F450816
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 472 | 195 | 472 | 215 |
Family's Representative Sequence
| Representative Sequence | 3300025919|Ga0207657_10611932|Ga0207657_106119321 |
| Length | 253 |
| Sequence | MKPYLCPPEGNVGNDCLLLKAGHDPGLFYNKYSIMKRFLLTGFLMAAVALVIAQTANDPAAKKILDGVSAKFKTYKAVQVQFTLKVEDGKGKLQGSQKGTVYMKGNKYRVSLAGKDNKEMFSDGSTTWTYDKASSEVTIAKTDPSAKTITPQSLLTNFYDKDFLYKLNGEQKDGPRTLQEIEMTPTDKSKTFHKVYVYVDKAKQGIYSTKVLDKNGNKYTYTVNSLNGNAAINDQLFVFDKSKYPGVEEVDLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 139 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 140 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 141 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 142 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 143 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 144 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 145 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 146 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 147 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 149 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 150 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 153 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 154 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 155 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 156 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 157 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 174 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 175 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 188 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 192 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 193 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 194 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 195 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.06 |
| Nodule | 0 |
| Rhizoplane | 0.42 |
| Rhizosphere | 96.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_1310824 | 2162886011 | Bacteria | 1141 |
| 2 | ARcpr5yngRDRAFT_c005752 | 3300000043 | Unclassified | 1135 |
| 3 | JGI24751J29686_10000697 | 3300002459 | Bacteria | 8296 |
| 4 | rootH1_10079318 | 3300003316 | Bacteria | 2143 |
| 5 | Ga0065712_10124090 | 3300005290 | Bacteria | 1619 |
| 6 | Ga0065712_10255476 | 3300005290 | Bacteria | 941 |
| 7 | Ga0070658_10025676 | 3300005327 | Bacteria | 4721 |
| 8 | Ga0070658_10062940 | 3300005327 | Bacteria | 3024 |
| 9 | Ga0070658_10175616 | 3300005327 | Bacteria | 1801 |
| 10 | Ga0070658_10628469 | 3300005327 | Bacteria | 931 |
| 11 | Ga0070676_10001325 | 3300005328 | Bacteria | 12443 |
| 12 | Ga0070676_10039691 | 3300005328 | Bacteria | 2723 |
| 13 | Ga0070676_10165048 | 3300005328 | Bacteria | 1428 |
| 14 | Ga0070676_10204941 | 3300005328 | Bacteria | 1295 |
| 15 | Ga0070683_100000163 | 3300005329 | Bacteria | 43905 |
| 16 | Ga0070683_100002968 | 3300005329 | Bacteria | 13603 |
| 17 | Ga0070683_100102845 | 3300005329 | Bacteria | 2691 |
| 18 | Ga0070690_100007549 | 3300005330 | Bacteria | 6224 |
| 19 | Ga0070690_100055790 | 3300005330 | Bacteria | 2531 |
| 20 | Ga0070690_100205100 | 3300005330 | Bacteria | 1374 |
| 21 | Ga0070670_100008754 | 3300005331 | Bacteria | 8643 |
| 22 | Ga0070670_100081260 | 3300005331 | Bacteria | 2785 |
| 23 | Ga0070670_100321289 | 3300005331 | Bacteria | 1356 |
| 24 | Ga0068869_100002154 | 3300005334 | Bacteria | 11840 |
| 25 | Ga0068869_100076503 | 3300005334 | Bacteria | 2488 |
| 26 | Ga0068869_100077989 | 3300005334 | Bacteria | 2466 |
| 27 | Ga0068869_100102195 | 3300005334 | Unclassified | 2169 |
| 28 | Ga0068869_100116093 | 3300005334 | Unclassified | 2042 |
| 29 | Ga0068869_100362686 | 3300005334 | Bacteria | 1184 |
| 30 | Ga0070666_10000051 | 3300005335 | Bacteria | 99740 |
| 31 | Ga0070666_10043723 | 3300005335 | Bacteria | 3000 |
| 32 | Ga0070680_100044461 | 3300005336 | Bacteria | 3609 |
| 33 | Ga0070682_100243845 | 3300005337 | Bacteria | 1291 |
| 34 | Ga0070682_101022226 | 3300005337 | Unclassified | 687 |
| 35 | Ga0068868_100009542 | 3300005338 | Bacteria | 6993 |
| 36 | Ga0068868_100022248 | 3300005338 | Bacteria | 4783 |
| 37 | Ga0068868_100066867 | 3300005338 | Bacteria | 2859 |
| 38 | Ga0068868_100181328 | 3300005338 | Bacteria | 1747 |
| 39 | Ga0068868_100219385 | 3300005338 | Bacteria | 1591 |
| 40 | Ga0068868_100238580 | 3300005338 | Bacteria | 1527 |
| 41 | Ga0070660_100042613 | 3300005339 | Bacteria | 3465 |
| 42 | Ga0070689_100411509 | 3300005340 | Bacteria | 1145 |
| 43 | Ga0070689_100783032 | 3300005340 | Bacteria | 838 |
| 44 | Ga0070661_100013480 | 3300005344 | Bacteria | 5738 |
| 45 | Ga0070661_100015221 | 3300005344 | Bacteria | 5428 |
| 46 | Ga0070661_100262532 | 3300005344 | Unclassified | 1335 |
| 47 | Ga0070661_100365956 | 3300005344 | Bacteria | 1134 |
| 48 | Ga0070668_100130932 | 3300005347 | Bacteria | 2013 |
| 49 | Ga0070668_100217971 | 3300005347 | Bacteria | 1572 |
| 50 | Ga0070668_100781338 | 3300005347 | Bacteria | 847 |
| 51 | Ga0070669_100149455 | 3300005353 | Bacteria | 1807 |
| 52 | Ga0070669_100241834 | 3300005353 | Bacteria | 1434 |
| 53 | Ga0070669_100250908 | 3300005353 | Bacteria | 1409 |
| 54 | Ga0070675_100022391 | 3300005354 | Bacteria | 5050 |
| 55 | Ga0070675_100151137 | 3300005354 | Bacteria | 1991 |
| 56 | Ga0070675_100645866 | 3300005354 | Bacteria | 961 |
| 57 | Ga0070671_100070435 | 3300005355 | Bacteria | 2917 |
| 58 | Ga0070674_100007210 | 3300005356 | Bacteria | 6544 |
| 59 | Ga0070674_100093218 | 3300005356 | Unclassified | 2179 |
| 60 | Ga0070673_100052189 | 3300005364 | Bacteria | 3207 |
| 61 | Ga0070673_100076951 | 3300005364 | Bacteria | 2695 |
| 62 | Ga0070673_100113300 | 3300005364 | Bacteria | 2252 |
| 63 | Ga0070673_100181985 | 3300005364 | Bacteria | 1800 |
| 64 | Ga0070673_100393663 | 3300005364 | Bacteria | 1237 |
| 65 | Ga0070673_100419281 | 3300005364 | Bacteria | 1200 |
| 66 | Ga0070688_100019508 | 3300005365 | Bacteria | 3929 |
| 67 | Ga0070688_100066198 | 3300005365 | Bacteria | 2299 |
| 68 | Ga0070688_100559821 | 3300005365 | Bacteria | 870 |
| 69 | Ga0070659_100528695 | 3300005366 | Bacteria | 1008 |
| 70 | Ga0070659_101024961 | 3300005366 | Unclassified | 725 |
| 71 | Ga0070667_100014132 | 3300005367 | Bacteria | 6596 |
| 72 | Ga0070667_100133205 | 3300005367 | Bacteria | 2171 |
| 73 | Ga0070667_100204235 | 3300005367 | Bacteria | 1754 |
| 74 | Ga0070667_100243184 | 3300005367 | Bacteria | 1607 |
| 75 | Ga0070701_10118879 | 3300005438 | Bacteria | 1486 |
| 76 | Ga0070701_10181469 | 3300005438 | Bacteria | 1233 |
| 77 | Ga0070700_100560312 | 3300005441 | Bacteria | 889 |
| 78 | Ga0070663_100164210 | 3300005455 | Bacteria | 1711 |
| 79 | Ga0070663_100626201 | 3300005455 | Unclassified | 907 |
| 80 | Ga0070678_100069233 | 3300005456 | Bacteria | 2634 |
| 81 | Ga0070678_100326121 | 3300005456 | Unclassified | 1313 |
| 82 | Ga0070662_100011578 | 3300005457 | Bacteria | 5821 |
| 83 | Ga0070662_100911132 | 3300005457 | Unclassified | 750 |
| 84 | Ga0068867_100005521 | 3300005459 | Bacteria | 8952 |
| 85 | Ga0068867_100037474 | 3300005459 | Bacteria | 3524 |
| 86 | Ga0068867_100091448 | 3300005459 | Bacteria | 2310 |
| 87 | Ga0068867_100602426 | 3300005459 | Bacteria | 958 |
| 88 | Ga0070685_10088388 | 3300005466 | Bacteria | 1871 |
| 89 | Ga0070685_10227720 | 3300005466 | Bacteria | 1224 |
| 90 | Ga0070679_100001442 | 3300005530 | Bacteria | 21032 |
| 91 | Ga0070679_100003021 | 3300005530 | Bacteria | 15362 |
| 92 | Ga0070679_100267778 | 3300005530 | Bacteria | 1663 |
| 93 | Ga0070684_100017115 | 3300005535 | Bacteria | 5943 |
| 94 | Ga0070684_100021262 | 3300005535 | Bacteria | 5395 |
| 95 | Ga0070684_100064713 | 3300005535 | Bacteria | 3208 |
| 96 | Ga0068853_100002145 | 3300005539 | Bacteria | 14683 |
| 97 | Ga0068853_100047147 | 3300005539 | Bacteria | 3698 |
| 98 | Ga0068853_100085576 | 3300005539 | Bacteria | 2764 |
| 99 | Ga0068853_100202466 | 3300005539 | Unclassified | 1807 |
| 100 | Ga0070672_100224107 | 3300005543 | Bacteria | 1578 |
| 101 | Ga0070672_100684590 | 3300005543 | Bacteria | 897 |
| 102 | Ga0070672_100986036 | 3300005543 | Bacteria | 746 |
| 103 | Ga0070686_100038233 | 3300005544 | Bacteria | 2982 |
| 104 | Ga0070686_100116157 | 3300005544 | Bacteria | 1831 |
| 105 | Ga0070693_100266426 | 3300005547 | Bacteria | 1142 |
