ga0495628_0116164 3300046516 Bacteria 2055
431 Ga0495630_0021010 3300046517 Bacteria 4819
432 Ga0495640_0517578 3300046533 Unclassified 725
433 Ga0495586_0048106 3300046535 Unclassified 2304
434 Ga0495645_0454828 3300046543 Unclassified 807
435 Ga0495668_0000367 3300046616 Bacteria 59531
436 Ga0495634_0062782 3300046642 Bacteria 2466
437 Ga0495635_0345549 3300046663 Unclassified 993
438 Ga0495658_0229443 3300046683 Bacteria 1164
439 Ga0495672_0153905 3300047320 Bacteria 1189
440 Ga0495676_0229168 3300047321 Bacteria 1277
441 Ga0495684_0271746 3300047471 Unclassified 1226
442 Ga0496101_0118021 3300048904 Bacteria 2004
443 Ga0496113_0577386 3300048916 Bacteria 901
444 Ga0501031_0008920 3300049568 Bacteria 6520
445 Ga0501032_0056211 3300049569 Bacteria 2646
446 Ga0501034_0034359 3300049571 Bacteria 5139
447 Ga0501034_0178981 3300049571 Bacteria 2086
448 Ga0501034_0287650 3300049571 Unclassified 1582
449 Ga0501034_0299467 3300049571 Bacteria 1545
450 Ga0501036_0031936 3300049572 Bacteria 4448
451 Ga0501036_0137029 3300049572 Bacteria 2066
452 Ga0501037_0037569 3300049573 Bacteria 3570
453 Ga0501037_0662685 3300049573 Bacteria 697
454 Ga0501038_0009237 3300049574 Bacteria 9047
455 Ga0501039_0083623 3300049575 Bacteria 2485
456 Ga0501043_0033806 3300049579 Bacteria 4023
457 Ga0501046_0074137 3300049580 Bacteria 2641
458 Ga0501046_0364890 3300049580 Bacteria 1047
459 Ga0501047_0054822 3300049581 Bacteria 3856
460 Ga0501047_0062801 3300049581 Bacteria 3583
461 Ga0501073_0169215 3300049589 Bacteria 1513
462 Ga0501075_0536586 3300049591 Bacteria 893
463 Ga0501225_0084361 3300049705 Unclassified 915
464 Ga0501035_0017194 3300049822 Bacteria 6666
465 Ga0501035_0048382 3300049822 Bacteria 3814
466 Ga0501044_0067496 3300049823 Bacteria 3644
467 Ga0495619_0216741 3300053085 Unclassified 1326
468 Ga0500553_107070 3300053101 Bacteria 1187
469 Ga0500628_127527 3300053129 Bacteria 696
470 Ga0500568_0000789 3300053139 Bacteria 22357
471 Ga0500588_0035688 3300053146 Bacteria 1465
472 Ga0500616_0061856 3300053153 Bacteria 1936

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053129 Ga0500628_127527 Ga0500628_127527_12_593 179
2 3300035172 Ga0373955_0039844 Ga0373955_0039844_1896_2498 182
3 3300049573 Ga0501037_0662685 Ga0501037_0662685_37_630 183
4 3300005719 Ga0068861_100096355 Ga0068861_1000963553 186
5 3300025918 Ga0207662_10154665 Ga0207662_101546652 186
6 3300025923 Ga0207681_10493027 Ga0207681_104930272 186
7 3300026118 Ga0207675_100040981 Ga0207675_1000409812 186
8 3300009176 Ga0105242_10240374 Ga0105242_102403742 187
9 3300010375 Ga0105239_10277519 Ga0105239_102775192 187
10 3300013102 Ga0157371_10604113 Ga0157371_106041131 187
11 3300013297 Ga0157378_10298813 Ga0157378_102988132 187
12 3300013306 Ga0163162_10058353 Ga0163162_100583532 187
13 3300014325 Ga0163163_10508638 Ga0163163_105086381 187
14 3300014968 Ga0157379_10105531 Ga0157379_101055312 187
15 3300014969 Ga0157376_10433214 Ga0157376_104332142 187
16 3300035410 Ga0373924_0007228 Ga0373924_0007228_2824_3441 187
17 3300036401 Ga0373937_0005153 Ga0373937_0005153_2156_2773 187
18 3300046472 Ga0495580_0465839 Ga0495580_0465839_41_658 187
19 3300046511 Ga0495608_0223901 Ga0495608_0223901_157_774 187
20 3300046514 Ga0495618_0012660 Ga0495618_0012660_3267_3884 187
21 3300046516 Ga0495628_0116164 Ga0495628_0116164_1336_1953 187
22 3300046517 Ga0495630_0021010 Ga0495630_0021010_2895_3512 187
23 3300046533 Ga0495640_0517578 Ga0495640_0517578_55_672 187
24 3300046535 Ga0495586_0048106 Ga0495586_0048106_645_1262 187
25 3300046543 Ga0495645_0454828 Ga0495645_0454828_15_632 187
26 3300046642 Ga0495634_0062782 Ga0495634_0062782_1747_2364 187
27 3300046663 Ga0495635_0345549 Ga0495635_0345549_59_676 187
28 3300047321 Ga0495676_0229168 Ga0495676_0229168_109_726 187
29 3300047471 Ga0495684_0271746 Ga0495684_0271746_561_1178 187
30 3300048904 Ga0496101_0118021 Ga0496101_0118021_820_1437 187
31 3300053085 Ga0495619_0216741 Ga0495619_0216741_94_711 187
32 3300003316 rootH1_10079318 rootH1_100793182 188
