F450798

General Info

Members Datasets Scaffolds Average Seq Length
472 210 944 379

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10224545|Ga0105237_102245452
Length 383
Sequence VNIHEYQAKELLRKEGVPIPPGEVARSAADAEAIARKFGTTVVVKAQVHAGGRGKAGGVKLAKTPEETREIASKILGMQIKGLTVEQVLVTPAADIATEAYAGIILDRASKKPVFMVSPAGGIDIEEVAAKTPDKILKLPIDTRYGLQPYQASRLGFFLYNDVKQVRAAGKIMQQLYAAFMKNGCSLAEINPLVTTPAPAGDVVALDAKMVIDDNELDRHPEIAALRDESAEAPSEVLARNANLTFIKLDGDVGCVVNGAGLAMATMDLVKYYGGDPANFLDIGGSSNPEKVVNALKIITADKNVKAILFNIFGGITRTDDVANGIVTATKQNPLKVPLVIRLTGTNEEIAMKILQENGFSASSDMDEAVKSAVALAKGGKTA

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
127 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
128 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
208 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
209 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.66
Rhizosphere 95.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10224545 3300009545 Bacteria 1879
2 Ga0065715_10098860 3300005293 Bacteria 3489
3 Ga0065715_10128473 3300005293 Bacteria 2065
4 Ga0070683_100002094 3300005329 Bacteria 15750
5 Ga0070683_100002685 3300005329 Bacteria 14217
6 Ga0070683_100004245 3300005329 Bacteria 11755
7 Ga0070683_100069292 3300005329 Bacteria 3288
8 Ga0070666_10108901 3300005335 Bacteria 1914
9 Ga0070680_100008954 3300005336 Bacteria 7673
10 Ga0070680_100016225 3300005336 Bacteria 5859
11 Ga0070680_100054435 3300005336 Bacteria 3267
12 Ga0070680_100200852 3300005336 Bacteria 1681
13 Ga0070682_100003413 3300005337 Bacteria 8808
14 Ga0070682_100007210 3300005337 Bacteria 6266
15 Ga0070660_100011352 3300005339 Bacteria 6325
16 Ga0070687_100014945 3300005343 Bacteria 3499
17 Ga0070661_100000287 3300005344 Bacteria 40709
18 Ga0070661_100001847 3300005344 Bacteria 14669
19 Ga0070692_10003088 3300005345 Bacteria 6661
20 Ga0070675_100007545 3300005354 Bacteria 8410
21 Ga0070674_100049597 3300005356 Bacteria 2887
22 Ga0070659_100002757 3300005366 Bacteria 12502
23 Ga0070659_100042403 3300005366 Bacteria 3557
24 Ga0070703_10034308 3300005406 Bacteria 1548
25 Ga0070701_10040231 3300005438 Bacteria 2375
26 Ga0070711_100000082 3300005439 Bacteria 52402
27 Ga0070711_100000573 3300005439 Bacteria 19204
28 Ga0070711_100057540 3300005439 Bacteria 2692
29 Ga0070705_100009040 3300005440 Bacteria 4947
30 Ga0070705_100016809 3300005440 Bacteria 3808
31 Ga0070705_100051382 3300005440 Bacteria 2403
32 Ga0070705_100074493 3300005440 Bacteria 2064
33 Ga0070705_100112086 3300005440 Bacteria 1745
34 Ga0070700_100169998 3300005441 Bacteria 1509
35 Ga0070694_100003011 3300005444 Bacteria 10027
36 Ga0070694_100005760 3300005444 Bacteria 7515
37 Ga0070694_100008762 3300005444 Bacteria 6197
38 Ga0070694_100008848 3300005444 Bacteria 6168
39 Ga0070694_100040204 3300005444 Bacteria 3117
40 Ga0070694_100043719 3300005444 Bacteria 2996
41 Ga0070694_100059352 3300005444 Bacteria 2605
42 Ga0070708_100017445 3300005445 Bacteria 5989
43 Ga0070662_100027639 3300005457 Bacteria 3941
44 Ga0070681_10000220 3300005458 Bacteria 44725
45 Ga0070681_10000222 3300005458 Bacteria 44616
46 Ga0070681_10000726 3300005458 Bacteria 27264
47 Ga0070681_10003763 3300005458 Bacteria 14243
48 Ga0070681_10024220 3300005458 Bacteria 6111
49 Ga0070681_10060340 3300005458 Bacteria 3770
50 Ga0070681_10106650 3300005458 Bacteria 2743
51 Ga0070681_10183775 3300005458 Bacteria 2012
52 Ga0068867_100054594 3300005459 Bacteria 2951
53 Ga0070706_100005320 3300005467 Bacteria 12265
54 Ga0070706_100042358 3300005467 Bacteria 4206
55 Ga0070706_100147372 3300005467 Bacteria 2198
56 Ga0070706_100151017 3300005467 Bacteria 2168
57 Ga0070707_100017132 3300005468 Bacteria 6806
58 Ga0070707_100023089 3300005468 Bacteria 5885
59 Ga0070707_100047117 3300005468 Bacteria 4126
60 Ga0070707_100073228 3300005468 Bacteria 3302
61 Ga0070707_100152149 3300005468 Bacteria 2253
62 Ga0070698_100001463 3300005471 Bacteria 26218
63 Ga0070698_100004261 3300005471 Bacteria 15721
64 Ga0070698_100013098 3300005471 Bacteria 8778
65 Ga0070698_100021370 3300005471 Bacteria 6780
66 Ga0070698_100108802 3300005471 Bacteria 2739
67 Ga0070698_100326694 3300005471 Bacteria 1465
68 Ga0070699_100001850 3300005518 Bacteria 19198
69 Ga0070699_100025783 3300005518 Bacteria 5066
70 Ga0070699_100044119 3300005518 Bacteria 3860
71 Ga0070699_100105342 3300005518 Bacteria 2474
72 Ga0070699_100179129 3300005518 Bacteria 1880
73 Ga0070699_100359878 3300005518 Bacteria 1312
74 Ga0070679_100000984 3300005530 Bacteria 24839
75 Ga0070679_100002501 3300005530 Bacteria 16651
76 Ga0070679_100005314 3300005530 Bacteria 11919
77 Ga0070679_100009033 3300005530 Bacteria 9401
78 Ga0070679_100012558 3300005530 Bacteria 8100
79 Ga0070679_100064432 3300005530 Bacteria 3653
80 Ga0070679_100278712 3300005530 Bacteria 1625
81 Ga0070684_100006639 3300005535 Bacteria 8963
82 Ga0070684_100009012 3300005535 Bacteria 7839
83 Ga0070684_100018786 3300005535 Bacteria 5703
84 Ga0070684_100222797 3300005535 Bacteria 1721