| 106 | Ga0070693_100503818 | 3300005547 | Bacteria | 859 |
| 107 | Ga0070665_100292112 | 3300005548 | Bacteria | 1632 |
| 108 | Ga0070665_100359755 | 3300005548 | Bacteria | 1461 |
| 109 | Ga0070665_100783909 | 3300005548 | Bacteria | 966 |
| 110 | Ga0070665_100885550 | 3300005548 | Bacteria | 905 |
| 111 | Ga0068855_100106649 | 3300005563 | Bacteria | 3219 |
| 112 | Ga0068855_100316191 | 3300005563 | Bacteria | 1727 |
| 113 | Ga0070664_100003401 | 3300005564 | Bacteria | 12846 |
| 114 | Ga0070664_101189329 | 3300005564 | Bacteria | 719 |
| 115 | Ga0068857_100041415 | 3300005577 | Bacteria | 4085 |
| 116 | Ga0068857_100861997 | 3300005577 | Bacteria | 867 |
| 117 | Ga0068854_100094647 | 3300005578 | Bacteria | 2228 |
| 118 | Ga0068854_100141627 | 3300005578 | Unclassified | 1846 |
| 119 | Ga0068854_100477340 | 3300005578 | Unclassified | 1046 |
| 120 | Ga0068854_100701700 | 3300005578 | Bacteria | 873 |
| 121 | Ga0068856_100032156 | 3300005614 | Bacteria | 5136 |
| 122 | Ga0070702_100005619 | 3300005615 | Bacteria | 5863 |
| 123 | Ga0068852_100003114 | 3300005616 | Bacteria | 11552 |
| 124 | Ga0068852_100015143 | 3300005616 | Bacteria | 5968 |
| 125 | Ga0068852_100173333 | 3300005616 | Bacteria | 2024 |
| 126 | Ga0068852_100256435 | 3300005616 | Bacteria | 1677 |
| 127 | Ga0068852_100279782 | 3300005616 | Bacteria | 1608 |
| 128 | Ga0068859_100000023 | 3300005617 | Bacteria | 221914 |
| 129 | Ga0068859_100009583 | 3300005617 | Bacteria | 9780 |
| 130 | Ga0068859_100032476 | 3300005617 | Bacteria | 5243 |
| 131 | Ga0068859_100051366 | 3300005617 | Bacteria | 4144 |
| 132 | Ga0068859_100237199 | 3300005617 | Bacteria | 1913 |
| 133 | Ga0068859_100275598 | 3300005617 | Bacteria | 1774 |
| 134 | Ga0068859_100932416 | 3300005617 | Unclassified | 952 |
| 135 | Ga0068864_100002925 | 3300005618 | Bacteria | 14126 |
| 136 | Ga0068864_100004156 | 3300005618 | Bacteria | 11886 |
| 137 | Ga0068864_100108282 | 3300005618 | Bacteria | 2473 |
| 138 | Ga0068864_100261178 | 3300005618 | Bacteria | 1611 |
| 139 | Ga0068861_100017003 | 3300005719 | Bacteria | 5158 |
| 140 | Ga0068861_100096355 | 3300005719 | Bacteria | 2344 |
| 141 | Ga0068861_100448367 | 3300005719 | Bacteria | 1156 |
| 142 | Ga0068861_100787563 | 3300005719 | Unclassified | 891 |
| 143 | Ga0068851_10012087 | 3300005834 | Bacteria | 4064 |
| 144 | Ga0068851_10047113 | 3300005834 | Bacteria | 2182 |
| 145 | Ga0068851_10080001 | 3300005834 | Bacteria | 1705 |
| 146 | Ga0068851_10106571 | 3300005834 | Bacteria | 1492 |
| 147 | Ga0068851_10204394 | 3300005834 | Bacteria | 1104 |
| 148 | Ga0068851_10382932 | 3300005834 | Unclassified | 824 |
| 149 | Ga0068870_10097830 | 3300005840 | Bacteria | 1652 |
| 150 | Ga0068863_100008666 | 3300005841 | Bacteria | 9940 |
| 151 | Ga0068863_100010607 | 3300005841 | Bacteria | 8944 |
| 152 | Ga0068863_100189682 | 3300005841 | Bacteria | 1975 |
| 153 | Ga0068863_100312418 | 3300005841 | Unclassified | 1526 |
| 154 | Ga0068858_100044704 | 3300005842 | Bacteria | 4105 |
| 155 | Ga0068858_100066694 | 3300005842 | Bacteria | 3333 |
| 156 | Ga0068858_100138918 | 3300005842 | Unclassified | 2281 |
| 157 | Ga0068860_100000982 | 3300005843 | Bacteria | 31595 |
| 158 | Ga0068860_100002944 | 3300005843 | Bacteria | 17607 |
| 159 | Ga0068860_100010290 | 3300005843 | Bacteria | 9252 |
| 160 | Ga0068860_100045870 | 3300005843 | Bacteria | 4168 |
| 161 | Ga0068860_100196119 | 3300005843 | Bacteria | 1955 |
| 162 | Ga0068860_100262923 | 3300005843 | Bacteria | 1682 |
| 163 | Ga0068860_100286513 | 3300005843 | Bacteria | 1611 |
| 164 | Ga0068860_100674934 | 3300005843 | Bacteria | 1042 |
| 165 | Ga0068862_100042218 | 3300005844 | Bacteria | 3884 |
| 166 | Ga0068862_100069807 | 3300005844 | Bacteria | 3033 |
| 167 | Ga0068862_100408071 | 3300005844 | Bacteria | 1272 |
| 168 | Ga0097621_100018843 | 3300006237 | Bacteria | 5283 |
| 169 | Ga0097621_100116128 | 3300006237 | Bacteria | 2266 |
| 170 | Ga0097621_100193836 | 3300006237 | Unclassified | 1761 |
| 171 | Ga0068871_100014336 | 3300006358 | Bacteria | 5905 |
| 172 | Ga0068871_100429837 | 3300006358 | Unclassified | 1180 |
| 173 | Ga0068871_100635081 | 3300006358 | Bacteria | 974 |
| 174 | Ga0068865_100084570 | 3300006881 | Bacteria | 2286 |
| 175 | Ga0068865_100319926 | 3300006881 | Unclassified | 1247 |
| 176 | Ga0068865_100587260 | 3300006881 | Unclassified | 940 |
| 177 | Ga0097620_100000023 | 3300006931 | Bacteria | 221914 |
| 178 | Ga0097620_100009583 | 3300006931 | Bacteria | 9780 |
| 179 | Ga0097620_100032475 | 3300006931 | Bacteria | 5243 |
| 180 | Ga0097620_100051365 | 3300006931 | Bacteria | 4144 |
| 181 | Ga0097620_100237206 | 3300006931 | Bacteria | 1913 |
| 182 | Ga0097620_100275619 | 3300006931 | Bacteria | 1774 |
| 183 | Ga0097620_100932427 | 3300006931 | Unclassified | 952 |
| 184 | Ga0105251_10076507 | 3300009011 | Bacteria | 1553 |
| 185 | Ga0105240_10100691 | 3300009093 | Bacteria | 3516 |
| 186 | Ga0105240_10126882 | 3300009093 | Bacteria | 3065 |
| 187 | Ga0105247_10012562 | 3300009101 | Bacteria | 5087 |
| 188 | Ga0105247_10161803 | 3300009101 | Bacteria | 1482 |
| 189 | Ga0105243_10305542 | 3300009148 | Bacteria | 1443 |
| 190 | Ga0105241_10003636 | 3300009174 | Bacteria | 11443 |
| 191 | Ga0105241_10094242 | 3300009174 | Bacteria | 2368 |
| 192 | Ga0105241_10175514 | 3300009174 | Bacteria | 1773 |
| 193 | Ga0105241_10502235 | 3300009174 | Bacteria | 1082 |
| 194 | Ga0105241_10680451 | 3300009174 | Bacteria | 937 |
| 195 | Ga0105242_10040136 | 3300009176 | Bacteria | 3771 |
| 196 | Ga0105242_10240374 | 3300009176 | Unclassified | 1627 |
| 197 | Ga0105248_10698319 | 3300009177 | Bacteria | 1145 |
| 198 | Ga0105237_10002490 | 3300009545 | Bacteria | 22826 |
| 199 | Ga0105237_10008015 | 3300009545 | Bacteria | 11497 |
| 200 | Ga0105249_10003768 | 3300009553 | Bacteria | 13084 |
| 201 | Ga0105249_10043401 | 3300009553 | Bacteria | 4089 |
| 202 | Ga0105249_10056871 | 3300009553 | Bacteria | 3582 |
| 203 | Ga0105249_10095840 | 3300009553 | Bacteria | 2783 |
| 204 | Ga0105249_10170736 | 3300009553 | Bacteria | 2108 |
| 205 | Ga0105239_10165961 | 3300010375 | Bacteria | 2469 |
| 206 | Ga0105239_10277519 | 3300010375 | Bacteria | 1886 |
| 207 | Ga0105239_10389060 | 3300010375 | Bacteria | 1577 |
| 208 | Ga0105239_11122919 | 3300010375 | Bacteria | 905 |
| 209 | Ga0105246_10013049 | 3300011119 | Bacteria | 5199 |
| 210 | Ga0105246_10030935 | 3300011119 | Bacteria | 3539 |
| 211 | Ga0105246_10605882 | 3300011119 | Bacteria | 947 |
| 212 | Ga0157373_10003214 | 3300013100 | Bacteria | 12356 |
| 213 | Ga0157373_10010365 | 3300013100 | Bacteria | 6861 |
| 214 | Ga0157371_10001525 | 3300013102 | Bacteria | 23896 |
| 215 | Ga0157371_10007179 | 3300013102 | Bacteria | 9051 |
| 216 | Ga0157371_10013861 | 3300013102 | Bacteria | 6107 |
| 217 | Ga0157371_10080098 | 3300013102 | Bacteria | 2313 |
| 218 | Ga0157371_10182665 | 3300013102 | Bacteria | 1500 |
| 219 | Ga0157371_10604113 | 3300013102 | Unclassified | 816 |
| 220 | Ga0157370_10043363 | 3300013104 | Unclassified | 4330 |
| 221 | Ga0157370_10210171 | 3300013104 | Bacteria | 1803 |
| 222 | Ga0157374_10005863 | 3300013296 | Bacteria | 10374 |
| 223 | Ga0157374_10029588 | 3300013296 | Bacteria | 4962 |
| 224 | Ga0157374_10211073 | 3300013296 | Bacteria | 1903 |
| 225 | Ga0157374_10347145 | 3300013296 | Bacteria | 1474 |
| 226 | Ga0157374_10846301 | 3300013296 | Bacteria | 931 |
| 227 | Ga0157378_10006118 | 3300013297 | Bacteria | 10537 |
| 228 | Ga0157378_10008930 | 3300013297 | Bacteria | 8725 |
| 229 | Ga0157378_10140950 | 3300013297 | Bacteria | 2239 |
| 230 | Ga0157378_10192120 | 3300013297 | Bacteria | 1926 |
| 231 | Ga0157378_10205085 | 3300013297 | Bacteria | 1867 |
| 232 | Ga0157378_10298813 | 3300013297 | Unclassified | 1557 |
| 233 | Ga0163162_10000798 | 3300013306 | Bacteria | 29316 |
| 234 | Ga0163162_10041859 | 3300013306 | Bacteria | 4583 |
| 235 | Ga0163162_10058353 | 3300013306 | Bacteria | 3888 |
| 236 | Ga0163162_10088913 | 3300013306 | Bacteria | 3169 |
| 237 | Ga0163162_10290588 | 3300013306 | Bacteria | 1767 |
| 238 | Ga0163162_10819694 | 3300013306 | Bacteria | 1047 |
| 239 | Ga0163162_10909483 | 3300013306 | Bacteria | 993 |
| 240 | Ga0157372_10050572 | 3300013307 | Bacteria | 4623 |