33 3300005563 Ga0068855_100106649 Ga0068855_1001066492 190
34 3300025949 Ga0207667_10145479 Ga0207667_101454792 190
35 3300032004 Ga0307414_10170652 Ga0307414_101706522 191
36 3300035692 Ga0373935_0315737 Ga0373935_0315737_282_911 191
37 3300049705 Ga0501225_0084361 Ga0501225_0084361_281_904 191
38 3300005547 Ga0070693_100503818 Ga0070693_1005038181 193
39 3300005366 Ga0070659_101024961 Ga0070659_1010249611 194
40 3300005457 Ga0070662_100911132 Ga0070662_1009111321 194
41 3300005618 Ga0068864_100004156 Ga0068864_10000415615 194
42 3300025960 Ga0207651_10537534 Ga0207651_105375342 194
43 3300053139 Ga0500568_0000789 Ga0500568_0000789_13017_13658 196
44 3300025933 Ga0207706_10096610 Ga0207706_100966102 198
45 3300005330 Ga0070690_100007549 Ga0070690_1000075495 199
46 3300005334 Ga0068869_100116093 Ga0068869_1001160932 199
47 3300005335 Ga0070666_10043723 Ga0070666_100437232 199
48 3300005338 Ga0068868_100009542 Ga0068868_1000095425 199
49 3300005344 Ga0070661_100262532 Ga0070661_1002625321 199
50 3300005356 Ga0070674_100093218 Ga0070674_1000932182 199
51 3300005367 Ga0070667_100014132 Ga0070667_1000141322 199
52 3300005438 Ga0070701_10118879 Ga0070701_101188792 199
53 3300005456 Ga0070678_100326121 Ga0070678_1003261212 199
54 3300005457 Ga0070662_100011578 Ga0070662_1000115781 199
55 3300005539 Ga0068853_100202466 Ga0068853_1002024662 199
56 3300005544 Ga0070686_100116157 Ga0070686_1001161571 199
57 3300005578 Ga0068854_100141627 Ga0068854_1001416272 199
58 3300005617 Ga0068859_100051366 Ga0068859_1000513663 199
59 3300005618 Ga0068864_100261178 Ga0068864_1002611783 199
60 3300005834 Ga0068851_10012087 Ga0068851_100120874 199
61 3300005842 Ga0068858_100138918 Ga0068858_1001389182 199
62 3300005843 Ga0068860_100674934 Ga0068860_1006749341 199
63 3300006358 Ga0068871_100429837 Ga0068871_1004298371 199
64 3300006881 Ga0068865_100587260 Ga0068865_1005872602 199
65 3300006931 Ga0097620_100051365 Ga0097620_1000513653 199
66 3300013296 Ga0157374_10005863 Ga0157374_100058632 199
67 3300013307 Ga0157372_10769556 Ga0157372_107695562 199
68 3300013308 Ga0157375_10160367 Ga0157375_101603672 199
69 3300017792 Ga0163161_10005625 Ga0163161_100056253 199
70 3300025321 Ga0207656_10031181 Ga0207656_100311811 199
71 3300025899 Ga0207642_10376992 Ga0207642_103769921 199
72 3300025933 Ga0207706_10001885 Ga0207706_1000188514 199
73 3300025934 Ga0207686_10037874 Ga0207686_100378742 199
74 3300025942 Ga0207689_10026108 Ga0207689_100261085 199
75 3300025945 Ga0207679_10090182 Ga0207679_100901822 199
76 3300025960 Ga0207651_10075315 Ga0207651_100753152 199
77 3300025981 Ga0207640_10426139 Ga0207640_104261392 199
78 3300026035 Ga0207703_10036338 Ga0207703_100363383 199
79 3300026088 Ga0207641_10214875 Ga0207641_102148753 199
80 3300026089 Ga0207648_10277489 Ga0207648_102774892 199
81 3300026121 Ga0207683_10013033 Ga0207683_100130336 199
82 3300028381 Ga0268264_10436942 Ga0268264_104369422 199
83 3300028794 Ga0307515_10000002 Ga0307515_10000002480 199
84 3300037068 Ga0373925_0246234 Ga0373925_0246234_91_744 199
85 3300042876 Ga0451577_0344357 Ga0451577_0344357_551_1192 199
86 3300046477 Ga0495664_0399607 Ga0495664_0399607_83_736 199
87 3300046683 Ga0495658_0229443 Ga0495658_0229443_87_740 199
88 3300047320 Ga0495672_0153905 Ga0495672_0153905_415_1071 199
89 3300009093 Ga0105240_10100691 Ga0105240_101006912 200
90 3300005834 Ga0068851_10080001 Ga0068851_100800012 201
91 3300031901 Ga0307406_10626235 Ga0307406_106262351 201
92 3300042156 Ga0439446_0020183 Ga0439446_0020183_1178_1858 201
93 3300046616 Ga0495668_0000367 Ga0495668_0000367_10715_11371 201
94 3300002459 JGI24751J29686_10000697 JGI24751J29686_100006972 202
95 3300005327 Ga0070658_10025676 Ga0070658_100256764 202
96 3300005327 Ga0070658_10062940 Ga0070658_100629402 202
97 3300005327 Ga0070658_10628469 Ga0070658_106284692 202
98 3300005329 Ga0070683_100000163 Ga0070683_10000016314 202
99 3300005329 Ga0070683_100102845 Ga0070683_1001028452 202
100 3300005330 Ga0070690_100055790 Ga0070690_1000557903 202