85 Ga0070697_100011123 3300005536 Bacteria 7033
86 Ga0070697_100094493 3300005536 Bacteria 2477
87 Ga0070697_100237933 3300005536 Bacteria 1554
88 Ga0070695_100021285 3300005545 Bacteria 3966
89 Ga0070695_100114728 3300005545 Bacteria 1834
90 Ga0070696_100000915 3300005546 Bacteria 19198
91 Ga0070696_100022475 3300005546 Bacteria 4285
92 Ga0070696_100034962 3300005546 Bacteria 3458
93 Ga0070696_100053238 3300005546 Bacteria 2817
94 Ga0070696_100057564 3300005546 Bacteria 2713
95 Ga0070696_100074454 3300005546 Bacteria 2395
96 Ga0070696_100075102 3300005546 Bacteria 2384
97 Ga0070696_100135222 3300005546 Bacteria 1797
98 Ga0070665_100199451 3300005548 Bacteria 2002
99 Ga0070704_100000705 3300005549 Bacteria 16279
100 Ga0070704_100002345 3300005549 Bacteria 10623
101 Ga0070704_100005744 3300005549 Bacteria 7255
102 Ga0070704_100006296 3300005549 Bacteria 6992
103 Ga0070704_100024299 3300005549 Bacteria 3975
104 Ga0070704_100034163 3300005549 Bacteria 3445
105 Ga0070704_100045220 3300005549 Bacteria 3062
106 Ga0068855_100050653 3300005563 Bacteria 4892
107 Ga0068857_100018279 3300005577 Bacteria 6149
108 Ga0068857_100020332 3300005577 Bacteria 5838
109 Ga0068856_100000868 3300005614 Bacteria 32382
110 Ga0070702_100012813 3300005615 Bacteria 4218
111 Ga0068852_100201382 3300005616 Bacteria 1884
112 Ga0068859_100003718 3300005617 Bacteria 15552
113 Ga0068859_100047585 3300005617 Bacteria 4309
114 Ga0068870_10010131 3300005840 Bacteria 4314
115 Ga0068863_100001868 3300005841 Bacteria 20951
116 Ga0068860_100017133 3300005843 Bacteria 7063
117 Ga0070716_100001934 3300006173 Bacteria 9420
118 Ga0070716_100025460 3300006173 Bacteria 3157
119 Ga0097621_100078013 3300006237 Bacteria 2751
120 Ga0075428_100039444 3300006844 Bacteria 5198
121 Ga0075428_100193307 3300006844 Bacteria 2201
122 Ga0075428_100401025 3300006844 Bacteria 1470
123 Ga0075430_100056763 3300006846 Bacteria 3293
124 Ga0075431_100003686 3300006847 Bacteria 14880
125 Ga0075431_100012418 3300006847 Bacteria 8596
126 Ga0075431_100014047 3300006847 Bacteria 8092
127 Ga0075431_100144598 3300006847 Bacteria 2450
128 Ga0075431_100248680 3300006847 Bacteria 1807
129 Ga0075431_100253495 3300006847 Bacteria 1787
130 Ga0075431_100268131 3300006847 Bacteria 1731
131 Ga0075433_10032950 3300006852 Bacteria 4440
132 Ga0075433_10039310 3300006852 Bacteria 4090
133 Ga0075433_10040789 3300006852 Bacteria 4020
134 Ga0075434_100003859 3300006871 Bacteria 13410
135 Ga0075434_100005740 3300006871 Bacteria 11331
136 Ga0075434_100014059 3300006871 Bacteria 7643
137 Ga0075434_100034342 3300006871 Bacteria 5008
138 Ga0075434_100130361 3300006871 Bacteria 2533
139 Ga0075434_100209499 3300006871 Bacteria 1969
140 Ga0075429_100018382 3300006880 Bacteria 6054
141 Ga0075429_100037167 3300006880 Bacteria 4238
142 Ga0075429_100061347 3300006880 Bacteria 3276
143 Ga0068865_100042657 3300006881 Bacteria 3095
144 Ga0075436_100002864 3300006914 Bacteria 11815
145 Ga0075436_100017210 3300006914 Bacteria 4946
146 Ga0075436_100032075 3300006914 Bacteria 3620
147 Ga0075436_100035279 3300006914 Bacteria 3451
148 Ga0075436_100099580 3300006914 Bacteria 2024
149 Ga0097620_100003718 3300006931 Bacteria 15552
150 Ga0097620_100047588 3300006931 Bacteria 4309
151 Ga0075435_100003405 3300007076 Bacteria 10786
152 Ga0075435_100010728 3300007076 Bacteria 6709
153 Ga0075435_100072953 3300007076 Bacteria 2805
154 Ga0099794_10000064 3300007265 Bacteria 40634
155 Ga0099794_10007390 3300007265 Bacteria 4511
156 Ga0099794_10011699 3300007265 Bacteria 3764
157 Ga0105240_10003063 3300009093 Bacteria 26282
158 Ga0105240_10185144 3300009093 Bacteria 2453
159 Ga0111539_10127760 3300009094 Bacteria 2977
160 Ga0111539_10178060 3300009094 Bacteria 2484
161 Ga0105245_10023306 3300009098 Bacteria 5433
162 Ga0114129_10000112 3300009147 Bacteria 80956
163 Ga0114129_10018629 3300009147 Bacteria 9883
164 Ga0114129_10065322 3300009147 Bacteria 5078
165 Ga0114129_10092821 3300009147 Bacteria 4182
166 Ga0114129_10692812 3300009147 Bacteria 1310
167 Ga0105241_10130064 3300009174 Bacteria 2037
168 Ga0105241_10185195 3300009174 Bacteria 1730
169 Ga0105242_10008031 3300009176 Bacteria 8125
170 Ga0105248_10003770 3300009177 Bacteria 16785
171 Ga0105238_10032258 3300009551 Bacteria 5330
172 Ga0105239_10003966 3300010375 Bacteria 17933
173 Ga0105239_10010959 3300010375 Bacteria 10124
174 Ga0105246_10001860 3300011119 Bacteria 12702
175 Ga0157373_10019767 3300013100 Bacteria 4898
176 Ga0157370_10003876 3300013104 Bacteria 17427
177 Ga0157370_10007972 3300013104 Bacteria 11475
178 Ga0157369_10066337 3300013105 Bacteria 3883
179 Ga0157374_10002627 3300013296 Bacteria 15149
180 Ga0157374_10348829 3300013296 Bacteria 1470
181 Ga0157372_10001141 3300013307 Bacteria 28828
182 Ga0157372_10004069 3300013307 Bacteria 15676
183 Ga0157372_10005318 3300013307 Bacteria 13672
184 Ga0157372_10039056 3300013307 Bacteria 5239
185 Ga0157372_10289847 3300013307 Bacteria 1904
186 Ga0163163_10012700 3300014325 Bacteria 7683