| 241 | Ga0157372_10306183 | 3300013307 | Bacteria | 1849 |
| 242 | Ga0157372_10769556 | 3300013307 | Bacteria | 1119 |
| 243 | Ga0157375_10160367 | 3300013308 | Unclassified | 2390 |
| 244 | Ga0157375_10287748 | 3300013308 | Bacteria | 1806 |
| 245 | Ga0157375_10352945 | 3300013308 | Bacteria | 1636 |
| 246 | Ga0157375_10357516 | 3300013308 | Bacteria | 1626 |
| 247 | Ga0157375_10684350 | 3300013308 | Bacteria | 1180 |
| 248 | Ga0163163_10000457 | 3300014325 | Bacteria | 37238 |
| 249 | Ga0163163_10044180 | 3300014325 | Bacteria | 4370 |
| 250 | Ga0163163_10052852 | 3300014325 | Bacteria | 4009 |
| 251 | Ga0163163_10325190 | 3300014325 | Bacteria | 1592 |
| 252 | Ga0163163_10479039 | 3300014325 | Unclassified | 1305 |
| 253 | Ga0163163_10508638 | 3300014325 | Unclassified | 1266 |
| 254 | Ga0163163_10516217 | 3300014325 | Bacteria | 1257 |
| 255 | Ga0157380_10645220 | 3300014326 | Bacteria | 1055 |
| 256 | Ga0157377_10003543 | 3300014745 | Bacteria | 7066 |
| 257 | Ga0157377_10098707 | 3300014745 | Bacteria | 1736 |
| 258 | Ga0157377_10336118 | 3300014745 | Bacteria | 1009 |
| 259 | Ga0157377_10602734 | 3300014745 | Bacteria | 784 |
| 260 | Ga0157379_10105531 | 3300014968 | Bacteria | 2529 |
| 261 | Ga0157379_10429884 | 3300014968 | Bacteria | 1217 |
| 262 | Ga0157376_10002968 | 3300014969 | Bacteria | 11631 |
| 263 | Ga0157376_10179380 | 3300014969 | Bacteria | 1935 |
| 264 | Ga0157376_10433214 | 3300014969 | Unclassified | 1278 |
| 265 | Ga0163161_10005625 | 3300017792 | Bacteria | 8693 |
| 266 | Ga0207697_10066068 | 3300025315 | Bacteria | 1510 |
| 267 | Ga0207656_10031181 | 3300025321 | Unclassified | 2207 |
| 268 | Ga0207656_10038955 | 3300025321 | Bacteria | 2008 |
| 269 | Ga0207656_10298621 | 3300025321 | Unclassified | 797 |
| 270 | Ga0207642_10337681 | 3300025899 | Bacteria | 885 |
| 271 | Ga0207642_10376992 | 3300025899 | Unclassified | 843 |
| 272 | Ga0207688_10011124 | 3300025901 | Bacteria | 4896 |
| 273 | Ga0207680_10000053 | 3300025903 | Bacteria | 55149 |
| 274 | Ga0207680_10041946 | 3300025903 | Bacteria | 2673 |
| 275 | Ga0207647_10132119 | 3300025904 | Bacteria | 1467 |
| 276 | Ga0207645_10000713 | 3300025907 | Bacteria | 27669 |
| 277 | Ga0207645_10024429 | 3300025907 | Bacteria | 3918 |
| 278 | Ga0207705_10032240 | 3300025909 | Bacteria | 3743 |
| 279 | Ga0207705_10188288 | 3300025909 | Bacteria | 1559 |
| 280 | Ga0207654_10068394 | 3300025911 | Bacteria | 2101 |
| 281 | Ga0207695_10012215 | 3300025913 | Bacteria | 10314 |
| 282 | Ga0207671_10011923 | 3300025914 | Bacteria | 7029 |
| 283 | Ga0207671_10022167 | 3300025914 | Bacteria | 4806 |
| 284 | Ga0207660_10016446 | 3300025917 | Bacteria | 4897 |
| 285 | Ga0207662_10154665 | 3300025918 | Bacteria | 1461 |
| 286 | Ga0207657_10074056 | 3300025919 | Bacteria | 2876 |
| 287 | Ga0207657_10611932 | 3300025919 | Bacteria | 850 |
| 288 | Ga0207649_10073283 | 3300025920 | Bacteria | 2193 |
| 289 | Ga0207649_10317749 | 3300025920 | Unclassified | 1143 |
| 290 | Ga0207649_10349219 | 3300025920 | Bacteria | 1094 |
| 291 | Ga0207652_10000045 | 3300025921 | Bacteria | 125343 |
| 292 | Ga0207652_10022706 | 3300025921 | Bacteria | 5195 |
| 293 | Ga0207681_10109044 | 3300025923 | Bacteria | 2011 |
| 294 | Ga0207681_10217849 | 3300025923 | Bacteria | 1475 |
| 295 | Ga0207681_10456091 | 3300025923 | Bacteria | 1041 |
| 296 | Ga0207681_10493027 | 3300025923 | Bacteria | 1002 |
| 297 | Ga0207650_10115723 | 3300025925 | Bacteria | 2081 |
| 298 | Ga0207650_10278261 | 3300025925 | Bacteria | 1362 |
| 299 | Ga0207650_10365047 | 3300025925 | Bacteria | 1190 |
| 300 | Ga0207659_10057168 | 3300025926 | Bacteria | 2796 |
| 301 | Ga0207659_10130354 | 3300025926 | Bacteria | 1940 |
| 302 | Ga0207659_10168604 | 3300025926 | Bacteria | 1725 |
| 303 | Ga0207659_10529365 | 3300025926 | Bacteria | 1000 |
| 304 | Ga0207644_10069571 | 3300025931 | Bacteria | 2570 |
| 305 | Ga0207690_10378847 | 3300025932 | Bacteria | 1124 |
| 306 | Ga0207706_10001885 | 3300025933 | Bacteria | 20569 |
| 307 | Ga0207706_10070566 | 3300025933 | Bacteria | 3073 |
| 308 | Ga0207706_10096610 | 3300025933 | Bacteria | 2598 |
| 309 | Ga0207706_10642399 | 3300025933 | Bacteria | 909 |
| 310 | Ga0207686_10037874 | 3300025934 | Bacteria | 2913 |
| 311 | Ga0207670_10023950 | 3300025936 | Bacteria | 3808 |
| 312 | Ga0207670_10104348 | 3300025936 | Bacteria | 2030 |
| 313 | Ga0207669_10010987 | 3300025937 | Bacteria | 4384 |
| 314 | Ga0207669_10474033 | 3300025937 | Bacteria | 996 |
| 315 | Ga0207691_10092990 | 3300025940 | Bacteria | 2700 |
| 316 | Ga0207691_10209697 | 3300025940 | Bacteria | 1693 |
| 317 | Ga0207689_10004231 | 3300025942 | Bacteria | 13055 |
| 318 | Ga0207689_10006306 | 3300025942 | Bacteria | 10506 |
| 319 | Ga0207689_10008218 | 3300025942 | Bacteria | 9094 |
| 320 | Ga0207689_10018291 | 3300025942 | Bacteria | 5914 |
| 321 | Ga0207689_10026108 | 3300025942 | Bacteria | 4891 |
| 322 | Ga0207689_10032751 | 3300025942 | Bacteria | 4321 |
| 323 | Ga0207689_10039167 | 3300025942 | Bacteria | 3924 |
| 324 | Ga0207689_10045837 | 3300025942 | Bacteria | 3615 |
| 325 | Ga0207661_10072653 | 3300025944 | Bacteria | 2815 |
| 326 | Ga0207661_10083702 | 3300025944 | Bacteria | 2640 |
| 327 | Ga0207661_10151429 | 3300025944 | Bacteria | 2005 |
| 328 | Ga0207661_10499820 | 3300025944 | Bacteria | 1111 |
| 329 | Ga0207679_10001677 | 3300025945 | Bacteria | 13793 |
| 330 | Ga0207679_10011282 | 3300025945 | Bacteria | 5779 |
| 331 | Ga0207679_10090182 | 3300025945 | Unclassified | 2369 |
| 332 | Ga0207679_10210856 | 3300025945 | Bacteria | 1629 |
| 333 | Ga0207667_10053539 | 3300025949 | Bacteria | 4246 |
| 334 | Ga0207667_10145479 | 3300025949 | Bacteria | 2440 |
| 335 | Ga0207667_10322647 | 3300025949 | Bacteria | 1577 |
| 336 | Ga0207651_10075315 | 3300025960 | Bacteria | 2408 |
| 337 | Ga0207651_10107769 | 3300025960 | Bacteria | 2083 |
| 338 | Ga0207651_10148701 | 3300025960 | Bacteria | 1820 |
| 339 | Ga0207651_10180430 | 3300025960 | Bacteria | 1674 |
| 340 | Ga0207651_10537534 | 3300025960 | Bacteria | 1015 |
| 341 | Ga0207651_10693835 | 3300025960 | Bacteria | 896 |
| 342 | Ga0207712_10001102 | 3300025961 | Bacteria | 18895 |
| 343 | Ga0207712_10057325 | 3300025961 | Bacteria | 2748 |
| 344 | Ga0207668_10328125 | 3300025972 | Unclassified | 1272 |
| 345 | Ga0207668_10651153 | 3300025972 | Bacteria | 922 |
| 346 | Ga0207640_10215699 | 3300025981 | Bacteria | 1465 |
| 347 | Ga0207640_10426139 | 3300025981 | Unclassified | 1087 |
| 348 | Ga0207640_10653724 | 3300025981 | Unclassified | 896 |
| 349 | Ga0207658_10033227 | 3300025986 | Bacteria | 3679 |
| 350 | Ga0207658_10096741 | 3300025986 | Bacteria | 2303 |
| 351 | Ga0207658_10179026 | 3300025986 | Bacteria | 1753 |
| 352 | Ga0207658_10183382 | 3300025986 | Bacteria | 1734 |
| 353 | Ga0207658_10517879 | 3300025986 | Unclassified | 1064 |
| 354 | Ga0207677_10006263 | 3300026023 | Bacteria | 6509 |
| 355 | Ga0207677_10281571 | 3300026023 | Bacteria | 1365 |
| 356 | Ga0207703_10017807 | 3300026035 | Bacteria | 5548 |
| 357 | Ga0207703_10036338 | 3300026035 | Bacteria | 3921 |
| 358 | Ga0207703_10300516 | 3300026035 | Bacteria | 1464 |
| 359 | Ga0207703_10424889 | 3300026035 | Bacteria | 1237 |
| 360 | Ga0207639_10063348 | 3300026041 | Bacteria | 2863 |
| 361 | Ga0207639_10106058 | 3300026041 | Bacteria | 2280 |
| 362 | Ga0207639_10341747 | 3300026041 | Bacteria | 1334 |
| 363 | Ga0207678_10053667 | 3300026067 | Bacteria | 3473 |
| 364 | Ga0207678_10491066 | 3300026067 | Bacteria | 1070 |
| 365 | Ga0207708_10062674 | 3300026075 | Bacteria | 2840 |
| 366 | Ga0207702_10083491 | 3300026078 | Bacteria | 2779 |
| 367 | Ga0207641_10000202 | 3300026088 | Bacteria | 79668 |
| 368 | Ga0207641_10021200 | 3300026088 | Bacteria | 5342 |
| 369 | Ga0207641_10172561 | 3300026088 | Bacteria | 1975 |
| 370 | Ga0207641_10214875 | 3300026088 | Bacteria | 1780 |
| 371 | Ga0207648_10006817 | 3300026089 | Bacteria | 11319 |
| 372 | Ga0207648_10082249 | 3300026089 | Bacteria | 2808 |
| 373 | Ga0207648_10162731 | 3300026089 | Bacteria | 1971 |
| 374 | Ga0207648_10277489 | 3300026089 | Unclassified | 1498 |
| 375 | Ga0207648_10428514 | 3300026089 | Bacteria | 1202 |
| 376 | Ga0207648_10438400 | 3300026089 | Unclassified | 1188 |
| 377 | Ga0207676_10196680 | 3300026095 | Bacteria | 1778 |