101 3300005331 Ga0070670_100008754 Ga0070670_1000087542 202
102 3300005331 Ga0070670_100321289 Ga0070670_1003212892 202
103 3300005334 Ga0068869_100077989 Ga0068869_1000779892 202
104 3300005334 Ga0068869_100362686 Ga0068869_1003626861 202
105 3300005336 Ga0070680_100044461 Ga0070680_1000444613 202
106 3300005337 Ga0070682_100243845 Ga0070682_1002438452 202
107 3300005337 Ga0070682_101022226 Ga0070682_1010222261 202
108 3300005338 Ga0068868_100181328 Ga0068868_1001813283 202
109 3300005339 Ga0070660_100042613 Ga0070660_1000426133 202
110 3300005344 Ga0070661_100013480 Ga0070661_1000134803 202
111 3300005344 Ga0070661_100365956 Ga0070661_1003659562 202
112 3300005354 Ga0070675_100151137 Ga0070675_1001511372 202
113 3300005365 Ga0070688_100066198 Ga0070688_1000661983 202
114 3300005455 Ga0070663_100626201 Ga0070663_1006262011 202
115 3300005459 Ga0068867_100005521 Ga0068867_1000055213 202
116 3300005530 Ga0070679_100001442 Ga0070679_10000144216 202
117 3300005530 Ga0070679_100003021 Ga0070679_1000030216 202
118 3300005530 Ga0070679_100267778 Ga0070679_1002677782 202
119 3300005535 Ga0070684_100017115 Ga0070684_1000171157 202
120 3300005535 Ga0070684_100064713 Ga0070684_1000647131 202
121 3300005539 Ga0068853_100002145 Ga0068853_1000021455 202
122 3300005539 Ga0068853_100047147 Ga0068853_1000471475 202
123 3300005539 Ga0068853_100085576 Ga0068853_1000855763 202
124 3300005543 Ga0070672_100684590 Ga0070672_1006845901 202
125 3300005543 Ga0070672_100986036 Ga0070672_1009860361 202
126 3300005563 Ga0068855_100316191 Ga0068855_1003161912 202
127 3300005564 Ga0070664_100003401 Ga0070664_10000340111 202
128 3300005564 Ga0070664_101189329 Ga0070664_1011893291 202
129 3300005577 Ga0068857_100041415 Ga0068857_1000414153 202
130 3300005577 Ga0068857_100861997 Ga0068857_1008619972 202
131 3300005578 Ga0068854_100094647 Ga0068854_1000946473 202
132 3300005578 Ga0068854_100477340 Ga0068854_1004773402 202
133 3300005614 Ga0068856_100032156 Ga0068856_1000321563 202
134 3300005616 Ga0068852_100015143 Ga0068852_1000151433 202
135 3300005616 Ga0068852_100173333 Ga0068852_1001733332 202
136 3300005616 Ga0068852_100279782 Ga0068852_1002797822 202
137 3300005617 Ga0068859_100032476 Ga0068859_1000324761 202
138 3300005617 Ga0068859_100275598 Ga0068859_1002755982 202
139 3300005834 Ga0068851_10204394 Ga0068851_102043942 202
140 3300005841 Ga0068863_100189682 Ga0068863_1001896821 202
141 3300005842 Ga0068858_100044704 Ga0068858_1000447042 202
142 3300005843 Ga0068860_100010290 Ga0068860_10001029012 202
143 3300005843 Ga0068860_100262923 Ga0068860_1002629232 202
144 3300005844 Ga0068862_100042218 Ga0068862_1000422182 202
145 3300005844 Ga0068862_100408071 Ga0068862_1004080711 202
146 3300006237 Ga0097621_100116128 Ga0097621_1001161283 202
147 3300006931 Ga0097620_100032475 Ga0097620_1000324751 202
148 3300006931 Ga0097620_100275619 Ga0097620_1002756192 202
149 3300009011 Ga0105251_10076507 Ga0105251_100765072 202
150 3300009093 Ga0105240_10126882 Ga0105240_101268823 202
151 3300009101 Ga0105247_10161803 Ga0105247_101618032 202
152 3300009174 Ga0105241_10175514 Ga0105241_101755142 202
153 3300009177 Ga0105248_10698319 Ga0105248_106983192 202
154 3300009553 Ga0105249_10043401 Ga0105249_100434012 202
155 3300009553 Ga0105249_10056871 Ga0105249_100568714 202
156 3300010375 Ga0105239_10389060 Ga0105239_103890601 202
157 3300010375 Ga0105239_11122919 Ga0105239_111229191 202
158 3300013100 Ga0157373_10003214 Ga0157373_100032147 202
159 3300013100 Ga0157373_10010365 Ga0157373_100103653 202
160 3300013102 Ga0157371_10001525 Ga0157371_1000152521 202
161 3300013102 Ga0157371_10007179 Ga0157371_1000717910 202
162 3300013102 Ga0157371_10013861 Ga0157371_100138615 202
163 3300013102 Ga0157371_10080098 Ga0157371_100800983 202
164 3300013102 Ga0157371_10182665 Ga0157371_101826652 202
165 3300013104 Ga0157370_10043363 Ga0157370_100433635 202
166 3300013104 Ga0157370_10210171 Ga0157370_102101712 202
167 3300013296 Ga0157374_10347145 Ga0157374_103471452 202