187 Ga0157377_10002831 3300014745 Bacteria 7746
188 Ga0207653_10000053 3300025885 Bacteria 87641
189 Ga0207653_10014630 3300025885 Bacteria 2462
190 Ga0207680_10087583 3300025903 Bacteria 1972
191 Ga0207647_10040751 3300025904 Bacteria 2923
192 Ga0207699_10000701 3300025906 Bacteria 15991
193 Ga0207699_10012883 3300025906 Bacteria 4261
194 Ga0207645_10060758 3300025907 Bacteria 2413
195 Ga0207643_10017176 3300025908 Bacteria 3952
196 Ga0207705_10004001 3300025909 Bacteria 11213
197 Ga0207684_10018464 3300025910 Bacteria 5972
198 Ga0207684_10026663 3300025910 Bacteria 4926
199 Ga0207684_10049407 3300025910 Bacteria 3568
200 Ga0207654_10148971 3300025911 Bacteria 1500
201 Ga0207654_10177276 3300025911 Bacteria 1388
202 Ga0207707_10000368 3300025912 Bacteria 47267
203 Ga0207707_10000450 3300025912 Bacteria 42820
204 Ga0207707_10001363 3300025912 Bacteria 22677
205 Ga0207707_10001633 3300025912 Bacteria 20685
206 Ga0207707_10001930 3300025912 Bacteria 18855
207 Ga0207707_10002467 3300025912 Bacteria 16652
208 Ga0207707_10026467 3300025912 Bacteria 5070
209 Ga0207707_10027595 3300025912 Bacteria 4964
210 Ga0207695_10002777 3300025913 Bacteria 25479
211 Ga0207695_10014185 3300025913 Bacteria 9454
212 Ga0207671_10111337 3300025914 Bacteria 2083
213 Ga0207693_10077341 3300025915 Bacteria 2606
214 Ga0207663_10000059 3300025916 Bacteria 56317
215 Ga0207663_10062520 3300025916 Bacteria 2367
216 Ga0207660_10005308 3300025917 Bacteria 8379
217 Ga0207660_10006044 3300025917 Bacteria 7859
218 Ga0207660_10008884 3300025917 Bacteria 6495
219 Ga0207660_10009491 3300025917 Bacteria 6298
220 Ga0207660_10019393 3300025917 Bacteria 4546
221 Ga0207660_10055847 3300025917 Bacteria 2824
222 Ga0207662_10012923 3300025918 Bacteria 4660
223 Ga0207649_10005833 3300025920 Bacteria 6667
224 Ga0207649_10046564 3300025920 Bacteria 2665
225 Ga0207652_10000841 3300025921 Bacteria 29282
226 Ga0207652_10001054 3300025921 Bacteria 25084
227 Ga0207652_10005142 3300025921 Bacteria 10613
228 Ga0207652_10006293 3300025921 Bacteria 9584
229 Ga0207652_10007085 3300025921 Bacteria 9034
230 Ga0207652_10008884 3300025921 Bacteria 8094
231 Ga0207652_10013334 3300025921 Bacteria 6656
232 Ga0207652_10094139 3300025921 Bacteria 2638
233 Ga0207646_10002302 3300025922 Bacteria 22670
234 Ga0207646_10006162 3300025922 Bacteria 12466
235 Ga0207646_10028648 3300025922 Bacteria 5067
236 Ga0207646_10085610 3300025922 Bacteria 2819
237 Ga0207646_10104762 3300025922 Bacteria 2537
238 Ga0207681_10038942 3300025923 Bacteria 3153
239 Ga0207694_10041673 3300025924 Bacteria 3538
240 Ga0207659_10033263 3300025926 Bacteria 3547
241 Ga0207659_10064612 3300025926 Bacteria 2649
242 Ga0207687_10029340 3300025927 Bacteria 3699
243 Ga0207687_10044267 3300025927 Bacteria 3071
244 Ga0207690_10037668 3300025932 Bacteria 3142
245 Ga0207669_10133924 3300025937 Bacteria 1708
246 Ga0207704_10004355 3300025938 Bacteria 6473
247 Ga0207665_10004482 3300025939 Bacteria 9270
248 Ga0207665_10028784 3300025939 Bacteria 3672
249 Ga0207665_10063436 3300025939 Bacteria 2509
250 Ga0207711_10068056 3300025941 Bacteria 3083
251 Ga0207689_10004826 3300025942 Bacteria 12161
252 Ga0207661_10004386 3300025944 Bacteria 9890
253 Ga0207661_10005288 3300025944 Bacteria 9086
254 Ga0207661_10005969 3300025944 Bacteria 8599
255 Ga0207661_10006215 3300025944 Bacteria 8447
256 Ga0207661_10232408 3300025944 Bacteria 1633
257 Ga0207679_10001487 3300025945 Bacteria 14673
258 Ga0207679_10106235 3300025945 Bacteria 2206
259 Ga0207667_10021020 3300025949 Bacteria 7238
260 Ga0207667_10152601 3300025949 Bacteria 2377
261 Ga0207651_10039638 3300025960 Bacteria 3108
262 Ga0207668_10014006 3300025972 Bacteria 4956
263 Ga0207668_10020925 3300025972 Bacteria 4166
264 Ga0207640_10000433 3300025981 Bacteria 25514
265 Ga0207703_10091943 3300026035 Bacteria 2553
266 Ga0207678_10131844 3300026067 Bacteria 2132
267 Ga0207678_10159242 3300026067 Bacteria 1928
268 Ga0207702_10183152 3300026078 Bacteria 1930
269 Ga0207641_10011787 3300026088 Bacteria 7178
270 Ga0207676_10001153 3300026095 Bacteria 19908
271 Ga0207674_10000603 3300026116 Bacteria 47253
272 Ga0207674_10004722 3300026116 Bacteria 16334
273 Ga0207675_100009617 3300026118 Bacteria 9046
274 Ga0207698_10021878 3300026142 Bacteria 4431
275 Ga0207698_10107767 3300026142 Bacteria 2327
276 Ga0209588_1000495 3300027671 Bacteria 10089
277 Ga0207428_10141627 3300027907 Bacteria 1835
278 Ga0268266_10240794 3300028379 Bacteria 1670
279 Ga0268265_10315755 3300028380 Bacteria 1413
280 Ga0268264_10018948 3300028381 Bacteria 5627
281 Ga0268264_10098387 3300028381 Bacteria 2537
282 Ga0265338_10019338 3300028800 Bacteria 7231
283 Ga0265340_10004971 3300031247 Bacteria 7392
284 Ga0265331_10008976 3300031250 Bacteria 5648
285 Ga0307408_100014870 3300031548 Bacteria 5176
286 Ga0307408_100039789 3300031548 Bacteria 3326
287 Ga0307408_100040103 3300031548 Bacteria 3314
288 Ga0307408_100097010 3300031548 Bacteria 2238
289 Ga0316575_10002134 3300031665 Bacteria 6602