| 378 | Ga0207676_10214437 | 3300026095 | Unclassified | 1710 |
| 379 | Ga0207676_10639615 | 3300026095 | Bacteria | 1025 |
| 380 | Ga0207674_10007789 | 3300026116 | Bacteria | 12460 |
| 381 | Ga0207674_10753315 | 3300026116 | Bacteria | 940 |
| 382 | Ga0207675_100030578 | 3300026118 | Bacteria | 5017 |
| 383 | Ga0207675_100040981 | 3300026118 | Bacteria | 4325 |
| 384 | Ga0207675_100176410 | 3300026118 | Bacteria | 2045 |
| 385 | Ga0207683_10008436 | 3300026121 | Bacteria | 8820 |
| 386 | Ga0207683_10013033 | 3300026121 | Bacteria | 7095 |
| 387 | Ga0207698_10003490 | 3300026142 | Bacteria | 9482 |
| 388 | Ga0207698_10073227 | 3300026142 | Bacteria | 2727 |
| 389 | Ga0207698_10109781 | 3300026142 | Bacteria | 2309 |
| 390 | Ga0268266_10099028 | 3300028379 | Bacteria | 2566 |
| 391 | Ga0268266_10110768 | 3300028379 | Bacteria | 2432 |
| 392 | Ga0268266_10166767 | 3300028379 | Bacteria | 1996 |
| 393 | Ga0268266_10288744 | 3300028379 | Bacteria | 1527 |
| 394 | Ga0268265_10239184 | 3300028380 | Bacteria | 1601 |
| 395 | Ga0268265_10435732 | 3300028380 | Bacteria | 1220 |
| 396 | Ga0268264_10001699 | 3300028381 | Bacteria | 20272 |
| 397 | Ga0268264_10001731 | 3300028381 | Bacteria | 20053 |
| 398 | Ga0268264_10001913 | 3300028381 | Bacteria | 18815 |
| 399 | Ga0268264_10069166 | 3300028381 | Unclassified | 2985 |
| 400 | Ga0268264_10213012 | 3300028381 | Bacteria | 1774 |
| 401 | Ga0268264_10436942 | 3300028381 | Bacteria | 1265 |
| 402 | Ga0268264_10971662 | 3300028381 | Unclassified | 855 |
| 403 | Ga0307517_10002335 | 3300028786 | Bacteria | 30606 |
| 404 | Ga0307515_10000002 | 3300028794 | Bacteria | 1231751 |
| 405 | Ga0307515_10000076 | 3300028794 | Bacteria | 228736 |
| 406 | Ga0265327_10024764 | 3300031251 | Bacteria | 3515 |
| 407 | Ga0307509_10091360 | 3300031507 | Bacteria | 3116 |
| 408 | Ga0307509_10172463 | 3300031507 | Bacteria | 2040 |
| 409 | Ga0307509_10431501 | 3300031507 | Bacteria | 1016 |
| 410 | Ga0265313_10058156 | 3300031595 | Bacteria | 1823 |
| 411 | Ga0307508_10003608 | 3300031616 | Bacteria | 15547 |
| 412 | Ga0307516_10008501 | 3300031730 | Bacteria | 11601 |
| 413 | Ga0307406_10626235 | 3300031901 | Unclassified | 890 |
| 414 | Ga0307414_10170652 | 3300032004 | Bacteria | 1739 |
| 415 | Ga0373955_0039844 | 3300035172 | Bacteria | 2510 |
| 416 | Ga0373924_0007228 | 3300035410 | Bacteria | 4003 |
| 417 | Ga0373935_0315737 | 3300035692 | Unclassified | 1108 |
| 418 | Ga0373937_0005153 | 3300036401 | Bacteria | 11144 |
| 419 | Ga0373925_0246234 | 3300037068 | Unclassified | 1433 |
| 420 | Ga0395899_0555235 | 3300037312 | Unclassified | 737 |
| 421 | Ga0395900_0012586 | 3300037418 | Bacteria | 8657 |
| 422 | Ga0439446_0020183 | 3300042156 | Bacteria | 1876 |
| 423 | Ga0451577_0003916 | 3300042876 | Bacteria | 16080 |
| 424 | Ga0451577_0344357 | 3300042876 | Bacteria | 1352 |
| 425 | Ga0453684_1529590 | 3300044712 | Bacteria | 687 |
| 426 | Ga0495580_0465839 | 3300046472 | Unclassified | 847 |
| 427 | Ga0495664_0399607 | 3300046477 | Unclassified | 825 |
| 428 | Ga0495608_0223901 | 3300046511 | Unclassified | 1179 |
| 429 | Ga0495618_0012660 | 3300046514 | Bacteria | 5125 |
| 430 | Ga0495628_0116164 | 3300046516 | Bacteria | 2055 |
| 431 | Ga0495630_0021010 | 3300046517 | Bacteria | 4819 |
| 432 | Ga0495640_0517578 | 3300046533 | Unclassified | 725 |
| 433 | Ga0495586_0048106 | 3300046535 | Unclassified | 2304 |
| 434 | Ga0495645_0454828 | 3300046543 | Unclassified | 807 |
| 435 | Ga0495668_0000367 | 3300046616 | Bacteria | 59531 |
| 436 | Ga0495634_0062782 | 3300046642 | Bacteria | 2466 |
| 437 | Ga0495635_0345549 | 3300046663 | Unclassified | 993 |
| 438 | Ga0495658_0229443 | 3300046683 | Bacteria | 1164 |
| 439 | Ga0495672_0153905 | 3300047320 | Bacteria | 1189 |
| 440 | Ga0495676_0229168 | 3300047321 | Bacteria | 1277 |
| 441 | Ga0495684_0271746 | 3300047471 | Unclassified | 1226 |
| 442 | Ga0496101_0118021 | 3300048904 | Bacteria | 2004 |
| 443 | Ga0496113_0577386 | 3300048916 | Bacteria | 901 |
| 444 | Ga0501031_0008920 | 3300049568 | Bacteria | 6520 |
| 445 | Ga0501032_0056211 | 3300049569 | Bacteria | 2646 |
| 446 | Ga0501034_0034359 | 3300049571 | Bacteria | 5139 |
| 447 | Ga0501034_0178981 | 3300049571 | Bacteria | 2086 |
| 448 | Ga0501034_0287650 | 3300049571 | Unclassified | 1582 |
| 449 | Ga0501034_0299467 | 3300049571 | Bacteria | 1545 |
| 450 | Ga0501036_0031936 | 3300049572 | Bacteria | 4448 |
| 451 | Ga0501036_0137029 | 3300049572 | Bacteria | 2066 |
| 452 | Ga0501037_0037569 | 3300049573 | Bacteria | 3570 |
| 453 | Ga0501037_0662685 | 3300049573 | Bacteria | 697 |
| 454 | Ga0501038_0009237 | 3300049574 | Bacteria | 9047 |
| 455 | Ga0501039_0083623 | 3300049575 | Bacteria | 2485 |
| 456 | Ga0501043_0033806 | 3300049579 | Bacteria | 4023 |
| 457 | Ga0501046_0074137 | 3300049580 | Bacteria | 2641 |
| 458 | Ga0501046_0364890 | 3300049580 | Bacteria | 1047 |
| 459 | Ga0501047_0054822 | 3300049581 | Bacteria | 3856 |
| 460 | Ga0501047_0062801 | 3300049581 | Bacteria | 3583 |
| 461 | Ga0501073_0169215 | 3300049589 | Bacteria | 1513 |
| 462 | Ga0501075_0536586 | 3300049591 | Bacteria | 893 |
| 463 | Ga0501225_0084361 | 3300049705 | Unclassified | 915 |
| 464 | Ga0501035_0017194 | 3300049822 | Bacteria | 6666 |
| 465 | Ga0501035_0048382 | 3300049822 | Bacteria | 3814 |
| 466 | Ga0501044_0067496 | 3300049823 | Bacteria | 3644 |
| 467 | Ga0495619_0216741 | 3300053085 | Unclassified | 1326 |
| 468 | Ga0500553_107070 | 3300053101 | Bacteria | 1187 |
| 469 | Ga0500628_127527 | 3300053129 | Bacteria | 696 |
| 470 | Ga0500568_0000789 | 3300053139 | Bacteria | 22357 |
| 471 | Ga0500588_0035688 | 3300053146 | Bacteria | 1465 |
| 472 | Ga0500616_0061856 | 3300053153 | Bacteria | 1936 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053129 | Ga0500628_127527 | Ga0500628_127527_12_593 | 179 |
| 2 | 3300035172 | Ga0373955_0039844 | Ga0373955_0039844_1896_2498 | 182 |
| 3 | 3300049573 | Ga0501037_0662685 | Ga0501037_0662685_37_630 | 183 |
| 4 | 3300005719 | Ga0068861_100096355 | Ga0068861_1000963553 | 186 |
| 5 | 3300025918 | Ga0207662_10154665 | Ga0207662_101546652 | 186 |
| 6 | 3300025923 | Ga0207681_10493027 | Ga0207681_104930272 | 186 |
| 7 | 3300026118 | Ga0207675_100040981 | Ga0207675_1000409812 | 186 |
| 8 | 3300009176 | Ga0105242_10240374 | Ga0105242_102403742 | 187 |
| 9 | 3300010375 | Ga0105239_10277519 | Ga0105239_102775192 | 187 |
| 10 | 3300013102 | Ga0157371_10604113 | Ga0157371_106041131 | 187 |
| 11 | 3300013297 | Ga0157378_10298813 | Ga0157378_102988132 | 187 |
| 12 | 3300013306 | Ga0163162_10058353 | Ga0163162_100583532 | 187 |
| 13 | 3300014325 | Ga0163163_10508638 | Ga0163163_105086381 | 187 |
| 14 | 3300014968 | Ga0157379_10105531 | Ga0157379_101055312 | 187 |
| 15 | 3300014969 | Ga0157376_10433214 | Ga0157376_104332142 | 187 |
| 16 | 3300035410 | Ga0373924_0007228 | Ga0373924_0007228_2824_3441 | 187 |
| 17 | 3300036401 | Ga0373937_0005153 | Ga0373937_0005153_2156_2773 | 187 |
| 18 | 3300046472 | Ga0495580_0465839 | Ga0495580_0465839_41_658 | 187 |
| 19 | 3300046511 | Ga0495608_0223901 | Ga0495608_0223901_157_774 | 187 |
| 20 | 3300046514 | Ga0495618_0012660 | Ga0495618_0012660_3267_3884 | 187 |
| 21 | 3300046516 | Ga0495628_0116164 | Ga0495628_0116164_1336_1953 | 187 |
| 22 | 3300046517 | Ga0495630_0021010 | Ga0495630_0021010_2895_3512 | 187 |
| 23 | 3300046533 | Ga0495640_0517578 | Ga0495640_0517578_55_672 | 187 |
| 24 | 3300046535 | Ga0495586_0048106 | Ga0495586_0048106_645_1262 | 187 |
| 25 | 3300046543 | Ga0495645_0454828 | Ga0495645_0454828_15_632 | 187 |
| 26 | 3300046642 | Ga0495634_0062782 | Ga0495634_0062782_1747_2364 | 187 |
| 27 | 3300046663 | Ga0495635_0345549 | Ga0495635_0345549_59_676 | 187 |
| 28 | 3300047321 | Ga0495676_0229168 | Ga0495676_0229168_109_726 | 187 |
| 29 | 3300047471 | Ga0495684_0271746 | Ga0495684_0271746_561_1178 | 187 |
| 30 | 3300048904 | Ga0496101_0118021 | Ga0496101_0118021_820_1437 | 187 |
| 31 | 3300053085 | Ga0495619_0216741 | Ga0495619_0216741_94_711 | 187 |
| 32 | 3300003316 | rootH1_10079318 | rootH1_100793182 | 188 |
| 33 | 3300005563 | Ga0068855_100106649 | Ga0068855_1001066492 | 190 |
| 34 | 3300025949 | Ga0207667_10145479 | Ga0207667_101454792 | 190 |
| 35 | 3300032004 | Ga0307414_10170652 | Ga0307414_101706522 | 191 |