168 3300013297 Ga0157378_10205085 Ga0157378_102050852 202
169 3300013306 Ga0163162_10041859 Ga0163162_100418596 202
170 3300013306 Ga0163162_10909483 Ga0163162_109094831 202
171 3300013307 Ga0157372_10050572 Ga0157372_100505723 202
172 3300013307 Ga0157372_10306183 Ga0157372_103061831 202
173 3300013308 Ga0157375_10357516 Ga0157375_103575162 202
174 3300014325 Ga0163163_10044180 Ga0163163_100441803 202
175 3300014325 Ga0163163_10479039 Ga0163163_104790392 202
176 3300014325 Ga0163163_10516217 Ga0163163_105162171 202
177 3300014745 Ga0157377_10602734 Ga0157377_106027341 202
178 3300025909 Ga0207705_10032240 Ga0207705_100322404 202
179 3300025909 Ga0207705_10188288 Ga0207705_101882882 202
180 3300025911 Ga0207654_10068394 Ga0207654_100683942 202
181 3300025913 Ga0207695_10012215 Ga0207695_100122155 202
182 3300025917 Ga0207660_10016446 Ga0207660_100164463 202
183 3300025919 Ga0207657_10074056 Ga0207657_100740562 202
184 3300025920 Ga0207649_10317749 Ga0207649_103177492 202
185 3300025920 Ga0207649_10349219 Ga0207649_103492191 202
186 3300025921 Ga0207652_10000045 Ga0207652_1000004573 202
187 3300025921 Ga0207652_10022706 Ga0207652_100227063 202
188 3300025925 Ga0207650_10278261 Ga0207650_102782612 202
189 3300025925 Ga0207650_10365047 Ga0207650_103650472 202
190 3300025926 Ga0207659_10130354 Ga0207659_101303542 202
191 3300025932 Ga0207690_10378847 Ga0207690_103788472 202
192 3300025936 Ga0207670_10104348 Ga0207670_101043482 202
193 3300025942 Ga0207689_10006306 Ga0207689_100063062 202
194 3300025942 Ga0207689_10039167 Ga0207689_100391672 202
195 3300025944 Ga0207661_10072653 Ga0207661_100726532 202
196 3300025944 Ga0207661_10151429 Ga0207661_101514292 202
197 3300025944 Ga0207661_10499820 Ga0207661_104998202 202
198 3300025945 Ga0207679_10001677 Ga0207679_100016775 202
199 3300025945 Ga0207679_10210856 Ga0207679_102108561 202
200 3300025949 Ga0207667_10053539 Ga0207667_100535392 202
201 3300025949 Ga0207667_10322647 Ga0207667_103226471 202
202 3300025961 Ga0207712_10057325 Ga0207712_100573252 202
203 3300025972 Ga0207668_10651153 Ga0207668_106511531 202
204 3300025981 Ga0207640_10215699 Ga0207640_102156991 202
205 3300025981 Ga0207640_10653724 Ga0207640_106537241 202
206 3300026035 Ga0207703_10424889 Ga0207703_104248891 202
207 3300026041 Ga0207639_10063348 Ga0207639_100633482 202
208 3300026041 Ga0207639_10106058 Ga0207639_101060583 202
209 3300026041 Ga0207639_10341747 Ga0207639_103417472 202
210 3300026067 Ga0207678_10491066 Ga0207678_104910662 202
211 3300026078 Ga0207702_10083491 Ga0207702_100834912 202
212 3300026088 Ga0207641_10172561 Ga0207641_101725613 202
213 3300026095 Ga0207676_10214437 Ga0207676_102144371 202
214 3300026116 Ga0207674_10007789 Ga0207674_1000778911 202
215 3300026116 Ga0207674_10753315 Ga0207674_107533151 202
216 3300026142 Ga0207698_10003490 Ga0207698_100034905 202
217 3300028379 Ga0268266_10166767 Ga0268266_101667672 202
218 3300028380 Ga0268265_10435732 Ga0268265_104357321 202
219 3300028381 Ga0268264_10069166 Ga0268264_100691662 202
220 3300028381 Ga0268264_10971662 Ga0268264_109716621 202
221 3300031507 Ga0307509_10172463 Ga0307509_101724632 202
222 3300031507 Ga0307509_10431501 Ga0307509_104315012 202
223 3300037312 Ga0395899_0555235 Ga0395899_0555235_29_691 202
224 3300037418 Ga0395900_0012586 Ga0395900_0012586_803_1465 202
225 3300048916 Ga0496113_0577386 Ga0496113_0577386_192_869 202
226 3300049568 Ga0501031_0008920 Ga0501031_0008920_895_1560 202
227 3300049569 Ga0501032_0056211 Ga0501032_0056211_357_1022 202
228 3300049571 Ga0501034_0034359 Ga0501034_0034359_3041_3706 202
229 3300049571 Ga0501034_0178981 Ga0501034_0178981_257_919 202
230 3300049571 Ga0501034_0299467 Ga0501034_0299467_173_838 202
231 3300049572 Ga0501036_0031936 Ga0501036_0031936_2093_2758 202
232 3300049573 Ga0501037_0037569 Ga0501037_0037569_1949_2614 202
233 3300049574 Ga0501038_0009237 Ga0501038_0009237_3794_4459 202
234 3300049575 Ga0501039_0083623 Ga0501039_0083623_1731_2396 202