290 Ga0316578_10015010 3300031728 Bacteria 4155
291 Ga0316577_10044108 3300031733 Bacteria 2494
292 Ga0307413_10018033 3300031824 Bacteria 3692
293 Ga0307413_10030447 3300031824 Bacteria 3032
294 Ga0307413_10110655 3300031824 Bacteria 1838
295 Ga0307413_10143453 3300031824 Bacteria 1653
296 Ga0307410_10013979 3300031852 Bacteria 4705
297 Ga0307410_10028026 3300031852 Bacteria 3567
298 Ga0307410_10066775 3300031852 Bacteria 2479
299 Ga0307406_10028941 3300031901 Bacteria 3350
300 Ga0307406_10072890 3300031901 Bacteria 2256
301 Ga0307407_10015206 3300031903 Bacteria 3795
302 Ga0307412_10116741 3300031911 Bacteria 1915
303 Ga0307409_100006156 3300031995 Bacteria 7017
304 Ga0307409_100044890 3300031995 Bacteria 3332
305 Ga0307409_100054702 3300031995 Bacteria 3076
306 Ga0307409_100062349 3300031995 Bacteria 2918
307 Ga0307409_100177378 3300031995 Bacteria 1882
308 Ga0307409_100404416 3300031995 Bacteria 1305
309 Ga0307416_100013565 3300032002 Bacteria 5545
310 Ga0307416_100016567 3300032002 Bacteria 5128
311 Ga0307416_100046245 3300032002 Bacteria 3433
312 Ga0307416_100148045 3300032002 Bacteria 2148
313 Ga0307416_100184467 3300032002 Bacteria 1959
314 Ga0307416_100195837 3300032002 Bacteria 1911
315 Ga0307416_100490868 3300032002 Bacteria 1290
316 Ga0307414_10020935 3300032004 Bacteria 4089
317 Ga0307414_10044797 3300032004 Bacteria 3025
318 Ga0307414_10134862 3300032004 Bacteria 1923
319 Ga0307414_10219055 3300032004 Bacteria 1561
320 Ga0307414_10253214 3300032004 Bacteria 1465
321 Ga0307411_10004817 3300032005 Bacteria 6542
322 Ga0307411_10055228 3300032005 Bacteria 2612
323 Ga0307411_10078708 3300032005 Bacteria 2261
324 Ga0307415_100016475 3300032126 Bacteria 4408
325 Ga0307415_100038829 3300032126 Bacteria 3141
326 Ga0373929_0012075 3300035085 Bacteria 1637
327 Ga0373943_0011813 3300035170 Bacteria 3929
328 Ga0316574_0010434 3300035398 Bacteria 5250
329 Ga0373935_0015351 3300035692 Bacteria 4629
330 Ga0373925_0128215 3300037068 Bacteria 1976
331 Ga0395905_0033015 3300037471 Bacteria 4866
332 Ga0453683_0015544 3300044673 Bacteria 4926
333 Ga0451576_0008943 3300045051 Bacteria 11682
334 Ga0451576_0087198 3300045051 Bacteria 3246
335 Ga0451576_0219021 3300045051 Bacteria 1987
336 Ga0451576_0456531 3300045051 Bacteria 1341
337 Ga0495629_0021467 3300046459 Bacteria 4608
338 Ga0495582_0038485 3300046473 Bacteria 2632
339 Ga0495630_0054254 3300046517 Bacteria 3003
340 Ga0495652_0065265 3300046529 Bacteria 3059
341 Ga0495587_0069582 3300046536 Bacteria 2049
342 Ga0495609_0054321 3300046538 Bacteria 1779
343 Ga0495667_0032798 3300046559 Bacteria 3477
344 Ga0495599_0018285 3300046678 Bacteria 4367
345 Ga0495623_0015531 3300046679 Bacteria 4923
346 Ga0495658_0130291 3300046683 Bacteria 1530
347 Ga0495613_0141321 3300046689 Bacteria 1720
348 Ga0495674_0202474 3300047319 Bacteria 1646
349 Ga0495680_0013936 3300047322 Bacteria 6991
350 Ga0495675_0019744 3300047444 Bacteria 4282
351 Ga0495684_0053435 3300047471 Bacteria 3082
352 Ga0496102_0003544 3300048905 Bacteria 13220
353 Ga0496103_0023747 3300048906 Bacteria 3697
354 Ga0496104_0013041 3300048907 Bacteria 7486
355 Ga0496106_0019721 3300048909 Bacteria 5001
356 Ga0496108_0001015 3300048911 Bacteria 21893
357 Ga0496108_0004033 3300048911 Bacteria 11788
358 Ga0496108_0010854 3300048911 Bacteria 7394
359 Ga0496108_0020311 3300048911 Bacteria 5459
360 Ga0496109_0001618 3300048912 Bacteria 18825
361 Ga0496109_0003846 3300048912 Bacteria 12538
362 Ga0496109_0007999 3300048912 Bacteria 8964
363 Ga0496110_0012437 3300048913 Bacteria 6999
364 Ga0496110_0042500 3300048913 Bacteria 3967
365 Ga0496111_0008134 3300048914 Bacteria 6929
366 Ga0496112_0000777 3300048915 Bacteria 22477
367 Ga0496112_0001653 3300048915 Bacteria 17323
368 Ga0496112_0006373 3300048915 Bacteria 10357
369 Ga0496112_0041621 3300048915 Bacteria 4495
370 Ga0496112_0085064 3300048915 Bacteria 3129
371 Ga0496112_0087659 3300048915 Bacteria 3080
372 Ga0496113_0000735 3300048916 Bacteria 16815
373 Ga0496113_0020939 3300048916 Bacteria 4607
374 Ga0501033_0072320 3300049570 Bacteria 2532
375 Ga0501034_0000957 3300049571 Bacteria 41717
376 Ga0501038_0072857 3300049574 Bacteria 2910
377 Ga0501040_0006613 3300049576 Bacteria 7525
378 Ga0501041_0026804 3300049577 Bacteria 3470
379 Ga0501041_0037122 3300049577 Bacteria 2951
380 Ga0501043_0086265 3300049579 Bacteria 2467
381 Ga0501046_0064306 3300049580 Bacteria 2864
382 Ga0501048_0082119 3300049582 Bacteria 2273
383 Ga0501048_0098761 3300049582 Bacteria 2059
384 Ga0501067_0000453 3300049583 Bacteria 22520
385 Ga0501068_0000075 3300049584 Bacteria 39857
386 Ga0501068_0003185 3300049584 Bacteria 8785
387 Ga0501069_0000201 3300049585 Bacteria 26361
388 Ga0501069_0000583 3300049585 Bacteria 16870
389 Ga0501069_0047293 3300049585 Bacteria 2388
390 Ga0501069_0055970 3300049585 Bacteria 2197
391 Ga0501070_0002218 3300049586 Bacteria 17067
392 Ga0501070_0011931 3300049586 Bacteria 7340
393 Ga0501070_0023072 3300049586 Bacteria 5211
394 Ga0501071_0000468 3300049587 Bacteria 20369