| 36 | 3300035692 | Ga0373935_0315737 | Ga0373935_0315737_282_911 | 191 |
| 37 | 3300049705 | Ga0501225_0084361 | Ga0501225_0084361_281_904 | 191 |
| 38 | 3300005547 | Ga0070693_100503818 | Ga0070693_1005038181 | 193 |
| 39 | 3300005366 | Ga0070659_101024961 | Ga0070659_1010249611 | 194 |
| 40 | 3300005457 | Ga0070662_100911132 | Ga0070662_1009111321 | 194 |
| 41 | 3300005618 | Ga0068864_100004156 | Ga0068864_10000415615 | 194 |
| 42 | 3300025960 | Ga0207651_10537534 | Ga0207651_105375342 | 194 |
| 43 | 3300053139 | Ga0500568_0000789 | Ga0500568_0000789_13017_13658 | 196 |
| 44 | 3300025933 | Ga0207706_10096610 | Ga0207706_100966102 | 198 |
| 45 | 3300005330 | Ga0070690_100007549 | Ga0070690_1000075495 | 199 |
| 46 | 3300005334 | Ga0068869_100116093 | Ga0068869_1001160932 | 199 |
| 47 | 3300005335 | Ga0070666_10043723 | Ga0070666_100437232 | 199 |
| 48 | 3300005338 | Ga0068868_100009542 | Ga0068868_1000095425 | 199 |
| 49 | 3300005344 | Ga0070661_100262532 | Ga0070661_1002625321 | 199 |
| 50 | 3300005356 | Ga0070674_100093218 | Ga0070674_1000932182 | 199 |
| 51 | 3300005367 | Ga0070667_100014132 | Ga0070667_1000141322 | 199 |
| 52 | 3300005438 | Ga0070701_10118879 | Ga0070701_101188792 | 199 |
| 53 | 3300005456 | Ga0070678_100326121 | Ga0070678_1003261212 | 199 |
| 54 | 3300005457 | Ga0070662_100011578 | Ga0070662_1000115781 | 199 |
| 55 | 3300005539 | Ga0068853_100202466 | Ga0068853_1002024662 | 199 |
| 56 | 3300005544 | Ga0070686_100116157 | Ga0070686_1001161571 | 199 |
| 57 | 3300005578 | Ga0068854_100141627 | Ga0068854_1001416272 | 199 |
| 58 | 3300005617 | Ga0068859_100051366 | Ga0068859_1000513663 | 199 |
| 59 | 3300005618 | Ga0068864_100261178 | Ga0068864_1002611783 | 199 |
| 60 | 3300005834 | Ga0068851_10012087 | Ga0068851_100120874 | 199 |
| 61 | 3300005842 | Ga0068858_100138918 | Ga0068858_1001389182 | 199 |
| 62 | 3300005843 | Ga0068860_100674934 | Ga0068860_1006749341 | 199 |
| 63 | 3300006358 | Ga0068871_100429837 | Ga0068871_1004298371 | 199 |
| 64 | 3300006881 | Ga0068865_100587260 | Ga0068865_1005872602 | 199 |
| 65 | 3300006931 | Ga0097620_100051365 | Ga0097620_1000513653 | 199 |
| 66 | 3300013296 | Ga0157374_10005863 | Ga0157374_100058632 | 199 |
| 67 | 3300013307 | Ga0157372_10769556 | Ga0157372_107695562 | 199 |
| 68 | 3300013308 | Ga0157375_10160367 | Ga0157375_101603672 | 199 |
| 69 | 3300017792 | Ga0163161_10005625 | Ga0163161_100056253 | 199 |
| 70 | 3300025321 | Ga0207656_10031181 | Ga0207656_100311811 | 199 |
| 71 | 3300025899 | Ga0207642_10376992 | Ga0207642_103769921 | 199 |
| 72 | 3300025933 | Ga0207706_10001885 | Ga0207706_1000188514 | 199 |
| 73 | 3300025934 | Ga0207686_10037874 | Ga0207686_100378742 | 199 |
| 74 | 3300025942 | Ga0207689_10026108 | Ga0207689_100261085 | 199 |
| 75 | 3300025945 | Ga0207679_10090182 | Ga0207679_100901822 | 199 |
| 76 | 3300025960 | Ga0207651_10075315 | Ga0207651_100753152 | 199 |
| 77 | 3300025981 | Ga0207640_10426139 | Ga0207640_104261392 | 199 |
| 78 | 3300026035 | Ga0207703_10036338 | Ga0207703_100363383 | 199 |
| 79 | 3300026088 | Ga0207641_10214875 | Ga0207641_102148753 | 199 |
| 80 | 3300026089 | Ga0207648_10277489 | Ga0207648_102774892 | 199 |
| 81 | 3300026121 | Ga0207683_10013033 | Ga0207683_100130336 | 199 |
| 82 | 3300028381 | Ga0268264_10436942 | Ga0268264_104369422 | 199 |
| 83 | 3300028794 | Ga0307515_10000002 | Ga0307515_10000002480 | 199 |
| 84 | 3300037068 | Ga0373925_0246234 | Ga0373925_0246234_91_744 | 199 |
| 85 | 3300042876 | Ga0451577_0344357 | Ga0451577_0344357_551_1192 | 199 |
| 86 | 3300046477 | Ga0495664_0399607 | Ga0495664_0399607_83_736 | 199 |
| 87 | 3300046683 | Ga0495658_0229443 | Ga0495658_0229443_87_740 | 199 |
| 88 | 3300047320 | Ga0495672_0153905 | Ga0495672_0153905_415_1071 | 199 |
| 89 | 3300009093 | Ga0105240_10100691 | Ga0105240_101006912 | 200 |
| 90 | 3300005834 | Ga0068851_10080001 | Ga0068851_100800012 | 201 |
| 91 | 3300031901 | Ga0307406_10626235 | Ga0307406_106262351 | 201 |
| 92 | 3300042156 | Ga0439446_0020183 | Ga0439446_0020183_1178_1858 | 201 |
| 93 | 3300046616 | Ga0495668_0000367 | Ga0495668_0000367_10715_11371 | 201 |
| 94 | 3300002459 | JGI24751J29686_10000697 | JGI24751J29686_100006972 | 202 |
| 95 | 3300005327 | Ga0070658_10025676 | Ga0070658_100256764 | 202 |
| 96 | 3300005327 | Ga0070658_10062940 | Ga0070658_100629402 | 202 |
| 97 | 3300005327 | Ga0070658_10628469 | Ga0070658_106284692 | 202 |
| 98 | 3300005329 | Ga0070683_100000163 | Ga0070683_10000016314 | 202 |
| 99 | 3300005329 | Ga0070683_100102845 | Ga0070683_1001028452 | 202 |
| 100 | 3300005330 | Ga0070690_100055790 | Ga0070690_1000557903 | 202 |
| 101 | 3300005331 | Ga0070670_100008754 | Ga0070670_1000087542 | 202 |
| 102 | 3300005331 | Ga0070670_100321289 | Ga0070670_1003212892 | 202 |
| 103 | 3300005334 | Ga0068869_100077989 | Ga0068869_1000779892 | 202 |
| 104 | 3300005334 | Ga0068869_100362686 | Ga0068869_1003626861 | 202 |
| 105 | 3300005336 | Ga0070680_100044461 | Ga0070680_1000444613 | 202 |
| 106 | 3300005337 | Ga0070682_100243845 | Ga0070682_1002438452 | 202 |
| 107 | 3300005337 | Ga0070682_101022226 | Ga0070682_1010222261 | 202 |
| 108 | 3300005338 | Ga0068868_100181328 | Ga0068868_1001813283 | 202 |
| 109 | 3300005339 | Ga0070660_100042613 | Ga0070660_1000426133 | 202 |
| 110 | 3300005344 | Ga0070661_100013480 | Ga0070661_1000134803 | 202 |
| 111 | 3300005344 | Ga0070661_100365956 | Ga0070661_1003659562 | 202 |
| 112 | 3300005354 | Ga0070675_100151137 | Ga0070675_1001511372 | 202 |
| 113 | 3300005365 | Ga0070688_100066198 | Ga0070688_1000661983 | 202 |
| 114 | 3300005455 | Ga0070663_100626201 | Ga0070663_1006262011 | 202 |
| 115 | 3300005459 | Ga0068867_100005521 | Ga0068867_1000055213 | 202 |
| 116 | 3300005530 | Ga0070679_100001442 | Ga0070679_10000144216 | 202 |
| 117 | 3300005530 | Ga0070679_100003021 | Ga0070679_1000030216 | 202 |
| 118 | 3300005530 | Ga0070679_100267778 | Ga0070679_1002677782 | 202 |
| 119 | 3300005535 | Ga0070684_100017115 | Ga0070684_1000171157 | 202 |
| 120 | 3300005535 | Ga0070684_100064713 | Ga0070684_1000647131 | 202 |
| 121 | 3300005539 | Ga0068853_100002145 | Ga0068853_1000021455 | 202 |
| 122 | 3300005539 | Ga0068853_100047147 | Ga0068853_1000471475 | 202 |
| 123 | 3300005539 | Ga0068853_100085576 | Ga0068853_1000855763 | 202 |
| 124 | 3300005543 | Ga0070672_100684590 | Ga0070672_1006845901 | 202 |
| 125 | 3300005543 | Ga0070672_100986036 | Ga0070672_1009860361 | 202 |
| 126 | 3300005563 | Ga0068855_100316191 | Ga0068855_1003161912 | 202 |
| 127 | 3300005564 | Ga0070664_100003401 | Ga0070664_10000340111 | 202 |
| 128 | 3300005564 | Ga0070664_101189329 | Ga0070664_1011893291 | 202 |
| 129 | 3300005577 | Ga0068857_100041415 | Ga0068857_1000414153 | 202 |
| 130 | 3300005577 | Ga0068857_100861997 | Ga0068857_1008619972 | 202 |
| 131 | 3300005578 | Ga0068854_100094647 | Ga0068854_1000946473 | 202 |
| 132 | 3300005578 | Ga0068854_100477340 | Ga0068854_1004773402 | 202 |
| 133 | 3300005614 | Ga0068856_100032156 | Ga0068856_1000321563 | 202 |
| 134 | 3300005616 | Ga0068852_100015143 | Ga0068852_1000151433 | 202 |
| 135 | 3300005616 | Ga0068852_100173333 | Ga0068852_1001733332 | 202 |
| 136 | 3300005616 | Ga0068852_100279782 | Ga0068852_1002797822 | 202 |
| 137 | 3300005617 | Ga0068859_100032476 | Ga0068859_1000324761 | 202 |
| 138 | 3300005617 | Ga0068859_100275598 | Ga0068859_1002755982 | 202 |
| 139 | 3300005834 | Ga0068851_10204394 | Ga0068851_102043942 | 202 |
| 140 | 3300005841 | Ga0068863_100189682 | Ga0068863_1001896821 | 202 |
| 141 | 3300005842 | Ga0068858_100044704 | Ga0068858_1000447042 | 202 |
| 142 | 3300005843 | Ga0068860_100010290 | Ga0068860_10001029012 | 202 |
| 143 | 3300005843 | Ga0068860_100262923 | Ga0068860_1002629232 | 202 |
| 144 | 3300005844 | Ga0068862_100042218 | Ga0068862_1000422182 | 202 |
| 145 | 3300005844 | Ga0068862_100408071 | Ga0068862_1004080711 | 202 |
| 146 | 3300006237 | Ga0097621_100116128 | Ga0097621_1001161283 | 202 |
| 147 | 3300006931 | Ga0097620_100032475 | Ga0097620_1000324751 | 202 |
| 148 | 3300006931 | Ga0097620_100275619 | Ga0097620_1002756192 | 202 |
| 149 | 3300009011 | Ga0105251_10076507 | Ga0105251_100765072 | 202 |
| 150 | 3300009093 | Ga0105240_10126882 | Ga0105240_101268823 | 202 |
| 151 | 3300009101 | Ga0105247_10161803 | Ga0105247_101618032 | 202 |