235 3300049579 Ga0501043_0033806 Ga0501043_0033806_2280_2945 202
236 3300049580 Ga0501046_0074137 Ga0501046_0074137_1632_2297 202
237 3300049581 Ga0501047_0054822 Ga0501047_0054822_1501_2166 202
238 3300049589 Ga0501073_0169215 Ga0501073_0169215_315_962 202
239 3300049591 Ga0501075_0536586 Ga0501075_0536586_114_779 202
240 3300049822 Ga0501035_0017194 Ga0501035_0017194_2847_3512 202
241 3300049823 Ga0501044_0067496 Ga0501044_0067496_1443_2108 202
242 3300053153 Ga0500616_0061856 Ga0500616_0061856_361_1017 202
243 3300005290 Ga0065712_10124090 Ga0065712_101240901 203
244 3300005327 Ga0070658_10175616 Ga0070658_101756162 203
245 3300005328 Ga0070676_10001325 Ga0070676_100013255 203
246 3300005328 Ga0070676_10039691 Ga0070676_100396913 203
247 3300005328 Ga0070676_10204941 Ga0070676_102049411 203
248 3300005331 Ga0070670_100081260 Ga0070670_1000812602 203
249 3300005334 Ga0068869_100002154 Ga0068869_1000021543 203
250 3300005334 Ga0068869_100076503 Ga0068869_1000765032 203
251 3300005334 Ga0068869_100102195 Ga0068869_1001021953 203
252 3300005335 Ga0070666_10000051 Ga0070666_1000005157 203
253 3300005338 Ga0068868_100022248 Ga0068868_1000222482 203
254 3300005338 Ga0068868_100066867 Ga0068868_1000668671 203
255 3300005338 Ga0068868_100219385 Ga0068868_1002193851 203
256 3300005338 Ga0068868_100238580 Ga0068868_1002385801 203
257 3300005340 Ga0070689_100411509 Ga0070689_1004115092 203
258 3300005340 Ga0070689_100783032 Ga0070689_1007830321 203
259 3300005347 Ga0070668_100130932 Ga0070668_1001309322 203
260 3300005347 Ga0070668_100217971 Ga0070668_1002179711 203
261 3300005347 Ga0070668_100781338 Ga0070668_1007813381 203
262 3300005353 Ga0070669_100149455 Ga0070669_1001494552 203
263 3300005353 Ga0070669_100241834 Ga0070669_1002418342 203
264 3300005354 Ga0070675_100645866 Ga0070675_1006458661 203
265 3300005355 Ga0070671_100070435 Ga0070671_1000704351 203
266 3300005356 Ga0070674_100007210 Ga0070674_1000072102 203
267 3300005364 Ga0070673_100052189 Ga0070673_1000521892 203
268 3300005364 Ga0070673_100076951 Ga0070673_1000769512 203
269 3300005364 Ga0070673_100113300 Ga0070673_1001133002 203
270 3300005364 Ga0070673_100393663 Ga0070673_1003936631 203
271 3300005364 Ga0070673_100419281 Ga0070673_1004192811 203
272 3300005365 Ga0070688_100559821 Ga0070688_1005598211 203
273 3300005367 Ga0070667_100133205 Ga0070667_1001332052 203
274 3300005367 Ga0070667_100204235 Ga0070667_1002042352 203
275 3300005367 Ga0070667_100243184 Ga0070667_1002431841 203
276 3300005438 Ga0070701_10181469 Ga0070701_101814692 203
277 3300005441 Ga0070700_100560312 Ga0070700_1005603121 203
278 3300005456 Ga0070678_100069233 Ga0070678_1000692332 203
279 3300005459 Ga0068867_100037474 Ga0068867_1000374742 203
280 3300005459 Ga0068867_100602426 Ga0068867_1006024262 203
281 3300005466 Ga0070685_10088388 Ga0070685_100883883 203
282 3300005544 Ga0070686_100038233 Ga0070686_1000382334 203
283 3300005547 Ga0070693_100266426 Ga0070693_1002664262 203
284 3300005548 Ga0070665_100359755 Ga0070665_1003597551 203
285 3300005548 Ga0070665_100783909 Ga0070665_1007839092 203
286 3300005548 Ga0070665_100885550 Ga0070665_1008855502 203
287 3300005578 Ga0068854_100701700 Ga0068854_1007017001 203
288 3300005615 Ga0070702_100005619 Ga0070702_1000056193 203
289 3300005616 Ga0068852_100003114 Ga0068852_1000031144 203
290 3300005616 Ga0068852_100256435 Ga0068852_1002564352 203
291 3300005617 Ga0068859_100000023 Ga0068859_100000023194 203
292 3300005617 Ga0068859_100009583 Ga0068859_1000095837 203
293 3300005617 Ga0068859_100237199 Ga0068859_1002371992 203
294 3300005618 Ga0068864_100108282 Ga0068864_1001082821 203
295 3300005719 Ga0068861_100017003 Ga0068861_1000170031 203
296 3300005719 Ga0068861_100448367 Ga0068861_1004483672 203
297 3300005834 Ga0068851_10047113 Ga0068851_100471133 203
298 3300005834 Ga0068851_10106571 Ga0068851_101065711 203
299 3300005834 Ga0068851_10382932 Ga0068851_103829321 203
300 3300005840 Ga0068870_10097830 Ga0068870_100978303 203
301 3300005841 Ga0068863_100008666 Ga0068863_1000086666 203