395 Ga0501072_0002414 3300049588 Bacteria 14002
396 Ga0501072_0035173 3300049588 Bacteria 3926
397 Ga0501072_0103730 3300049588 Bacteria 2260
398 Ga0501073_0001702 3300049589 Bacteria 16308
399 Ga0501073_0022832 3300049589 Bacteria 4499
400 Ga0501073_0231565 3300049589 Bacteria 1276
401 Ga0501074_0000981 3300049590 Bacteria 18483
402 Ga0501074_0007090 3300049590 Bacteria 8099
403 Ga0501075_0011295 3300049591 Bacteria 6318
404 Ga0501075_0019260 3300049591 Bacteria 4949
405 Ga0501076_0065357 3300049592 Bacteria 2900
406 Ga0501076_0080854 3300049592 Bacteria 2609
407 Ga0501077_0000496 3300049593 Bacteria 23850
408 Ga0501077_0038803 3300049593 Bacteria 3033
409 Ga0501225_0012378 3300049705 Bacteria 2397
410 Ga0501079_0001564 3300049741 Bacteria 16235
411 Ga0501079_0025882 3300049741 Bacteria 4501
412 Ga0501079_0114794 3300049741 Bacteria 2093
413 Ga0501079_0221240 3300049741 Bacteria 1479
414 Ga0501080_0008511 3300049742 Bacteria 9302
415 Ga0501080_0052966 3300049742 Bacteria 3777
416 Ga0501080_0064315 3300049742 Bacteria 3413
417 Ga0501080_0103847 3300049742 Bacteria 2636
418 Ga0501081_0041688 3300049743 Bacteria 3144
419 Ga0501083_0000108 3300049744 Bacteria 55825
420 Ga0501083_0039414 3300049744 Bacteria 3209
421 Ga0501083_0069169 3300049744 Bacteria 2349
422 Ga0501045_0028789 3300049824 Bacteria 4009
423 Ga0501045_0060838 3300049824 Bacteria 2769
424 Ga0501045_0120389 3300049824 Bacteria 1949
425 Ga0501212_006467 3300049851 Bacteria 1581
426 nmdc:mga05p37_164019_c1 3300050507 Bacteria 2712
427 nmdc:mga05p37_169493_c1 3300050507 Bacteria 2663
428 nmdc:mga05p37_30321_c1 3300050507 Bacteria 6599
429 nmdc:mga05p37_61590_c1 3300050507 Bacteria 4619
430 nmdc:mga09592_7438_c1 3300050508 Bacteria 8901
431 nmdc:mga06r32_156890_c1 3300050510 Bacteria 2257
432 nmdc:mga06r32_20680_c1 3300050510 Bacteria 6062
433 nmdc:mga06r32_210307_c1 3300050510 Bacteria 1933
434 nmdc:mga06r32_59414_c1 3300050510 Bacteria 3677
435 nmdc:mga06r32_65952_c1 3300050510 Bacteria 3493
436 nmdc:mga06r32_80809_c1 3300050510 Bacteria 3164
437 nmdc:mga06r32_84086_c1 3300050510 Bacteria 3101
438 nmdc:mga08y16_155541_c1 3300050511 Bacteria 2376
439 nmdc:mga08y16_353730_c1 3300050511 Bacteria 1508
440 nmdc:mga08y16_59890_c1 3300050511 Bacteria 3977
441 nmdc:mga0n895_121487_c1 3300050512 Bacteria 2633
442 nmdc:mga0n895_211399_c1 3300050512 Bacteria 1970
443 nmdc:mga0n895_335909_c1 3300050512 Bacteria 1531
444 nmdc:mga0n895_4186_c1 3300050512 Bacteria 11783
445 nmdc:mga0n895_5496_c1 3300050512 Bacteria 10603
446 nmdc:mga0n895_7803_c1 3300050512 Bacteria 9223
447 nmdc:mga0n895_8321_c1 3300050512 Bacteria 8975
448 nmdc:mga0rr50_20996_c1 3300050513 Bacteria 4449
449 nmdc:mga0rr50_40456_c1 3300050513 Bacteria 3390
450 nmdc:mga0rr50_54309_c1 3300050513 Bacteria 2984
451 nmdc:mga0rr50_69720_c1 3300050513 Bacteria 2677
452 nmdc:mga08x19_3259_c1 3300050514 Bacteria 9722
453 nmdc:mga08x19_33165_c1 3300050514 Bacteria 3258
454 nmdc:mga08x19_38161_c1 3300050514 Bacteria 3051
455 nmdc:mga08x19_47576_c1 3300050514 Bacteria 2746
456 nmdc:mga08x19_67400_c1 3300050514 Bacteria 2328
457 nmdc:mga0a205_101603_c2 3300050515 Bacteria 2239
458 nmdc:mga0a205_179656_c1 3300050515 Bacteria 2010
459 nmdc:mga0a205_25391_c1 3300050515 Bacteria 5646
460 nmdc:mga0a205_3572_c1 3300050515 Bacteria 13925
461 nmdc:mga0a205_6150_c1 3300050515 Bacteria 10829
462 Ga0501084_0001381 3300054114 Bacteria 19208
463 Ga0501084_0009078 3300054114 Bacteria 8227
464 Ga0501084_0021189 3300054114 Bacteria 5420
465 Ga0501084_0214163 3300054114 Bacteria 1625
466 Ga0590071_000448 3300059421 Bacteria 11963
467 Ga0590075_004532 3300059424 Bacteria 3292
468 Ga0590077_014935 3300059426 Bacteria 1620
469 Ga0590077_020153 3300059426 Bacteria 1415
470 Ga0501082_0001928 3300060353 Bacteria 18242
471 Ga0501082_0026327 3300060353 Bacteria 5011
472 Ga0501082_0048209 3300060353 Bacteria 3671
473 Ga0105237_10224545
474 Ga0065715_10098860
475 Ga0065715_10128473
476 Ga0070683_100002094
477 Ga0070683_100002685
478 Ga0070683_100004245
479 Ga0070683_100069292
480 Ga0070666_10108901
481 Ga0070680_100008954
482 Ga0070680_100016225
483 Ga0070680_100054435
484 Ga0070680_100200852
485 Ga0070682_100003413
486 Ga0070682_100007210
487 Ga0070660_100011352
488 Ga0070687_100014945
489 Ga0070661_100000287
490 Ga0070661_100001847
491 Ga0070692_10003088
492 Ga0070675_100007545
493 Ga0070674_100049597
494 Ga0070659_100002757
495 Ga0070659_100042403
496 Ga0070703_10034308
497 Ga0070701_10040231
498 Ga0070711_100000082
499 Ga0070711_100000573
500 Ga0070711_100057540
501 Ga0070705_100009040
502 Ga0070705_100016809
503 Ga0070705_100051382
504 Ga0070705_100074493
505 Ga0070705_100112086
506 Ga0070700_100169998
507 Ga0070694_100003011
508 Ga0070694_100005760
509 Ga0070694_100008762
510 Ga0070694_100008848
511 Ga0070694_100040204
512 Ga0070694_100043719
513 Ga0070694_100059352
514 Ga0070708_100017445
515 Ga0070662_100027639
516 Ga0070681_10000220
517 Ga0070681_10000222
518 Ga0070681_10000726
519 Ga0070681_10003763
520 Ga0070681_10024220
521 Ga0070681_10060340
522 Ga0070681_10106650
523 Ga0070681_10183775
524 Ga0068867_100054594
525 Ga0070706_100005320
526 Ga0070706_100042358
527 Ga0070706_100147372
528 Ga0070706_100151017
529 Ga0070707_100017132
530 Ga0070707_100023089
531 Ga0070707_100047117
532 Ga0070707_100073228
533 Ga0070707_100152149
534 Ga0070698_100001463
535 Ga0070698_100004261
536 Ga0070698_100013098
537 Ga0070698_100021370
538 Ga0070698_100108802
539 Ga0070698_100326694
540 Ga0070699_100001850
541 Ga0070699_100025783
542 Ga0070699_100044119
543 Ga0070699_100105342
544 Ga0070699_100179129
545 Ga0070699_100359878
546 Ga0070679_100000984
547 Ga0070679_100002501
548 Ga0070679_100005314
549 Ga0070679_100009033
550 Ga0070679_100012558
551 Ga0070679_100064432
552 Ga0070679_100278712
553 Ga0070684_100006639
554 Ga0070684_100009012
555 Ga0070684_100018786
556 Ga0070684_100222797
557 Ga0070697_100011123
558 Ga0070697_100094493
559 Ga0070697_100237933
560 Ga0070695_100021285
561 Ga0070695_100114728
562 Ga0070696_100000915
563 Ga0070696_100022475
564 Ga0070696_100034962
565 Ga0070696_100053238
566 Ga0070696_100057564
567 Ga0070696_100074454
568 Ga0070696_100075102
569 Ga0070696_100135222
570 Ga0070665_100199451
571 Ga0070704_100000705
572 Ga0070704_100002345
573 Ga0070704_100005744
574 Ga0070704_100006296
575 Ga0070704_100024299
576 Ga0070704_100034163
577 Ga0070704_100045220
578 Ga0068855_100050653
579 Ga0068857_100018279
580 Ga0068857_100020332
581 Ga0068856_100000868
582 Ga0070702_100012813
583 Ga0068852_100201382
584 Ga0068859_100003718
585 Ga0068859_100047585
586 Ga0068870_10010131
587 Ga0068863_100001868
588 Ga0068860_100017133
589 Ga0070716_100001934
590 Ga0070716_100025460
591 Ga0097621_100078013
592 Ga0075428_100039444
593 Ga0075428_100193307
594 Ga0075428_100401025
595 Ga0075430_100056763
596 Ga0075431_100003686
597 Ga0075431_100012418
598 Ga0075431_100014047
599 Ga0075431_100144598
600 Ga0075431_100248680
601 Ga0075431_100253495
602 Ga0075431_100268131
603 Ga0075433_10032950
604 Ga0075433_10039310
605 Ga0075433_10040789
606 Ga0075434_100003859
607 Ga0075434_100005740
608 Ga0075434_100014059
609 Ga0075434_100034342
610 Ga0075434_100130361
611 Ga0075434_100209499
612 Ga0075429_100018382
613 Ga0075429_100037167
614 Ga0075429_100061347
615 Ga0068865_100042657
616 Ga0075436_100002864
617 Ga0075436_100017210
618 Ga0075436_100032075
619 Ga0075436_100035279
620 Ga0075436_100099580
621 Ga0097620_100003718
622 Ga0097620_100047588
623 Ga0075435_100003405
624 Ga0075435_100010728
625 Ga0075435_100072953
626 Ga0099794_10000064
627 Ga0099794_10007390
628 Ga0099794_10011699
629 Ga0105240_10003063
630 Ga0105240_10185144
631 Ga0111539_10127760
632 Ga0111539_10178060
633 Ga0105245_10023306
634 Ga0114129_10000112
635 Ga0114129_10018629
636 Ga0114129_10065322
637 Ga0114129_10092821
638 Ga0114129_10692812
639 Ga0105241_10130064
640 Ga0105241_10185195
641 Ga0105242_10008031
642 Ga0105248_10003770
643 Ga0105238_10032258
644 Ga0105239_10003966
645 Ga0105239_10010959
646 Ga0105246_10001860
647 Ga0157373_10019767
648 Ga0157370_10003876
649 Ga0157370_10007972
650 Ga0157369_10066337
651 Ga0157374_10002627
652 Ga0157374_10348829
653 Ga0157372_10001141
654 Ga0157372_10004069
655 Ga0157372_10005318
656 Ga0157372_10039056
657 Ga0157372_10289847
658 Ga0163163_10012700
659 Ga0157377_10002831
660 Ga0207653_10000053
661 Ga0207653_10014630
662 Ga0207680_10087583
663 Ga0207647_10040751
664 Ga0207699_10000701
665 Ga0207699_10012883
666 Ga0207645_10060758
667 Ga0207643_10017176
668 Ga0207705_10004001
669 Ga0207684_10018464
670 Ga0207684_10026663
671 Ga0207684_10049407
672 Ga0207654_10148971
673 Ga0207654_10177276
674 Ga0207707_10000368
675 Ga0207707_10000450
676 Ga0207707_10001363
677 Ga0207707_10001633
678 Ga0207707_10001930
679 Ga0207707_10002467
680 Ga0207707_10026467
681 Ga0207707_10027595
682 Ga0207695_10002777
683 Ga0207695_10014185
684 Ga0207671_10111337
685 Ga0207693_10077341
686 Ga0207663_10000059
687 Ga0207663_10062520
688 Ga0207660_10005308
689 Ga0207660_10006044
690 Ga0207660_10008884
691 Ga0207660_10009491
692 Ga0207660_10019393
693 Ga0207660_10055847
694 Ga0207662_10012923
695 Ga0207649_10005833
696 Ga0207649_10046564
697 Ga0207652_10000841
698 Ga0207652_10001054
699 Ga0207652_10005142
700 Ga0207652_10006293
701 Ga0207652_10007085
702 Ga0207652_10008884
703 Ga0207652_10013334
704 Ga0207652_10094139
705 Ga0207646_10002302
706 Ga0207646_10006162
707 Ga0207646_10028648
708 Ga0207646_10085610
709 Ga0207646_10104762
710 Ga0207681_10038942
711 Ga0207694_10041673
712 Ga0207659_10033263
713 Ga0207659_10064612
714 Ga0207687_10029340
715 Ga0207687_10044267
716 Ga0207690_10037668
717 Ga0207669_10133924
718 Ga0207704_10004355
719 Ga0207665_10004482
720 Ga0207665_10028784
721 Ga0207665_10063436
722 Ga0207711_10068056
723 Ga0207689_10004826
724 Ga0207661_10004386
725 Ga0207661_10005288
726 Ga0207661_10005969
727 Ga0207661_10006215
728 Ga0207661_10232408
729 Ga0207679_10001487
730 Ga0207679_10106235
731 Ga0207667_10021020
732 Ga0207667_10152601
733 Ga0207651_10039638
734 Ga0207668_10014006
735 Ga0207668_10020925
736 Ga0207640_10000433
737 Ga0207703_10091943
738 Ga0207678_10131844
739 Ga0207678_10159242
740 Ga0207702_10183152
741 Ga0207641_10011787
742 Ga0207676_10001153
743 Ga0207674_10000603
744 Ga0207674_10004722
745 Ga0207675_100009617
746 Ga0207698_10021878
747 Ga0207698_10107767
748 Ga0209588_1000495
749 Ga0207428_10141627
750 Ga0268266_10240794
751 Ga0268265_10315755
752 Ga0268264_10018948
753 Ga0268264_10098387
754 Ga0265338_10019338
755 Ga0265340_10004971
756 Ga0265331_10008976
757 Ga0307408_100014870
758 Ga0307408_100039789
759 Ga0307408_100040103
760 Ga0307408_100097010
761 Ga0316575_10002134
762 Ga0316578_10015010
763 Ga0316577_10044108
764 Ga0307413_10018033
765 Ga0307413_10030447
766 Ga0307413_10110655
767 Ga0307413_10143453
768 Ga0307410_10013979
769 Ga0307410_10028026
770 Ga0307410_10066775
771 Ga0307406_10028941
772 Ga0307406_10072890
773 Ga0307407_10015206
774 Ga0307412_10116741
775 Ga0307409_100006156
776 Ga0307409_100044890
777 Ga0307409_100054702
778 Ga0307409_100062349
779 Ga0307409_100177378
780 Ga0307409_100404416
781 Ga0307416_100013565
782 Ga0307416_100016567
783 Ga0307416_100046245
784 Ga0307416_100148045
785 Ga0307416_100184467
786 Ga0307416_100195837
787 Ga0307416_100490868
788 Ga0307414_10020935
789 Ga0307414_10044797
790 Ga0307414_10134862
791 Ga0307414_10219055
792 Ga0307414_10253214
793 Ga0307411_10004817
794 Ga0307411_10055228
795 Ga0307411_10078708
796 Ga0307415_100016475
797 Ga0307415_100038829
798 Ga0373929_0012075
799 Ga0373943_0011813
800 Ga0316574_0010434
801 Ga0373935_0015351
802 Ga0373925_0128215
803 Ga0395905_0033015
804 Ga0453683_0015544
805 Ga0451576_0008943
806 Ga0451576_0087198
807 Ga0451576_0219021
808 Ga0451576_0456531
809 Ga0495629_0021467
810 Ga0495582_0038485
811 Ga0495630_0054254
812 Ga0495652_0065265
813 Ga0495587_0069582
814 Ga0495609_0054321
815 Ga0495667_0032798
816 Ga0495599_0018285
817 Ga0495623_0015531
818 Ga0495658_0130291
819 Ga0495613_0141321
820 Ga0495674_0202474
821 Ga0495680_0013936
822 Ga0495675_0019744
823 Ga0495684_0053435
824 Ga0496102_0003544
825 Ga0496103_0023747
826 Ga0496104_0013041
827 Ga0496106_0019721
828 Ga0496108_0001015
829 Ga0496108_0004033
830 Ga0496108_0010854
831 Ga0496108_0020311
832 Ga0496109_0001618
833 Ga0496109_0003846
834 Ga0496109_0007999
835 Ga0496110_0012437
836 Ga0496110_0042500
837 Ga0496111_0008134
838 Ga0496112_0000777
839 Ga0496112_0001653
840 Ga0496112_0006373
841 Ga0496112_0041621
842 Ga0496112_0085064
843 Ga0496112_0087659
844 Ga0496113_0000735
845 Ga0496113_0020939
846 Ga0501033_0072320
847 Ga0501034_0000957
848 Ga0501038_0072857
849 Ga0501040_0006613
850 Ga0501041_0026804
851 Ga0501041_0037122
852 Ga0501043_0086265
853 Ga0501046_0064306
854 Ga0501048_0082119
855 Ga0501048_0098761
856 Ga0501067_0000453
857 Ga0501068_0000075
858 Ga0501068_0003185
859 Ga0501069_0000201
860 Ga0501069_0000583
861 Ga0501069_0047293
862 Ga0501069_0055970
863 Ga0501070_0002218
864 Ga0501070_0011931
865 Ga0501070_0023072
866 Ga0501071_0000468
867 Ga0501072_0002414
868 Ga0501072_0035173
869 Ga0501072_0103730
870 Ga0501073_0001702
871 Ga0501073_0022832
872 Ga0501073_0231565
873 Ga0501074_0000981
874 Ga0501074_0007090
875 Ga0501075_0011295
876 Ga0501075_0019260
877 Ga0501076_0065357
878 Ga0501076_0080854
879 Ga0501077_0000496
880 Ga0501077_0038803
881 Ga0501225_0012378
882 Ga0501079_0001564
883 Ga0501079_0025882
884 Ga0501079_0114794
885 Ga0501079_0221240
886 Ga0501080_0008511
887 Ga0501080_0052966
888 Ga0501080_0064315
889 Ga0501080_0103847
890 Ga0501081_0041688
891 Ga0501083_0000108
892 Ga0501083_0039414
893 Ga0501083_0069169
894 Ga0501045_0028789
895 Ga0501045_0060838
896 Ga0501045_0120389
897 Ga0501212_006467
898 nmdc:mga05p37_164019_c1
899 nmdc:mga05p37_169493_c1
900 nmdc:mga05p37_30321_c1
901 nmdc:mga05p37_61590_c1
902 nmdc:mga09592_7438_c1
903 nmdc:mga06r32_156890_c1
904 nmdc:mga06r32_20680_c1
905 nmdc:mga06r32_210307_c1
906 nmdc:mga06r32_59414_c1
907 nmdc:mga06r32_65952_c1
908 nmdc:mga06r32_80809_c1
909 nmdc:mga06r32_84086_c1
910 nmdc:mga08y16_155541_c1
911 nmdc:mga08y16_353730_c1
912 nmdc:mga08y16_59890_c1
913 nmdc:mga0n895_121487_c1
914 nmdc:mga0n895_211399_c1
915 nmdc:mga0n895_335909_c1
916 nmdc:mga0n895_4186_c1
917 nmdc:mga0n895_5496_c1
918 nmdc:mga0n895_7803_c1
919 nmdc:mga0n895_8321_c1
920 nmdc:mga0rr50_20996_c1
921 nmdc:mga0rr50_40456_c1
922 nmdc:mga0rr50_54309_c1
923 nmdc:mga0rr50_69720_c1
924 nmdc:mga08x19_3259_c1
925 nmdc:mga08x19_33165_c1
926 nmdc:mga08x19_38161_c1
927 nmdc:mga08x19_47576_c1
928 nmdc:mga08x19_67400_c1
929 nmdc:mga0a205_101603_c2
930 nmdc:mga0a205_179656_c1
931 nmdc:mga0a205_25391_c1
932 nmdc:mga0a205_3572_c1
933 nmdc:mga0a205_6150_c1
934 Ga0501084_0001381
935 Ga0501084_0009078
936 Ga0501084_0021189
937 Ga0501084_0214163
938 Ga0590071_000448
939 Ga0590075_004532
940 Ga0590077_014935
941 Ga0590077_020153
942 Ga0501082_0001928
943 Ga0501082_0026327
944 Ga0501082_0048209

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08442

ATP-grasp_2

ATP-grasp domain

2

195

0.99

PF00549

Ligase_CoA

CoA-ligase

256

376

0.96

PF02786

CPSase_L_D2

Carbamoyl-phosphate synthase L chain, ATP binding domain

5

109

0.89

PF13549

ATP-grasp_5

ATP-grasp domain

2

134

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nu6-assembly1.cif.gz_B c123aa mutant of e. coli succinyl-coa synthetase 0.9286 1 365
1jll-assembly1.cif.gz_B crystal structure analysis of the e197betaa mutant of e. coli scs 0.9284 1 365
6mgg-assembly1.cif.gz_B succinyl-coa synthase from francisella tularensis, phosphorylated, in complex with coa 0.9256 1 360
2nu6-assembly1.cif.gz_B c123aa mutant of e. coli succinyl-coa synthetase 0.9166 1 365
1jll-assembly1.cif.gz_B crystal structure analysis of the e197betaa mutant of e. coli scs 0.9164 1 365
ID Description Score Start End Superfamily
af_A0A1D6HDG8_329_429_3.40.50.261 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Succinyl-CoA synthetase domains 0.9807 220 319 3.40.50.261
1jkjB01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9741 1 219 3.30.470.20
1jkjB01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.968 1 219 3.30.470.20
af_A0A1D6HDG8_329_429_3.40.50.261 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Succinyl-CoA synthetase domains 0.9618 220 319 3.40.50.261
3ufxE01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9566 1 213 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A537CB76-F1-model_v4 Succinate--CoA ligase subunit beta (EC 6.2.1.5) 0.9826 225 363 GO:0000166
GO:0004775
GO:0006099
GO:0006104
GO:0042709
AF-A0A2V7FPS2-F1-model_v4 ATP-citrate synthase/succinyl-CoA ligase C-terminal domain-containing protein 0.9805 182 365 GO:0004775
GO:0005829
GO:0006099
GO:0006104
GO:0042709
AF-T1H1Q9-F1-model_v4 ATP-citrate synthase/succinyl-CoA ligase C-terminal domain-containing protein 0.9714 230 333 GO:0000166
GO:0004776
GO:0005739
GO:0006099
GO:0006104
GO:0042709
AF-X0XMS1-F1-model_v4 ATP-citrate lyase/succinyl-CoA ligase domain-containing protein 0.9701 129 331 GO:0000166
GO:0004775
GO:0006099
GO:0006104
GO:0042709
GO:0046872
AF-A0A439NSV8-F1-model_v4 Succinate--CoA ligase subunit beta (EC 6.2.1.5) 0.9667 81 194 GO:0004775
GO:0005524
GO:0005829
GO:0006099
GO:0006104
GO:0042709

Map