| 152 | 3300009174 | Ga0105241_10175514 | Ga0105241_101755142 | 202 |
| 153 | 3300009177 | Ga0105248_10698319 | Ga0105248_106983192 | 202 |
| 154 | 3300009553 | Ga0105249_10043401 | Ga0105249_100434012 | 202 |
| 155 | 3300009553 | Ga0105249_10056871 | Ga0105249_100568714 | 202 |
| 156 | 3300010375 | Ga0105239_10389060 | Ga0105239_103890601 | 202 |
| 157 | 3300010375 | Ga0105239_11122919 | Ga0105239_111229191 | 202 |
| 158 | 3300013100 | Ga0157373_10003214 | Ga0157373_100032147 | 202 |
| 159 | 3300013100 | Ga0157373_10010365 | Ga0157373_100103653 | 202 |
| 160 | 3300013102 | Ga0157371_10001525 | Ga0157371_1000152521 | 202 |
| 161 | 3300013102 | Ga0157371_10007179 | Ga0157371_1000717910 | 202 |
| 162 | 3300013102 | Ga0157371_10013861 | Ga0157371_100138615 | 202 |
| 163 | 3300013102 | Ga0157371_10080098 | Ga0157371_100800983 | 202 |
| 164 | 3300013102 | Ga0157371_10182665 | Ga0157371_101826652 | 202 |
| 165 | 3300013104 | Ga0157370_10043363 | Ga0157370_100433635 | 202 |
| 166 | 3300013104 | Ga0157370_10210171 | Ga0157370_102101712 | 202 |
| 167 | 3300013296 | Ga0157374_10347145 | Ga0157374_103471452 | 202 |
| 168 | 3300013297 | Ga0157378_10205085 | Ga0157378_102050852 | 202 |
| 169 | 3300013306 | Ga0163162_10041859 | Ga0163162_100418596 | 202 |
| 170 | 3300013306 | Ga0163162_10909483 | Ga0163162_109094831 | 202 |
| 171 | 3300013307 | Ga0157372_10050572 | Ga0157372_100505723 | 202 |
| 172 | 3300013307 | Ga0157372_10306183 | Ga0157372_103061831 | 202 |
| 173 | 3300013308 | Ga0157375_10357516 | Ga0157375_103575162 | 202 |
| 174 | 3300014325 | Ga0163163_10044180 | Ga0163163_100441803 | 202 |
| 175 | 3300014325 | Ga0163163_10479039 | Ga0163163_104790392 | 202 |
| 176 | 3300014325 | Ga0163163_10516217 | Ga0163163_105162171 | 202 |
| 177 | 3300014745 | Ga0157377_10602734 | Ga0157377_106027341 | 202 |
| 178 | 3300025909 | Ga0207705_10032240 | Ga0207705_100322404 | 202 |
| 179 | 3300025909 | Ga0207705_10188288 | Ga0207705_101882882 | 202 |
| 180 | 3300025911 | Ga0207654_10068394 | Ga0207654_100683942 | 202 |
| 181 | 3300025913 | Ga0207695_10012215 | Ga0207695_100122155 | 202 |
| 182 | 3300025917 | Ga0207660_10016446 | Ga0207660_100164463 | 202 |
| 183 | 3300025919 | Ga0207657_10074056 | Ga0207657_100740562 | 202 |
| 184 | 3300025920 | Ga0207649_10317749 | Ga0207649_103177492 | 202 |
| 185 | 3300025920 | Ga0207649_10349219 | Ga0207649_103492191 | 202 |
| 186 | 3300025921 | Ga0207652_10000045 | Ga0207652_1000004573 | 202 |
| 187 | 3300025921 | Ga0207652_10022706 | Ga0207652_100227063 | 202 |
| 188 | 3300025925 | Ga0207650_10278261 | Ga0207650_102782612 | 202 |
| 189 | 3300025925 | Ga0207650_10365047 | Ga0207650_103650472 | 202 |
| 190 | 3300025926 | Ga0207659_10130354 | Ga0207659_101303542 | 202 |
| 191 | 3300025932 | Ga0207690_10378847 | Ga0207690_103788472 | 202 |
| 192 | 3300025936 | Ga0207670_10104348 | Ga0207670_101043482 | 202 |
| 193 | 3300025942 | Ga0207689_10006306 | Ga0207689_100063062 | 202 |
| 194 | 3300025942 | Ga0207689_10039167 | Ga0207689_100391672 | 202 |
| 195 | 3300025944 | Ga0207661_10072653 | Ga0207661_100726532 | 202 |
| 196 | 3300025944 | Ga0207661_10151429 | Ga0207661_101514292 | 202 |
| 197 | 3300025944 | Ga0207661_10499820 | Ga0207661_104998202 | 202 |
| 198 | 3300025945 | Ga0207679_10001677 | Ga0207679_100016775 | 202 |
| 199 | 3300025945 | Ga0207679_10210856 | Ga0207679_102108561 | 202 |
| 200 | 3300025949 | Ga0207667_10053539 | Ga0207667_100535392 | 202 |
| 201 | 3300025949 | Ga0207667_10322647 | Ga0207667_103226471 | 202 |
| 202 | 3300025961 | Ga0207712_10057325 | Ga0207712_100573252 | 202 |
| 203 | 3300025972 | Ga0207668_10651153 | Ga0207668_106511531 | 202 |
| 204 | 3300025981 | Ga0207640_10215699 | Ga0207640_102156991 | 202 |
| 205 | 3300025981 | Ga0207640_10653724 | Ga0207640_106537241 | 202 |
| 206 | 3300026035 | Ga0207703_10424889 | Ga0207703_104248891 | 202 |
| 207 | 3300026041 | Ga0207639_10063348 | Ga0207639_100633482 | 202 |
| 208 | 3300026041 | Ga0207639_10106058 | Ga0207639_101060583 | 202 |
| 209 | 3300026041 | Ga0207639_10341747 | Ga0207639_103417472 | 202 |
| 210 | 3300026067 | Ga0207678_10491066 | Ga0207678_104910662 | 202 |
| 211 | 3300026078 | Ga0207702_10083491 | Ga0207702_100834912 | 202 |
| 212 | 3300026088 | Ga0207641_10172561 | Ga0207641_101725613 | 202 |
| 213 | 3300026095 | Ga0207676_10214437 | Ga0207676_102144371 | 202 |
| 214 | 3300026116 | Ga0207674_10007789 | Ga0207674_1000778911 | 202 |
| 215 | 3300026116 | Ga0207674_10753315 | Ga0207674_107533151 | 202 |
| 216 | 3300026142 | Ga0207698_10003490 | Ga0207698_100034905 | 202 |
| 217 | 3300028379 | Ga0268266_10166767 | Ga0268266_101667672 | 202 |
| 218 | 3300028380 | Ga0268265_10435732 | Ga0268265_104357321 | 202 |
| 219 | 3300028381 | Ga0268264_10069166 | Ga0268264_100691662 | 202 |
| 220 | 3300028381 | Ga0268264_10971662 | Ga0268264_109716621 | 202 |
| 221 | 3300031507 | Ga0307509_10172463 | Ga0307509_101724632 | 202 |
| 222 | 3300031507 | Ga0307509_10431501 | Ga0307509_104315012 | 202 |
| 223 | 3300037312 | Ga0395899_0555235 | Ga0395899_0555235_29_691 | 202 |
| 224 | 3300037418 | Ga0395900_0012586 | Ga0395900_0012586_803_1465 | 202 |
| 225 | 3300048916 | Ga0496113_0577386 | Ga0496113_0577386_192_869 | 202 |
| 226 | 3300049568 | Ga0501031_0008920 | Ga0501031_0008920_895_1560 | 202 |
| 227 | 3300049569 | Ga0501032_0056211 | Ga0501032_0056211_357_1022 | 202 |
| 228 | 3300049571 | Ga0501034_0034359 | Ga0501034_0034359_3041_3706 | 202 |
| 229 | 3300049571 | Ga0501034_0178981 | Ga0501034_0178981_257_919 | 202 |
| 230 | 3300049571 | Ga0501034_0299467 | Ga0501034_0299467_173_838 | 202 |
| 231 | 3300049572 | Ga0501036_0031936 | Ga0501036_0031936_2093_2758 | 202 |
| 232 | 3300049573 | Ga0501037_0037569 | Ga0501037_0037569_1949_2614 | 202 |
| 233 | 3300049574 | Ga0501038_0009237 | Ga0501038_0009237_3794_4459 | 202 |
| 234 | 3300049575 | Ga0501039_0083623 | Ga0501039_0083623_1731_2396 | 202 |
| 235 | 3300049579 | Ga0501043_0033806 | Ga0501043_0033806_2280_2945 | 202 |
| 236 | 3300049580 | Ga0501046_0074137 | Ga0501046_0074137_1632_2297 | 202 |
| 237 | 3300049581 | Ga0501047_0054822 | Ga0501047_0054822_1501_2166 | 202 |
| 238 | 3300049589 | Ga0501073_0169215 | Ga0501073_0169215_315_962 | 202 |
| 239 | 3300049591 | Ga0501075_0536586 | Ga0501075_0536586_114_779 | 202 |
| 240 | 3300049822 | Ga0501035_0017194 | Ga0501035_0017194_2847_3512 | 202 |
| 241 | 3300049823 | Ga0501044_0067496 | Ga0501044_0067496_1443_2108 | 202 |
| 242 | 3300053153 | Ga0500616_0061856 | Ga0500616_0061856_361_1017 | 202 |
| 243 | 3300005290 | Ga0065712_10124090 | Ga0065712_101240901 | 203 |
| 244 | 3300005327 | Ga0070658_10175616 | Ga0070658_101756162 | 203 |
| 245 | 3300005328 | Ga0070676_10001325 | Ga0070676_100013255 | 203 |
| 246 | 3300005328 | Ga0070676_10039691 | Ga0070676_100396913 | 203 |
| 247 | 3300005328 | Ga0070676_10204941 | Ga0070676_102049411 | 203 |
| 248 | 3300005331 | Ga0070670_100081260 | Ga0070670_1000812602 | 203 |
| 249 | 3300005334 | Ga0068869_100002154 | Ga0068869_1000021543 | 203 |
| 250 | 3300005334 | Ga0068869_100076503 | Ga0068869_1000765032 | 203 |
| 251 | 3300005334 | Ga0068869_100102195 | Ga0068869_1001021953 | 203 |
| 252 | 3300005335 | Ga0070666_10000051 | Ga0070666_1000005157 | 203 |
| 253 | 3300005338 | Ga0068868_100022248 | Ga0068868_1000222482 | 203 |
| 254 | 3300005338 | Ga0068868_100066867 | Ga0068868_1000668671 | 203 |
| 255 | 3300005338 | Ga0068868_100219385 | Ga0068868_1002193851 | 203 |
| 256 | 3300005338 | Ga0068868_100238580 | Ga0068868_1002385801 | 203 |
| 257 | 3300005340 | Ga0070689_100411509 | Ga0070689_1004115092 | 203 |
| 258 | 3300005340 | Ga0070689_100783032 | Ga0070689_1007830321 | 203 |
| 259 | 3300005347 | Ga0070668_100130932 | Ga0070668_1001309322 | 203 |
| 260 | 3300005347 | Ga0070668_100217971 | Ga0070668_1002179711 | 203 |
| 261 | 3300005347 | Ga0070668_100781338 | Ga0070668_1007813381 | 203 |
| 262 | 3300005353 | Ga0070669_100149455 | Ga0070669_1001494552 | 203 |
| 263 | 3300005353 | Ga0070669_100241834 | Ga0070669_1002418342 | 203 |
| 264 | 3300005354 | Ga0070675_100645866 | Ga0070675_1006458661 | 203 |
| 265 | 3300005355 | Ga0070671_100070435 | Ga0070671_1000704351 | 203 |
| 266 | 3300005356 | Ga0070674_100007210 | Ga0070674_1000072102 | 203 |
| 267 | 3300005364 | Ga0070673_100052189 | Ga0070673_1000521892 | 203 |