302 3300005841 Ga0068863_100010607 Ga0068863_1000106075 203
303 3300005842 Ga0068858_100066694 Ga0068858_1000666942 203
304 3300005843 Ga0068860_100000982 Ga0068860_1000009826 203
305 3300005843 Ga0068860_100002944 Ga0068860_1000029443 203
306 3300005843 Ga0068860_100045870 Ga0068860_1000458706 203
307 3300005843 Ga0068860_100196119 Ga0068860_1001961192 203
308 3300005844 Ga0068862_100069807 Ga0068862_1000698072 203
309 3300006237 Ga0097621_100018843 Ga0097621_1000188432 203
310 3300006237 Ga0097621_100193836 Ga0097621_1001938362 203
311 3300006358 Ga0068871_100014336 Ga0068871_1000143367 203
312 3300006358 Ga0068871_100635081 Ga0068871_1006350811 203
313 3300006881 Ga0068865_100084570 Ga0068865_1000845702 203
314 3300006881 Ga0068865_100319926 Ga0068865_1003199262 203
315 3300006931 Ga0097620_100000023 Ga0097620_100000023194 203
316 3300006931 Ga0097620_100009583 Ga0097620_1000095833 203
317 3300006931 Ga0097620_100237206 Ga0097620_1002372062 203
318 3300009101 Ga0105247_10012562 Ga0105247_100125624 203
319 3300009148 Ga0105243_10305542 Ga0105243_103055422 203
320 3300009174 Ga0105241_10003636 Ga0105241_100036363 203
321 3300009174 Ga0105241_10094242 Ga0105241_100942422 203
322 3300009174 Ga0105241_10502235 Ga0105241_105022352 203
323 3300009174 Ga0105241_10680451 Ga0105241_106804512 203
324 3300009176 Ga0105242_10040136 Ga0105242_100401365 203
325 3300009545 Ga0105237_10002490 Ga0105237_1000249022 203
326 3300009545 Ga0105237_10008015 Ga0105237_100080152 203
327 3300009553 Ga0105249_10003768 Ga0105249_100037683 203
328 3300009553 Ga0105249_10095840 Ga0105249_100958402 203
329 3300010375 Ga0105239_10165961 Ga0105239_101659612 203
330 3300011119 Ga0105246_10013049 Ga0105246_100130494 203
331 3300011119 Ga0105246_10030935 Ga0105246_100309354 203
332 3300011119 Ga0105246_10605882 Ga0105246_106058821 203
333 3300013296 Ga0157374_10211073 Ga0157374_102110732 203
334 3300013296 Ga0157374_10846301 Ga0157374_108463011 203
335 3300013297 Ga0157378_10006118 Ga0157378_100061182 203
336 3300013297 Ga0157378_10008930 Ga0157378_100089306 203
337 3300013297 Ga0157378_10140950 Ga0157378_101409501 203
338 3300013297 Ga0157378_10192120 Ga0157378_101921201 203
339 3300013306 Ga0163162_10000798 Ga0163162_1000079820 203
340 3300013306 Ga0163162_10088913 Ga0163162_100889134 203
341 3300013306 Ga0163162_10819694 Ga0163162_108196942 203
342 3300013308 Ga0157375_10287748 Ga0157375_102877482 203
343 3300013308 Ga0157375_10352945 Ga0157375_103529452 203
344 3300013308 Ga0157375_10684350 Ga0157375_106843502 203
345 3300014325 Ga0163163_10052852 Ga0163163_100528524 203
346 3300014325 Ga0163163_10325190 Ga0163163_103251901 203
347 3300014326 Ga0157380_10645220 Ga0157380_106452201 203
348 3300014745 Ga0157377_10003543 Ga0157377_100035435 203
349 3300014745 Ga0157377_10336118 Ga0157377_103361182 203
350 3300014968 Ga0157379_10429884 Ga0157379_104298842 203
351 3300014969 Ga0157376_10002968 Ga0157376_1000296810 203
352 3300025321 Ga0207656_10038955 Ga0207656_100389551 203
353 3300025321 Ga0207656_10298621 Ga0207656_102986211 203
354 3300025901 Ga0207688_10011124 Ga0207688_100111244 203
355 3300025903 Ga0207680_10000053 Ga0207680_1000005319 203
356 3300025903 Ga0207680_10041946 Ga0207680_100419463 203
357 3300025907 Ga0207645_10000713 Ga0207645_1000071317 203
358 3300025907 Ga0207645_10024429 Ga0207645_100244292 203
359 3300025914 Ga0207671_10011923 Ga0207671_100119235 203
360 3300025914 Ga0207671_10022167 Ga0207671_100221673 203
361 3300025919 Ga0207657_10611932 Ga0207657_106119321 203
362 3300025923 Ga0207681_10217849 Ga0207681_102178491 203
363 3300025923 Ga0207681_10456091 Ga0207681_104560912 203
364 3300025925 Ga0207650_10115723 Ga0207650_101157232 203
365 3300025926 Ga0207659_10168604 Ga0207659_101686041 203
366 3300025926 Ga0207659_10529365 Ga0207659_105293652 203
367 3300025931 Ga0207644_10069571 Ga0207644_100695712 203
368 3300025933 Ga0207706_10642399 Ga0207706_106423992 203
369 3300025937 Ga0207669_10010987 Ga0207669_100109873 203
370 3300025937 Ga0207669_10474033 Ga0207669_104740332 203
371 3300025940 Ga0207691_10209697 Ga0207691_102096972 203
372 3300025942 Ga0207689_10004231 Ga0207689_100042318 203
373 3300025942 Ga0207689_10008218 Ga0207689_100082188 203
374 3300025942 Ga0207689_10018291 Ga0207689_100182912 203
375 3300025942 Ga0207689_10032751 Ga0207689_100327512 203
376 3300025942 Ga0207689_10045837 Ga0207689_100458373 203
377 3300025960 Ga0207651_10107769 Ga0207651_101077692 203
378 3300025960 Ga0207651_10180430 Ga0207651_101804302 203
379 3300025960 Ga0207651_10693835 Ga0207651_106938351 203
380 3300025961 Ga0207712_10001102 Ga0207712_100011029 203
381 3300025972 Ga0207668_10328125 Ga0207668_103281252 203
382 3300025986 Ga0207658_10096741 Ga0207658_100967412 203
383 3300025986 Ga0207658_10179026 Ga0207658_101790261 203
384 3300025986 Ga0207658_10183382 Ga0207658_101833823 203
385 3300025986 Ga0207658_10517879 Ga0207658_105178792 203
386 3300026023 Ga0207677_10006263 Ga0207677_100062637 203
387 3300026023 Ga0207677_10281571 Ga0207677_102815712 203
388 3300026035 Ga0207703_10017807 Ga0207703_100178075 203
389 3300026035 Ga0207703_10300516 Ga0207703_103005162 203
390 3300026075 Ga0207708_10062674 Ga0207708_100626741 203
391 3300026088 Ga0207641_10000202 Ga0207641_1000020210 203
392 3300026088 Ga0207641_10021200 Ga0207641_100212002 203
393 3300026089 Ga0207648_10006817 Ga0207648_100068176 203
394 3300026089 Ga0207648_10162731 Ga0207648_101627312 203
395 3300026089 Ga0207648_10428514 Ga0207648_104285142 203
396 3300026089 Ga0207648_10438400 Ga0207648_104384001 203
397 3300026095 Ga0207676_10639615 Ga0207676_106396151 203
398 3300026118 Ga0207675_100030578 Ga0207675_1000305783 203
399 3300026118 Ga0207675_100176410 Ga0207675_1001764102 203
400 3300026121 Ga0207683_10008436 Ga0207683_100084366 203
401 3300026142 Ga0207698_10073227 Ga0207698_100732274 203
402 3300026142 Ga0207698_10109781 Ga0207698_101097812 203
403 3300028379 Ga0268266_10110768 Ga0268266_101107682 203
404 3300028379 Ga0268266_10288744 Ga0268266_102887442 203
405 3300028380 Ga0268265_10239184 Ga0268265_102391842 203
406 3300028381 Ga0268264_10001699 Ga0268264_1000169911 203
407 3300028381 Ga0268264_10001731 Ga0268264_1000173111 203
408 3300028381 Ga0268264_10001913 Ga0268264_1000191317 203
409 3300028381 Ga0268264_10213012 Ga0268264_102130121 203
410 3300028786 Ga0307517_10002335 Ga0307517_1000233521 203
411 3300028794 Ga0307515_10000076 Ga0307515_10000076206 203
412 3300031251 Ga0265327_10024764 Ga0265327_100247642 203
413 3300031507 Ga0307509_10091360 Ga0307509_100913604 203
414 3300031595 Ga0265313_10058156 Ga0265313_100581563 203
415 3300031616 Ga0307508_10003608 Ga0307508_1000360813 203
416 3300031730 Ga0307516_10008501 Ga0307516_100085019 203
417 3300049571 Ga0501034_0287650 Ga0501034_0287650_641_1312 203
418 3300049572 Ga0501036_0137029 Ga0501036_0137029_236_907 203
419 3300049580 Ga0501046_0364890 Ga0501046_0364890_44_715 203
420 3300049581 Ga0501047_0062801 Ga0501047_0062801_2359_3030 203
421 3300049822 Ga0501035_0048382 Ga0501035_0048382_207_878 203
422 3300053146 Ga0500588_0035688 Ga0500588_0035688_519_1178 203
423 2162886011 MRS1b_contig_1310824 MRS1b_0017.00001620 204
424 3300000043 ARcpr5yngRDRAFT_c005752 ARcpr5yngRDRAFT_0057522 204
425 3300005290 Ga0065712_10255476 Ga0065712_102554761 204
426 3300005328 Ga0070676_10165048 Ga0070676_101650482 204
427 3300005329 Ga0070683_100002968 Ga0070683_1000029688 204
428 3300005330 Ga0070690_100205100 Ga0070690_1002051002 204
429 3300005344 Ga0070661_100015221 Ga0070661_1000152214 204
430 3300005353 Ga0070669_100250908 Ga0070669_1002509082 204
431 3300005354 Ga0070675_100022391 Ga0070675_1000223913 204
432 3300005364 Ga0070673_100181985 Ga0070673_1001819852 204
433 3300005365 Ga0070688_100019508 Ga0070688_1000195082 204
434 3300005366 Ga0070659_100528695 Ga0070659_1005286951 204
435 3300005455 Ga0070663_100164210 Ga0070663_1001642102 204
436 3300005459 Ga0068867_100091448 Ga0068867_1000914482 204
437 3300005466 Ga0070685_10227720 Ga0070685_102277201 204
438 3300005535 Ga0070684_100021262 Ga0070684_1000212624 204
439 3300005543 Ga0070672_100224107 Ga0070672_1002241072 204
440 3300005548 Ga0070665_100292112 Ga0070665_1002921122 204
441 3300005617 Ga0068859_100932416 Ga0068859_1009324161 204
442 3300005618 Ga0068864_100002925 Ga0068864_1000029256 204
443 3300005719 Ga0068861_100787563 Ga0068861_1007875631 204
444 3300005841 Ga0068863_100312418 Ga0068863_1003124182 204
445 3300005843 Ga0068860_100286513 Ga0068860_1002865132 204
446 3300006931 Ga0097620_100932427 Ga0097620_1009324271 204
447 3300009553 Ga0105249_10170736 Ga0105249_101707363 204
448 3300013296 Ga0157374_10029588 Ga0157374_100295884 204
449 3300013306 Ga0163162_10290588 Ga0163162_102905882 204
450 3300014325 Ga0163163_10000457 Ga0163163_100004572 204
451 3300014745 Ga0157377_10098707 Ga0157377_100987072 204
452 3300014969 Ga0157376_10179380 Ga0157376_101793802 204
453 3300025315 Ga0207697_10066068 Ga0207697_100660682 204
454 3300025899 Ga0207642_10337681 Ga0207642_103376811 204
455 3300025904 Ga0207647_10132119 Ga0207647_101321192 204
456 3300025920 Ga0207649_10073283 Ga0207649_100732832 204
457 3300025923 Ga0207681_10109044 Ga0207681_101090442 204
458 3300025926 Ga0207659_10057168 Ga0207659_100571682 204
459 3300025933 Ga0207706_10070566 Ga0207706_100705662 204
460 3300025936 Ga0207670_10023950 Ga0207670_100239503 204
461 3300025940 Ga0207691_10092990 Ga0207691_100929902 204
462 3300025944 Ga0207661_10083702 Ga0207661_100837022 204
463 3300025945 Ga0207679_10011282 Ga0207679_100112825 204
464 3300025960 Ga0207651_10148701 Ga0207651_101487012 204
465 3300025986 Ga0207658_10033227 Ga0207658_100332274 204
466 3300026067 Ga0207678_10053667 Ga0207678_100536672 204
467 3300026089 Ga0207648_10082249 Ga0207648_100822493 204
468 3300026095 Ga0207676_10196680 Ga0207676_101966801 204
469 3300028379 Ga0268266_10099028 Ga0268266_100990282 204
470 3300042876 Ga0451577_0003916 Ga0451577_0003916_4329_5063 204
471 3300044712 Ga0453684_1529590 Ga0453684_1529590_18_674 204
472 3300053101 Ga0500553_107070 Ga0500553_107070_53_715 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03548

LolA

Outer membrane lipoprotein carrier protein LolA

73

240

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cgm-assembly2.cif.gz_B structure of the lipoprotein transporter lola from porphyromonas gingivalis 0.8547 27 204
4ki3-assembly3.cif.gz_I 1.70 angstrom resolution crystal structure of outer-membrane lipoprotein carrier protein (lola) from yersinia pestis co92 0.8067 31 204
8cgm-assembly2.cif.gz_B structure of the lipoprotein transporter lola from porphyromonas gingivalis 0.8006 27 204
4ki3-assembly3.cif.gz_G 1.70 angstrom resolution crystal structure of outer-membrane lipoprotein carrier protein (lola) from yersinia pestis co92 0.8 31 204
2zpd-assembly1.cif.gz_A crystal structure of the r43l mutant of lola in the open form 0.7998 32 202
ID Description Score Start End Superfamily
af_Q4DW43_4_102_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.8362 116 153 3.30.1520.10
af_Q55A08_605_716_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.8271 113 153 3.30.1520.10
4ki3G00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.8 31 204 2.50.20.10
af_Q8BX57_17_138_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.7796 113 151 3.30.1520.10
4ki3G00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7752 31 204 2.50.20.10
ID Description Score Start End GO Terms
AF-A0A6C0GPE3-F1-model_v4 Outer membrane lipoprotein carrier protein LolA 0.9223 29 204
AF-A0A5J4STK1-F1-model_v4 Outer-membrane lipoprotein carrier protein 0.916 29 204
AF-A0A3B9C6D0-F1-model_v4 Outer membrane lipoprotein carrier protein LolA 0.9108 22 204 GO:0016020
AF-R6E4K3-F1-model_v4 Outer membrane lipoprotein carrier protein LolA 0.9101 27 204
AF-A0A7C1AM22-F1-model_v4 Outer-membrane lipoprotein carrier protein 0.9043 28 204 GO:0042597
GO:0042953

Feature Viewer

pLDDT pTM Quality
89.4 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map