| 268 | 3300005364 | Ga0070673_100076951 | Ga0070673_1000769512 | 203 |
| 269 | 3300005364 | Ga0070673_100113300 | Ga0070673_1001133002 | 203 |
| 270 | 3300005364 | Ga0070673_100393663 | Ga0070673_1003936631 | 203 |
| 271 | 3300005364 | Ga0070673_100419281 | Ga0070673_1004192811 | 203 |
| 272 | 3300005365 | Ga0070688_100559821 | Ga0070688_1005598211 | 203 |
| 273 | 3300005367 | Ga0070667_100133205 | Ga0070667_1001332052 | 203 |
| 274 | 3300005367 | Ga0070667_100204235 | Ga0070667_1002042352 | 203 |
| 275 | 3300005367 | Ga0070667_100243184 | Ga0070667_1002431841 | 203 |
| 276 | 3300005438 | Ga0070701_10181469 | Ga0070701_101814692 | 203 |
| 277 | 3300005441 | Ga0070700_100560312 | Ga0070700_1005603121 | 203 |
| 278 | 3300005456 | Ga0070678_100069233 | Ga0070678_1000692332 | 203 |
| 279 | 3300005459 | Ga0068867_100037474 | Ga0068867_1000374742 | 203 |
| 280 | 3300005459 | Ga0068867_100602426 | Ga0068867_1006024262 | 203 |
| 281 | 3300005466 | Ga0070685_10088388 | Ga0070685_100883883 | 203 |
| 282 | 3300005544 | Ga0070686_100038233 | Ga0070686_1000382334 | 203 |
| 283 | 3300005547 | Ga0070693_100266426 | Ga0070693_1002664262 | 203 |
| 284 | 3300005548 | Ga0070665_100359755 | Ga0070665_1003597551 | 203 |
| 285 | 3300005548 | Ga0070665_100783909 | Ga0070665_1007839092 | 203 |
| 286 | 3300005548 | Ga0070665_100885550 | Ga0070665_1008855502 | 203 |
| 287 | 3300005578 | Ga0068854_100701700 | Ga0068854_1007017001 | 203 |
| 288 | 3300005615 | Ga0070702_100005619 | Ga0070702_1000056193 | 203 |
| 289 | 3300005616 | Ga0068852_100003114 | Ga0068852_1000031144 | 203 |
| 290 | 3300005616 | Ga0068852_100256435 | Ga0068852_1002564352 | 203 |
| 291 | 3300005617 | Ga0068859_100000023 | Ga0068859_100000023194 | 203 |
| 292 | 3300005617 | Ga0068859_100009583 | Ga0068859_1000095837 | 203 |
| 293 | 3300005617 | Ga0068859_100237199 | Ga0068859_1002371992 | 203 |
| 294 | 3300005618 | Ga0068864_100108282 | Ga0068864_1001082821 | 203 |
| 295 | 3300005719 | Ga0068861_100017003 | Ga0068861_1000170031 | 203 |
| 296 | 3300005719 | Ga0068861_100448367 | Ga0068861_1004483672 | 203 |
| 297 | 3300005834 | Ga0068851_10047113 | Ga0068851_100471133 | 203 |
| 298 | 3300005834 | Ga0068851_10106571 | Ga0068851_101065711 | 203 |
| 299 | 3300005834 | Ga0068851_10382932 | Ga0068851_103829321 | 203 |
| 300 | 3300005840 | Ga0068870_10097830 | Ga0068870_100978303 | 203 |
| 301 | 3300005841 | Ga0068863_100008666 | Ga0068863_1000086666 | 203 |
| 302 | 3300005841 | Ga0068863_100010607 | Ga0068863_1000106075 | 203 |
| 303 | 3300005842 | Ga0068858_100066694 | Ga0068858_1000666942 | 203 |
| 304 | 3300005843 | Ga0068860_100000982 | Ga0068860_1000009826 | 203 |
| 305 | 3300005843 | Ga0068860_100002944 | Ga0068860_1000029443 | 203 |
| 306 | 3300005843 | Ga0068860_100045870 | Ga0068860_1000458706 | 203 |
| 307 | 3300005843 | Ga0068860_100196119 | Ga0068860_1001961192 | 203 |
| 308 | 3300005844 | Ga0068862_100069807 | Ga0068862_1000698072 | 203 |
| 309 | 3300006237 | Ga0097621_100018843 | Ga0097621_1000188432 | 203 |
| 310 | 3300006237 | Ga0097621_100193836 | Ga0097621_1001938362 | 203 |
| 311 | 3300006358 | Ga0068871_100014336 | Ga0068871_1000143367 | 203 |
| 312 | 3300006358 | Ga0068871_100635081 | Ga0068871_1006350811 | 203 |
| 313 | 3300006881 | Ga0068865_100084570 | Ga0068865_1000845702 | 203 |
| 314 | 3300006881 | Ga0068865_100319926 | Ga0068865_1003199262 | 203 |
| 315 | 3300006931 | Ga0097620_100000023 | Ga0097620_100000023194 | 203 |
| 316 | 3300006931 | Ga0097620_100009583 | Ga0097620_1000095833 | 203 |
| 317 | 3300006931 | Ga0097620_100237206 | Ga0097620_1002372062 | 203 |
| 318 | 3300009101 | Ga0105247_10012562 | Ga0105247_100125624 | 203 |
| 319 | 3300009148 | Ga0105243_10305542 | Ga0105243_103055422 | 203 |
| 320 | 3300009174 | Ga0105241_10003636 | Ga0105241_100036363 | 203 |
| 321 | 3300009174 | Ga0105241_10094242 | Ga0105241_100942422 | 203 |
| 322 | 3300009174 | Ga0105241_10502235 | Ga0105241_105022352 | 203 |
| 323 | 3300009174 | Ga0105241_10680451 | Ga0105241_106804512 | 203 |
| 324 | 3300009176 | Ga0105242_10040136 | Ga0105242_100401365 | 203 |
| 325 | 3300009545 | Ga0105237_10002490 | Ga0105237_1000249022 | 203 |
| 326 | 3300009545 | Ga0105237_10008015 | Ga0105237_100080152 | 203 |
| 327 | 3300009553 | Ga0105249_10003768 | Ga0105249_100037683 | 203 |
| 328 | 3300009553 | Ga0105249_10095840 | Ga0105249_100958402 | 203 |
| 329 | 3300010375 | Ga0105239_10165961 | Ga0105239_101659612 | 203 |
| 330 | 3300011119 | Ga0105246_10013049 | Ga0105246_100130494 | 203 |
| 331 | 3300011119 | Ga0105246_10030935 | Ga0105246_100309354 | 203 |
| 332 | 3300011119 | Ga0105246_10605882 | Ga0105246_106058821 | 203 |
| 333 | 3300013296 | Ga0157374_10211073 | Ga0157374_102110732 | 203 |
| 334 | 3300013296 | Ga0157374_10846301 | Ga0157374_108463011 | 203 |
| 335 | 3300013297 | Ga0157378_10006118 | Ga0157378_100061182 | 203 |
| 336 | 3300013297 | Ga0157378_10008930 | Ga0157378_100089306 | 203 |
| 337 | 3300013297 | Ga0157378_10140950 | Ga0157378_101409501 | 203 |
| 338 | 3300013297 | Ga0157378_10192120 | Ga0157378_101921201 | 203 |
| 339 | 3300013306 | Ga0163162_10000798 | Ga0163162_1000079820 | 203 |
| 340 | 3300013306 | Ga0163162_10088913 | Ga0163162_100889134 | 203 |
| 341 | 3300013306 | Ga0163162_10819694 | Ga0163162_108196942 | 203 |
| 342 | 3300013308 | Ga0157375_10287748 | Ga0157375_102877482 | 203 |
| 343 | 3300013308 | Ga0157375_10352945 | Ga0157375_103529452 | 203 |
| 344 | 3300013308 | Ga0157375_10684350 | Ga0157375_106843502 | 203 |
| 345 | 3300014325 | Ga0163163_10052852 | Ga0163163_100528524 | 203 |
| 346 | 3300014325 | Ga0163163_10325190 | Ga0163163_103251901 | 203 |
| 347 | 3300014326 | Ga0157380_10645220 | Ga0157380_106452201 | 203 |
| 348 | 3300014745 | Ga0157377_10003543 | Ga0157377_100035435 | 203 |
| 349 | 3300014745 | Ga0157377_10336118 | Ga0157377_103361182 | 203 |
| 350 | 3300014968 | Ga0157379_10429884 | Ga0157379_104298842 | 203 |
| 351 | 3300014969 | Ga0157376_10002968 | Ga0157376_1000296810 | 203 |
| 352 | 3300025321 | Ga0207656_10038955 | Ga0207656_100389551 | 203 |
| 353 | 3300025321 | Ga0207656_10298621 | Ga0207656_102986211 | 203 |
| 354 | 3300025901 | Ga0207688_10011124 | Ga0207688_100111244 | 203 |
| 355 | 3300025903 | Ga0207680_10000053 | Ga0207680_1000005319 | 203 |
| 356 | 3300025903 | Ga0207680_10041946 | Ga0207680_100419463 | 203 |
| 357 | 3300025907 | Ga0207645_10000713 | Ga0207645_1000071317 | 203 |
| 358 | 3300025907 | Ga0207645_10024429 | Ga0207645_100244292 | 203 |
| 359 | 3300025914 | Ga0207671_10011923 | Ga0207671_100119235 | 203 |
| 360 | 3300025914 | Ga0207671_10022167 | Ga0207671_100221673 | 203 |
| 361 | 3300025919 | Ga0207657_10611932 | Ga0207657_106119321 | 203 |
| 362 | 3300025923 | Ga0207681_10217849 | Ga0207681_102178491 | 203 |
| 363 | 3300025923 | Ga0207681_10456091 | Ga0207681_104560912 | 203 |
| 364 | 3300025925 | Ga0207650_10115723 | Ga0207650_101157232 | 203 |
| 365 | 3300025926 | Ga0207659_10168604 | Ga0207659_101686041 | 203 |
| 366 | 3300025926 | Ga0207659_10529365 | Ga0207659_105293652 | 203 |
| 367 | 3300025931 | Ga0207644_10069571 | Ga0207644_100695712 | 203 |
| 368 | 3300025933 | Ga0207706_10642399 | Ga0207706_106423992 | 203 |
| 369 | 3300025937 | Ga0207669_10010987 | Ga0207669_100109873 | 203 |
| 370 | 3300025937 | Ga0207669_10474033 | Ga0207669_104740332 | 203 |
| 371 | 3300025940 | Ga0207691_10209697 | Ga0207691_102096972 | 203 |
| 372 | 3300025942 | Ga0207689_10004231 | Ga0207689_100042318 | 203 |
| 373 | 3300025942 | Ga0207689_10008218 | Ga0207689_100082188 | 203 |
| 374 | 3300025942 | Ga0207689_10018291 | Ga0207689_100182912 | 203 |
| 375 | 3300025942 | Ga0207689_10032751 | Ga0207689_100327512 | 203 |
| 376 | 3300025942 | Ga0207689_10045837 | Ga0207689_100458373 | 203 |
| 377 | 3300025960 | Ga0207651_10107769 | Ga0207651_101077692 | 203 |
| 378 | 3300025960 | Ga0207651_10180430 | Ga0207651_101804302 | 203 |
| 379 | 3300025960 | Ga0207651_10693835 | Ga0207651_106938351 | 203 |
| 380 | 3300025961 | Ga0207712_10001102 | Ga0207712_100011029 | 203 |
| 381 | 3300025972 | Ga0207668_10328125 | Ga0207668_103281252 | 203 |
| 382 | 3300025986 | Ga0207658_10096741 | Ga0207658_100967412 | 203 |
| 383 | 3300025986 | Ga0207658_10179026 | Ga0207658_101790261 | 203 |
| 384 | 3300025986 | Ga0207658_10183382 | Ga0207658_101833823 | 203 |
| 385 | 3300025986 | Ga0207658_10517879 | Ga0207658_105178792 | 203 |
| 386 | 3300026023 | Ga0207677_10006263 | Ga0207677_100062637 | 203 |
| 387 | 3300026023 | Ga0207677_10281571 | Ga0207677_102815712 | 203 |
| 388 | 3300026035 | Ga0207703_10017807 | Ga0207703_100178075 | 203 |
| 389 | 3300026035 | Ga0207703_10300516 | Ga0207703_103005162 | 203 |
| 390 | 3300026075 | Ga0207708_10062674 | Ga0207708_100626741 | 203 |
| 391 | 3300026088 | Ga0207641_10000202 | Ga0207641_1000020210 | 203 |
| 392 | 3300026088 | Ga0207641_10021200 | Ga0207641_100212002 | 203 |
| 393 | 3300026089 | Ga0207648_10006817 | Ga0207648_100068176 | 203 |
| 394 | 3300026089 | Ga0207648_10162731 | Ga0207648_101627312 | 203 |
| 395 | 3300026089 | Ga0207648_10428514 | Ga0207648_104285142 | 203 |
| 396 | 3300026089 | Ga0207648_10438400 | Ga0207648_104384001 | 203 |
| 397 | 3300026095 | Ga0207676_10639615 | Ga0207676_106396151 | 203 |
| 398 | 3300026118 | Ga0207675_100030578 | Ga0207675_1000305783 | 203 |
| 399 | 3300026118 | Ga0207675_100176410 | Ga0207675_1001764102 | 203 |
| 400 | 3300026121 | Ga0207683_10008436 | Ga0207683_100084366 | 203 |
| 401 | 3300026142 | Ga0207698_10073227 | Ga0207698_100732274 | 203 |
| 402 | 3300026142 | Ga0207698_10109781 | Ga0207698_101097812 | 203 |
| 403 | 3300028379 | Ga0268266_10110768 | Ga0268266_101107682 | 203 |
| 404 | 3300028379 | Ga0268266_10288744 | Ga0268266_102887442 | 203 |
| 405 | 3300028380 | Ga0268265_10239184 | Ga0268265_102391842 | 203 |
| 406 | 3300028381 | Ga0268264_10001699 | Ga0268264_1000169911 | 203 |
| 407 | 3300028381 | Ga0268264_10001731 | Ga0268264_1000173111 | 203 |
| 408 | 3300028381 | Ga0268264_10001913 | Ga0268264_1000191317 | 203 |
| 409 | 3300028381 | Ga0268264_10213012 | Ga0268264_102130121 | 203 |
| 410 | 3300028786 | Ga0307517_10002335 | Ga0307517_1000233521 | 203 |
| 411 | 3300028794 | Ga0307515_10000076 | Ga0307515_10000076206 | 203 |
| 412 | 3300031251 | Ga0265327_10024764 | Ga0265327_100247642 | 203 |
| 413 | 3300031507 | Ga0307509_10091360 | Ga0307509_100913604 | 203 |
| 414 | 3300031595 | Ga0265313_10058156 | Ga0265313_100581563 | 203 |
| 415 | 3300031616 | Ga0307508_10003608 | Ga0307508_1000360813 | 203 |
| 416 | 3300031730 | Ga0307516_10008501 | Ga0307516_100085019 | 203 |
| 417 | 3300049571 | Ga0501034_0287650 | Ga0501034_0287650_641_1312 | 203 |
| 418 | 3300049572 | Ga0501036_0137029 | Ga0501036_0137029_236_907 | 203 |
| 419 | 3300049580 | Ga0501046_0364890 | Ga0501046_0364890_44_715 | 203 |
| 420 | 3300049581 | Ga0501047_0062801 | Ga0501047_0062801_2359_3030 | 203 |
| 421 | 3300049822 | Ga0501035_0048382 | Ga0501035_0048382_207_878 | 203 |
| 422 | 3300053146 | Ga0500588_0035688 | Ga0500588_0035688_519_1178 | 203 |
| 423 | 2162886011 | MRS1b_contig_1310824 | MRS1b_0017.00001620 | 204 |
| 424 | 3300000043 | ARcpr5yngRDRAFT_c005752 | ARcpr5yngRDRAFT_0057522 | 204 |
| 425 | 3300005290 | Ga0065712_10255476 | Ga0065712_102554761 | 204 |
| 426 | 3300005328 | Ga0070676_10165048 | Ga0070676_101650482 | 204 |
| 427 | 3300005329 | Ga0070683_100002968 | Ga0070683_1000029688 | 204 |
| 428 | 3300005330 | Ga0070690_100205100 | Ga0070690_1002051002 | 204 |
| 429 | 3300005344 | Ga0070661_100015221 | Ga0070661_1000152214 | 204 |
| 430 | 3300005353 | Ga0070669_100250908 | Ga0070669_1002509082 | 204 |
| 431 | 3300005354 | Ga0070675_100022391 | Ga0070675_1000223913 | 204 |
| 432 | 3300005364 | Ga0070673_100181985 | Ga0070673_1001819852 | 204 |
| 433 | 3300005365 | Ga0070688_100019508 | Ga0070688_1000195082 | 204 |
| 434 | 3300005366 | Ga0070659_100528695 | Ga0070659_1005286951 | 204 |
| 435 | 3300005455 | Ga0070663_100164210 | Ga0070663_1001642102 | 204 |
| 436 | 3300005459 | Ga0068867_100091448 | Ga0068867_1000914482 | 204 |
| 437 | 3300005466 | Ga0070685_10227720 | Ga0070685_102277201 | 204 |
| 438 | 3300005535 | Ga0070684_100021262 | Ga0070684_1000212624 | 204 |
| 439 | 3300005543 | Ga0070672_100224107 | Ga0070672_1002241072 | 204 |
| 440 | 3300005548 | Ga0070665_100292112 | Ga0070665_1002921122 | 204 |
| 441 | 3300005617 | Ga0068859_100932416 | Ga0068859_1009324161 | 204 |
| 442 | 3300005618 | Ga0068864_100002925 | Ga0068864_1000029256 | 204 |
| 443 | 3300005719 | Ga0068861_100787563 | Ga0068861_1007875631 | 204 |
| 444 | 3300005841 | Ga0068863_100312418 | Ga0068863_1003124182 | 204 |
| 445 | 3300005843 | Ga0068860_100286513 | Ga0068860_1002865132 | 204 |
| 446 | 3300006931 | Ga0097620_100932427 | Ga0097620_1009324271 | 204 |
| 447 | 3300009553 | Ga0105249_10170736 | Ga0105249_101707363 | 204 |
| 448 | 3300013296 | Ga0157374_10029588 | Ga0157374_100295884 | 204 |
| 449 | 3300013306 | Ga0163162_10290588 | Ga0163162_102905882 | 204 |
| 450 | 3300014325 | Ga0163163_10000457 | Ga0163163_100004572 | 204 |
| 451 | 3300014745 | Ga0157377_10098707 | Ga0157377_100987072 | 204 |
| 452 | 3300014969 | Ga0157376_10179380 | Ga0157376_101793802 | 204 |
| 453 | 3300025315 | Ga0207697_10066068 | Ga0207697_100660682 | 204 |
| 454 | 3300025899 | Ga0207642_10337681 | Ga0207642_103376811 | 204 |
| 455 | 3300025904 | Ga0207647_10132119 | Ga0207647_101321192 | 204 |
| 456 | 3300025920 | Ga0207649_10073283 | Ga0207649_100732832 | 204 |
| 457 | 3300025923 | Ga0207681_10109044 | Ga0207681_101090442 | 204 |
| 458 | 3300025926 | Ga0207659_10057168 | Ga0207659_100571682 | 204 |
| 459 | 3300025933 | Ga0207706_10070566 | Ga0207706_100705662 | 204 |
| 460 | 3300025936 | Ga0207670_10023950 | Ga0207670_100239503 | 204 |
| 461 | 3300025940 | Ga0207691_10092990 | Ga0207691_100929902 | 204 |
| 462 | 3300025944 | Ga0207661_10083702 | Ga0207661_100837022 | 204 |
| 463 | 3300025945 | Ga0207679_10011282 | Ga0207679_100112825 | 204 |
| 464 | 3300025960 | Ga0207651_10148701 | Ga0207651_101487012 | 204 |
| 465 | 3300025986 | Ga0207658_10033227 | Ga0207658_100332274 | 204 |
| 466 | 3300026067 | Ga0207678_10053667 | Ga0207678_100536672 | 204 |
| 467 | 3300026089 | Ga0207648_10082249 | Ga0207648_100822493 | 204 |
| 468 | 3300026095 | Ga0207676_10196680 | Ga0207676_101966801 | 204 |
| 469 | 3300028379 | Ga0268266_10099028 | Ga0268266_100990282 | 204 |
| 470 | 3300042876 | Ga0451577_0003916 | Ga0451577_0003916_4329_5063 | 204 |
| 471 | 3300044712 | Ga0453684_1529590 | Ga0453684_1529590_18_674 | 204 |
| 472 | 3300053101 | Ga0500553_107070 | Ga0500553_107070_53_715 | 204 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cgm-assembly2.cif.gz_B | structure of the lipoprotein transporter lola from porphyromonas gingivalis | 0.8547 | 27 | 204 |
| 4ki3-assembly3.cif.gz_I | 1.70 angstrom resolution crystal structure of outer-membrane lipoprotein carrier protein (lola) from yersinia pestis co92 | 0.8067 | 31 | 204 |
| 8cgm-assembly2.cif.gz_B | structure of the lipoprotein transporter lola from porphyromonas gingivalis | 0.8006 | 27 | 204 |
| 4ki3-assembly3.cif.gz_G | 1.70 angstrom resolution crystal structure of outer-membrane lipoprotein carrier protein (lola) from yersinia pestis co92 | 0.8 | 31 | 204 |
| 2zpd-assembly1.cif.gz_A | crystal structure of the r43l mutant of lola in the open form | 0.7998 | 32 | 202 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4DW43_4_102_3.30.1520.10 | Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain | 0.8362 | 116 | 153 | 3.30.1520.10 |
| af_Q55A08_605_716_3.30.1520.10 | Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain | 0.8271 | 113 | 153 | 3.30.1520.10 |
| 4ki3G00 | Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX | 0.8 | 31 | 204 | 2.50.20.10 |
| af_Q8BX57_17_138_3.30.1520.10 | Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain | 0.7796 | 113 | 151 | 3.30.1520.10 |
| 4ki3G00 | Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX | 0.7752 | 31 | 204 | 2.50.20.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6C0GPE3-F1-model_v4 | Outer membrane lipoprotein carrier protein LolA | 0.9223 | 29 | 204 |
|
| AF-A0A5J4STK1-F1-model_v4 | Outer-membrane lipoprotein carrier protein | 0.916 | 29 | 204 |
|
| AF-A0A3B9C6D0-F1-model_v4 | Outer membrane lipoprotein carrier protein LolA | 0.9108 | 22 | 204 |
GO:0016020
|
| AF-R6E4K3-F1-model_v4 | Outer membrane lipoprotein carrier protein LolA | 0.9101 | 27 | 204 |
|
| AF-A0A7C1AM22-F1-model_v4 | Outer-membrane lipoprotein carrier protein | 0.9043 | 28 | 204 |
GO:0042597
GO:0042953 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar