F450780

General Info

Members Datasets Scaffolds Average Seq Length
472 304 456 138

Family's Representative Sequence

Representative Sequence 3300006942|Ga0099824_1015795|Ga0099824_10157955
Length 132
Sequence MTSSTNPIEHSFELAAAACDDLTPLVYRRLFREHPEAQVMFRSEPVKGSMLSLTIEALLDFAGERTGHFRLIECEVSSHDAYGTPRDLFVAFFGVIAATLRELLGEQWSDEIDAAWHKLLCDLEAIVRQQPD

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
5 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
6 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
7 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
8 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
9 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
10 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
11 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
12 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
13 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
14 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
15 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
74 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
146 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
147 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
148 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
152 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
153 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
164 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
165 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
166 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
167 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
168 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
169 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
170 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
172 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
174 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
177 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
191 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
192 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
204 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
205 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
206 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
211 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
215 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
216 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
217 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
222 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
225 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
226 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
227 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
231 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
232 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
233 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
234 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
235 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
236 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
237 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
247 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
248 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
263 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
264 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
265 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
266 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
267 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
268 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
269 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
270 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
271 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
274 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
277 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
278 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
279 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
280 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
283 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
284 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
285 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
286 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
287 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
288 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
289 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
290 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
291 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
292 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
293 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
294 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
295 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
296 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
297 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
298 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
299 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
300 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
301 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
302 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
303 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
304 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.82
Metatranscriptomes 0
Isolates 3.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.17
Nodule 4.03
Rhizoplane 2.97
Rhizosphere 76.91
Stem 0
Stem Tuber 0
Unclassified 5.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10041783 3300003659 Bacteria 970
2 Ga0065165_1115860 3300005262 Bacteria 655
3 Ga0070683_100022065 3300005329 Bacteria 5686
4 Ga0070683_102053884 3300005329 Bacteria 549
5 Ga0070690_100058425 3300005330 Bacteria 2477
6 Ga0070680_100009263 3300005336 Bacteria 7555
7 Ga0070660_100012305 3300005339 Bacteria 6106
8 Ga0070660_100672368 3300005339 Bacteria 867
9 Ga0070689_100086432 3300005340 Bacteria 2466
10 Ga0070689_101765199 3300005340 Bacteria 564
11 Ga0070661_100541460 3300005344 Bacteria 936
12 Ga0070668_100452996 3300005347 Bacteria 1103
13 Ga0070668_100794311 3300005347 Bacteria 840
14 Ga0070675_100813661 3300005354 Bacteria 854
15 Ga0070675_101057654 3300005354 Bacteria 746
16 Ga0070674_100126318 3300005356 Bacteria 1900
17 Ga0070674_100931546 3300005356 Bacteria 758
18 Ga0070688_100171288 3300005365 Bacteria 1499
19 Ga0070659_100141026 3300005366 Bacteria 1962
20 Ga0070659_100361497 3300005366 Bacteria 1219
21 Ga0070709_10475032 3300005434 Bacteria 946
22 Ga0070709_10741761 3300005434 Bacteria 767
23 Ga0070709_11251331 3300005434 Bacteria 597
24 Ga0070713_100824572 3300005436 Bacteria 890
25 Ga0070713_100835456 3300005436 Bacteria 884
26 Ga0070701_10081611 3300005438 Bacteria 1752
27 Ga0070701_10134755 3300005438 Bacteria 1406
28 Ga0070711_100712274 3300005439 Bacteria 846
29 Ga0070708_100130658 3300005445 Bacteria 2324
30 Ga0070663_101007333 3300005455 Bacteria 724
31 Ga0070678_100090216 3300005456 Bacteria 2348
32 Ga0070678_100176395 3300005456 Bacteria 1745
33 Ga0070678_100465257 3300005456 Bacteria 1110
34 Ga0070678_100510961 3300005456 Bacteria 1061
35 Ga0070678_100536012 3300005456 Bacteria 1037
36 Ga0070681_10158829 3300005458 Bacteria 2185
37 Ga0070681_10319064 3300005458 Bacteria 1463
38 Ga0070685_10710774 3300005466 Bacteria 733
39 Ga0070706_100493742 3300005467 Bacteria 1139
40 Ga0070707_101394943 3300005468 Bacteria 667
41 Ga0070698_100165645 3300005471 Bacteria 2153
42 Ga0070698_100431920 3300005471 Bacteria 1252
43 Ga0070679_100321207 3300005530 Bacteria 1497
44 Ga0070679_100472187 3300005530 Bacteria 1199
45 Ga0070679_100895597 3300005530 Bacteria 831
46 Ga0070684_100018135 3300005535 Bacteria 5791
47 Ga0070697_100561111 3300005536 Bacteria 1002
48 Ga0068853_100007871 3300005539 Bacteria 8547
49 Ga0070672_100072157 3300005543 Bacteria 2749
50 Ga0070672_100201915 3300005543 Bacteria 1663
51 Ga0070686_100279010 3300005544 Bacteria 1232
52 Ga0070686_101066826 3300005544 Bacteria 666
53 Ga0070695_100383905 3300005545 Bacteria 1061
54 Ga0070665_100115797 3300005548 Bacteria 2683
55 Ga0070665_100415172 3300005548 Bacteria 1354
56 Ga0068855_100069044 3300005563 Bacteria 4113
57 Ga0068855_100116894 3300005563 Bacteria 3056
58 Ga0068855_101186645 3300005563 Bacteria 794
59 Ga0070664_100512654 3300005564 Bacteria 1106
60 Ga0070664_101304818 3300005564 Bacteria 685
61 Ga0068857_100016728 3300005577 Bacteria 6425
62 Ga0068856_100290808 3300005614 Bacteria 1651
63 Ga0068852_100038827 3300005616 Bacteria 4004
64 Ga0068859_100477362 3300005617 Bacteria 1342
65 Ga0068866_10090737 3300005718 Bacteria 1663
66 Ga0068851_10228160 3300005834 Bacteria 1049
67 Ga0068851_10409266 3300005834 Bacteria 799
68 Ga0068870_10828506 3300005840 Bacteria 649
69 Ga0068863_100081398 3300005841 Bacteria 3067
70 Ga0068863_100198236 3300005841 Bacteria 1930
71 Ga0068858_100425889 3300005842 Bacteria 1276
72 Ga0068858_100897132 3300005842 Bacteria 867
73 Ga0068860_100000469 3300005843 Bacteria 50219
74 Ga0068860_100415599 3300005843 Bacteria 1332
75 Ga0068860_100498431 3300005843 Bacteria 1216
76 Ga0068862_100210791 3300005844 Bacteria 1755
77 Ga0081540_1008226 3300005983 Bacteria 7308
78 Ga0081540_1018032 3300005983 Bacteria 4346
79 Ga0075365_10037571 3300006038 Bacteria 3145
80 Ga0075365_10107814 3300006038 Bacteria 1912
81 Ga0075363_100129006 3300006048 Bacteria 1417
82 Ga0070715_10672136 3300006163 Bacteria 615
83 Ga0070716_100931004 3300006173 Bacteria 683
84 Ga0070712_100047343 3300006175 Bacteria 2976
85 Ga0070712_100237699 3300006175 Bacteria 1450
86 Ga0075367_10404434 3300006178 Bacteria 863
87 Ga0075366_10702273 3300006195 Bacteria 628
88 Ga0097621_100309268 3300006237 Bacteria 1398
89 Ga0068871_100057645 3300006358 Bacteria 3160
90 Ga0068871_100580478 3300006358 Bacteria 1018
91 Ga0068865_100010414 3300006881 Bacteria 5787
92 Ga0068865_100601204 3300006881 Bacteria 929
93 Ga0097620_100477323 3300006931 Bacteria 1342
94 Ga0099824_1015795 3300006942 Bacteria 7031
95 Ga0099822_1009319 3300006943 Bacteria 12382
96 Ga0099794_10032149 3300007265 Bacteria 2461
97 Ga0099794_10033703 3300007265 Bacteria 2408
98 Ga0099795_10022065 3300007788 Bacteria 2097
99 Ga0105240_10051150 3300009093 Bacteria 5202
100 Ga0105240_10240744 3300009093 Bacteria 2097
101 Ga0105240_10502751 3300009093 Bacteria 1347
102 Ga0105247_10009434 3300009101 Bacteria 5924
103 Ga0105247_10069370 3300009101 Bacteria 2200
104 Ga0105247_10167731 3300009101 Bacteria 1458
105 Ga0105247_10417397 3300009101 Bacteria 960
106 Ga0105243_10100149 3300009148 Bacteria 2404
107 Ga0105241_11127967 3300009174 Bacteria 740
108 Ga0105248_10880219 3300009177 Bacteria 1011
109 Ga0105237_10084692 3300009545 Bacteria 3160
110 Ga0105237_10091247 3300009545 Bacteria 3036
111 Ga0105237_10424013 3300009545 Bacteria 1336
112 Ga0105237_11063797 3300009545 Unclassified 816
113 Ga0105237_11633753 3300009545 Bacteria 651
114 Ga0105238_10017117 3300009551 Bacteria 7358
115 Ga0105238_10679291 3300009551 Bacteria 1041
116 Ga0105249_10754043 3300009553 Bacteria 1036
117 Ga0099796_10033256 3300010159 Bacteria 1696
118 Ga0105239_10137327 3300010375 Bacteria 2722
119 Ga0105239_10144153 3300010375 Bacteria 2655
120 Ga0105239_10487658 3300010375 Bacteria 1400
121 Ga0105239_10574739 3300010375 Bacteria 1284
122 Ga0105239_12418124 3300010375 Bacteria 612
123 Ga0105246_10100140 3300011119 Bacteria 2108
124 Ga0105246_10861007 3300011119 Bacteria 809
125 Ga0157337_1013623 3300012483 Bacteria 671
126 Ga0157369_10082565 3300013105 Bacteria 3438
127 Ga0157369_11838967 3300013105 Bacteria 615
128 Ga0157374_10914462 3300013296 Bacteria 895
129 Ga0157374_11286653 3300013296 Bacteria 753
130 Ga0157374_12040832 3300013296 Bacteria 600
131 Ga0157378_10048156 3300013297 Bacteria 3790
132 Ga0157378_10274514 3300013297 Bacteria 1623
133 Ga0157378_11703937 3300013297 Bacteria 677
134 Ga0163162_10614388 3300013306 Bacteria 1212
135 Ga0163162_10706508 3300013306 Bacteria 1130
136 Ga0163162_10856644 3300013306 Bacteria 1024
137 Ga0157372_10191237 3300013307 Bacteria 2371
138 Ga0157375_10073807 3300013308 Bacteria 3431
139 Ga0163163_10855348 3300014325 Bacteria 973
140 Ga0157380_11123145 3300014326 Bacteria 826
141 Ga0157380_11540141 3300014326 Bacteria 719
142 Ga0182008_10164649 3300014497 Bacteria 1117
143 Ga0157379_10466712 3300014968 Bacteria 1167
144 Ga0157376_10357859 3300014969 Bacteria 1399
145 Ga0163161_10016627 3300017792 Bacteria 5137
146 Ga0163161_11453268 3300017792 Bacteria 600
147 Ga0209758_1009002 3300025297 Bacteria 6311
148 Ga0207697_10291740 3300025315 Bacteria 723
149 Ga0207656_10084960 3300025321 Bacteria 1428
150 Ga0207682_10519851 3300025893 Bacteria 563
151 Ga0207710_10060164 3300025900 Bacteria 1721
152 Ga0207688_10088446 3300025901 Bacteria 1776
153 Ga0207684_10338198 3300025910 Bacteria 1296
154 Ga0207707_10009415 3300025912 Bacteria 8473
155 Ga0207707_10503564 3300025912 Bacteria 1033
156 Ga0207695_10028180 3300025913 Bacteria 6235
157 Ga0207695_10469271 3300025913 Bacteria 1141
158 Ga0207671_10010265 3300025914 Bacteria 7744
159 Ga0207671_10334433 3300025914 Bacteria 1200
160 Ga0207693_10082875 3300025915 Bacteria 2512
161 Ga0207663_10447708 3300025916 Bacteria 995
162 Ga0207660_10034871 3300025917 Bacteria 3490
163 Ga0207660_10350272 3300025917 Bacteria 1183
164 Ga0207657_10003989 3300025919 Bacteria 15691
165 Ga0207657_10243297 3300025919 Bacteria 1436
166 Ga0207652_10012855 3300025921 Bacteria 6768
167 Ga0207652_10853699 3300025921 Bacteria 806
168 Ga0207646_10231545 3300025922 Bacteria 1669
169 Ga0207694_10041206 3300025924 Bacteria 3558
170 Ga0207694_11352402 3300025924 Bacteria 602
171 Ga0207659_10448066 3300025926 Bacteria 1087
172 Ga0207700_10476154 3300025928 Bacteria 1103
173 Ga0207664_10301838 3300025929 Bacteria 1409
174 Ga0207706_10021355 3300025933 Bacteria 5816
175 Ga0207709_10149732 3300025935 Bacteria 1615
176 Ga0207670_10202327 3300025936 Bacteria 1510
177 Ga0207669_10073695 3300025937 Bacteria 2155
178 Ga0207704_10026146 3300025938 Bacteria 3197
179 Ga0207691_10022479 3300025940 Bacteria 5947
180 Ga0207691_10195560 3300025940 Bacteria 1762
181 Ga0207689_10130988 3300025942 Bacteria 2064
182 Ga0207679_10571965 3300025945 Bacteria 1016
183 Ga0207667_10045088 3300025949 Bacteria 4670
184 Ga0207667_10180050 3300025949 Bacteria 2171
185 Ga0207667_11677130 3300025949 Bacteria 603
186 Ga0207712_10185672 3300025961 Bacteria 1637
187 Ga0207668_10451124 3300025972 Bacteria 1097
188 Ga0207658_10614389 3300025986 Bacteria 977
189 Ga0207703_10775754 3300026035 Bacteria 914
190 Ga0207703_11445403 3300026035 Bacteria 661
191 Ga0207639_10005362 3300026041 Bacteria 8666
192 Ga0207678_10585937 3300026067 Bacteria 977
193 Ga0207708_10111321 3300026075 Bacteria 2126
194 Ga0207702_10321858 3300026078 Bacteria 1473
195 Ga0207702_10375871 3300026078 Bacteria 1365
196 Ga0207641_10035342 3300026088 Bacteria 4162
197 Ga0207648_10310996 3300026089 Bacteria 1414
198 Ga0207676_11224474 3300026095 Bacteria 744
199 Ga0207674_10024558 3300026116 Bacteria 6437
200 Ga0207675_100649072 3300026118 Bacteria 1061
201 Ga0207683_10307056 3300026121 Bacteria 1452
202 Ga0207683_10502364 3300026121 Bacteria 1120
203 Ga0207683_10554599 3300026121 Bacteria 1062
204 Ga0207683_10751022 3300026121 Bacteria 905
205 Ga0207698_10298495 3300026142 Bacteria 1498
206 Ga0207698_10306851 3300026142 Bacteria 1480
207 Ga0209589_1000003 3300027357 Bacteria 629130
208 Ga0209489_100003 3300027361 Bacteria 663105
209 Ga0209700_100003 3300027363 Bacteria 663105
210 Ga0209588_1013366 3300027671 Bacteria 2503
211 Ga0268266_10546672 3300028379 Bacteria 1109
212 Ga0268266_10563233 3300028379 Bacteria 1092
213 Ga0268266_10769463 3300028379 Bacteria 929
214 Ga0268264_10000022 3300028381 Bacteria 476624
215 Ga0307511_10098616 3300030521 Bacteria 1933
216 Ga0265330_10147648 3300031235 Bacteria 999
217 Ga0265332_10022675 3300031238 Bacteria 2770
218 Ga0265325_10010874 3300031241 Bacteria 5246
219 Ga0265340_10004404 3300031247 Bacteria 7879
220 Ga0265331_10018697 3300031250 Bacteria 3587
221 Ga0265331_10182675 3300031250 Bacteria 947
222 Ga0265316_10073238 3300031344 Bacteria 2639
223 Ga0265316_10662863 3300031344 Bacteria 737
224 Ga0307509_10121840 3300031507 Bacteria 2584
225 Ga0307508_10121036 3300031616 Bacteria 2220
226 Ga0307508_10549570 3300031616 Bacteria 753
227 Ga0265314_10038940 3300031711 Bacteria 3430
228 Ga0265314_10041341 3300031711 Bacteria 3301
229 Ga0265342_10141339 3300031712 Bacteria 1343
230 Ga0307411_11940839 3300032005 Bacteria 549
231 Ga0307507_10036993 3300033179 Bacteria 4974
232 Ga0307510_10061950 3300033180 Bacteria 3828
233 Ga0307510_10400276 3300033180 Bacteria 816
234 Ga0315911_1000001 3300033442 Bacteria 1088602
235 Ga0373926_0218519 3300035083 Bacteria 735
236 Ga0373929_0046364 3300035085 Bacteria 982
237 Ga0373934_0022928 3300035086 Bacteria 2410
238 Ga0373934_0101876 3300035086 Bacteria 1161
239 Ga0373934_0260389 3300035086 Bacteria 718
240 Ga0373944_0077284 3300035089 Bacteria 1094
241 Ga0373923_0044635 3300035111 Bacteria 1838
242 Ga0373923_0051159 3300035111 Bacteria 1732
243 Ga0373923_0110659 3300035111 Bacteria 1219
244 Ga0373932_0387230 3300035112 Bacteria 538
245 Ga0373936_0015833 3300035113 Bacteria 2893
246 Ga0373936_0420463 3300035113 Bacteria 615
247 Ga0373936_0573897 3300035113 Bacteria 528
248 Ga0373945_0018308 3300035116 Bacteria 2382
249 Ga0373953_0000391 3300035117 Bacteria 11920
250 Ga0373954_0000035 3300035118 Bacteria 51266
251 Ga0373954_0006222 3300035118 Bacteria 5205
252 Ga0373956_0000207 3300035119 Bacteria 22860
253 Ga0373956_0428988 3300035119 Bacteria 631
254 Ga0373957_0001128 3300035120 Bacteria 7068
255 Ga0373943_0015005 3300035170 Bacteria 3516
256 Ga0373943_0053506 3300035170 Bacteria 1994
257 Ga0373946_0004658 3300035171 Bacteria 4922
258 Ga0373955_0001026 3300035172 Bacteria 11850
259 Ga0373955_0107721 3300035172 Bacteria 1608
260 Ga0373924_0006045 3300035410 Bacteria 4320
261 Ga0373924_0080478 3300035410 Bacteria 1385
262 Ga0373931_0081607 3300035691 Bacteria 1786
263 Ga0373931_0350007 3300035691 Bacteria 925
264 Ga0373935_0000256 3300035692 Bacteria 26305
265 Ga0373935_0025093 3300035692 Bacteria 3673
266 Ga0373935_1398112 3300035692 Bacteria 523
267 Ga0373927_0005857 3300035695 Bacteria 8428
268 Ga0373927_0032639 3300035695 Bacteria 3391
269 Ga0373933_0000037 3300035724 Bacteria 81092
270 Ga0373947_0001480 3300035725 Bacteria 14434
271 Ga0373937_0000118 3300036401 Bacteria 75902
272 Ga0373937_0076968 3300036401 Bacteria 3082
273 Ga0373925_0020476 3300037068 Bacteria 4815
274 Ga0373925_0024933 3300037068 Bacteria 4368
275 Ga0373925_0370803 3300037068 Bacteria 1165
276 Ga0373925_0805655 3300037068 Bacteria 774
277 Ga0373925_1341703 3300037068 Bacteria 586
278 Ga0395905_0716540 3300037471 Bacteria 903
279 Ga0395905_1042395 3300037471 Bacteria 721
280 Ga0451798_0019876 3300041458 Bacteria 896
281 Ga0451853_1679816 3300041512 Bacteria 540
282 Ga0466969_0108532 3300044656 Bacteria 1301
283 Ga0495592_0000649 3300046454 Bacteria 24123
284 Ga0495592_0087410 3300046454 Bacteria 2242
285 Ga0495603_0000027 3300046455 Bacteria 61238
286 Ga0495603_0008387 3300046455 Bacteria 6243
287 Ga0495629_0000290 3300046459 Bacteria 43459
288 Ga0495629_0001487 3300046459 Bacteria 18475
289 Ga0495638_0528787 3300046460 Bacteria 589
290 Ga0495641_0004283 3300046461 Bacteria 10166
291 Ga0495651_0000412 3300046462 Bacteria 33198
292 Ga0495651_0084347 3300046462 Bacteria 2394
293 Ga0495651_0918980 3300046462 Bacteria 534
294 Ga0495653_0000161 3300046463 Bacteria 55322
295 Ga0495653_0100958 3300046463 Bacteria 2091
296 Ga0495653_0591316 3300046463 Bacteria 683
297 Ga0495580_0000610 3300046472 Bacteria 30234
298 Ga0495582_0000425 3300046473 Bacteria 23064
299 Ga0495639_0000048 3300046475 Bacteria 53257
300 Ga0495662_0000505 3300046476 Bacteria 17752
301 Ga0495664_0050706 3300046477 Bacteria 2465
302 Ga0495664_0096962 3300046477 Bacteria 1775
303 Ga0495664_0281600 3300046477 Bacteria 1005
304 Ga0495664_0703819 3300046477 Unclassified 597
305 Ga0495584_0307757 3300046491 Bacteria 805
306 Ga0495585_0265705 3300046492 Bacteria 852
307 Ga0495594_0000279 3300046499 Bacteria 25038
308 Ga0495606_0127161 3300046507 Bacteria 1519
309 Ga0495608_0000337 3300046511 Bacteria 33005
310 Ga0495608_0349304 3300046511 Bacteria 910
311 Ga0495618_0074656 3300046514 Bacteria 2159
312 Ga0495620_0150551 3300046515 Bacteria 907
313 Ga0495628_0002406 3300046516 Bacteria 16872
314 Ga0495630_0008325 3300046517 Bacteria 7444
315 Ga0495631_0095919 3300046518 Bacteria 1277
316 Ga0495637_0330750 3300046520 Bacteria 537
317 Ga0495648_0376063 3300046524 Bacteria 642
318 Ga0495666_0092289 3300046526 Bacteria 1428
319 Ga0495652_0000604 3300046529 Bacteria 42071
320 Ga0495652_0016212 3300046529 Bacteria 6665
321 Ga0495665_0000165 3300046531 Bacteria 33325
322 Ga0495665_0230598 3300046531 Bacteria 956
323 Ga0495640_0002246 3300046533 Bacteria 15480
324 Ga0495640_0009295 3300046533 Bacteria 7658
325 Ga0495586_0277184 3300046535 Bacteria 959
326 Ga0495587_0012948 3300046536 Bacteria 5244
327 Ga0495645_0047900 3300046543 Bacteria 3113
328 Ga0495645_0181486 3300046543 Bacteria 1442
329 Ga0495622_0050030 3300046557 Bacteria 1940
330 Ga0495622_0050752 3300046557 Bacteria 1924
331 Ga0495633_0101446 3300046558 Bacteria 1336
332 Ga0495667_0000147 3300046559 Bacteria 47993
333 Ga0495667_0034694 3300046559 Bacteria 3373
334 Ga0495668_0627444 3300046616 Bacteria 594
335 Ga0495634_0001502 3300046642 Bacteria 20642
336 Ga0495634_0002287 3300046642 Bacteria 16031
337 Ga0495635_0000517 3300046663 Bacteria 24463
338 Ga0495635_0004027 3300046663 Bacteria 10201
339 Ga0495635_0310910 3300046663 Bacteria 1056
340 Ga0495588_0032126 3300046674 Bacteria 2644
341 Ga0495657_0000995 3300046675 Bacteria 24963
342 Ga0495657_0108342 3300046675 Bacteria 1763
343 Ga0495599_0000253 3300046678 Bacteria 33822
344 Ga0495623_0000549 3300046679 Bacteria 25012
345 Ga0495623_0138417 3300046679 Bacteria 1451
346 Ga0495623_0250590 3300046679 Bacteria 996
347 Ga0495646_0003057 3300046680 Bacteria 10369
348 Ga0495646_0039365 3300046680 Bacteria 2915
349 Ga0495647_0000836 3300046681 Bacteria 9208
350 Ga0495658_0001036 3300046683 Bacteria 14692
351 Ga0495658_0680115 3300046683 Unclassified 659
352 Ga0495669_0037419 3300046684 Bacteria 2147
353 Ga0495613_0030930 3300046689 Bacteria 3976
354 Ga0495613_0204447 3300046689 Bacteria 1391
355 Ga0495624_0000380 3300046690 Bacteria 35436
356 Ga0495600_0001048 3300046809 Bacteria 14960
357 Ga0495581_0006694 3300047315 Bacteria 6679
358 Ga0495581_0302570 3300047315 Bacteria 935
359 Ga0495604_0000253 3300047317 Bacteria 47392
360 Ga0495674_0007638 3300047319 Bacteria 10327
361 Ga0495674_0161694 3300047319 Bacteria 1873
362 Ga0495674_0350771 3300047319 Bacteria 1198
363 Ga0495674_0350909 3300047319 Bacteria 1198
364 Ga0495676_0031535 3300047321 Bacteria 4480
365 Ga0495680_0000406 3300047322 Bacteria 48300
366 Ga0495680_0639996 3300047322 Unclassified 708
367 Ga0495675_0000285 3300047444 Bacteria 36643
368 Ga0495677_0048091 3300047445 Bacteria 1567
369 Ga0495673_0039888 3300047469 Bacteria 2127
370 Ga0495684_0000184 3300047471 Bacteria 47730
371 Ga0495684_0038153 3300047471 Bacteria 3684
372 Ga0495593_0000160 3300047673 Bacteria 34170
373 Ga0495593_0007660 3300047673 Bacteria 6299
374 Ga0495602_0001148 3300048088 Bacteria 25888
375 Ga0495602_0782071 3300048088 Bacteria 642
376 Ga0495602_0811547 3300048088 Bacteria 628
377 Ga0495614_0027200 3300048089 Bacteria 2467
378 Ga0496101_0022873 3300048904 Bacteria 4310
379 Ga0496101_1291764 3300048904 Bacteria 571
380 Ga0496103_0660509 3300048906 Bacteria 664
381 Ga0496106_0000623 3300048909 Bacteria 25352
382 Ga0496106_0106756 3300048909 Bacteria 2177
383 Ga0496107_0053762 3300048910 Bacteria 2905
384 Ga0496108_0302677 3300048911 Bacteria 1393
385 Ga0496108_1188927 3300048911 Bacteria 645
386 Ga0496109_0363360 3300048912 Bacteria 1367
387 Ga0496110_0454695 3300048913 Bacteria 1167
388 Ga0496110_0798716 3300048913 Bacteria 848
389 Ga0496112_0268308 3300048915 Bacteria 1655
390 Ga0496115_1000154 3300048918 Bacteria 639
391 Ga0496116_0302052 3300048919 Bacteria 761
392 Ga0496117_0006618 3300048920 Bacteria 11646
393 Ga0496118_0005952 3300048921 Bacteria 13618
394 Ga0496119_0242231 3300048922 Bacteria 913
395 Ga0496119_0438543 3300048922 Bacteria 617
396 Ga0496120_0267605 3300048923 Bacteria 795
397 Ga0496121_0001595 3300048924 Bacteria 37710
398 Ga0496121_0069632 3300048924 Bacteria 2838
399 Ga0496121_0078415 3300048924 Bacteria 2626
400 Ga0496121_0413785 3300048924 Bacteria 879
401 Ga0496124_0001501 3300048927 Bacteria 34172
402 Ga0496125_0074283 3300048928 Bacteria 2637
403 Ga0496126_0004715 3300048929 Bacteria 16093
404 Ga0496126_0033748 3300048929 Bacteria 4814
405 Ga0496126_0126655 3300048929 Bacteria 2210
406 Ga0496126_0272311 3300048929 Bacteria 1405
407 Ga0496126_0360133 3300048929 Bacteria 1188
408 nmdc:mga03n38_499769_c1 3300050490 Bacteria 682
409 nmdc:mga0yw44_3341_c1 3300050492 Bacteria 7107
410 nmdc:mga0yw44_569505_c1 3300050492 Bacteria 769
411 nmdc:mga06z11_385778_c1 3300050494 Bacteria 842
412 nmdc:mga07m45_60739_c1 3300050496 Bacteria 2140
413 nmdc:mga08x19_480019_c1 3300050514 Bacteria 876
414 Ga0495601_0004707 3300053077 Bacteria 7907
415 Ga0495612_0083989 3300053078 Bacteria 1341
416 Ga0500610_0158113 3300053079 Bacteria 1130
417 Ga0500635_0026146 3300053080 Bacteria 1845
418 Ga0500635_0110174 3300053080 Bacteria 1022
419 Ga0500635_0127930 3300053080 Bacteria 955
420 Ga0495595_0000318 3300053084 Bacteria 18768
421 Ga0495595_0605417 3300053084 Bacteria 560
422 Ga0495619_0000209 3300053085 Bacteria 42507
423 Ga0495619_0316714 3300053085 Bacteria 1080
424 Ga0495619_0669380 3300053085 Bacteria 707
425 Ga0500578_0225229 3300053086 Bacteria 1138
426 Ga0500566_0109407 3300053094 Bacteria 1504
427 Ga0500566_0235247 3300053094 Bacteria 901
428 Ga0500640_094592 3300053095 Bacteria 1245
429 Ga0500554_049232 3300053102 Bacteria 1321
430 Ga0500569_147081 3300053109 Bacteria 794
431 Ga0500572_151425 3300053111 Bacteria 757
432 Ga0500595_061605 3300053119 Bacteria 1132
433 Ga0500559_0014119 3300053136 Bacteria 3376
434 Ga0500559_0052261 3300053136 Bacteria 1805
435 Ga0500564_018367 3300053138 Bacteria 3188
436 Ga0500573_0205996 3300053140 Bacteria 1040
437 Ga0500603_005926 3300053150 Bacteria 2647
438 Ga0500603_034089 3300053150 Bacteria 1328
439 Ga0500619_063691 3300053154 Bacteria 1217
440 Ga0500620_027159 3300053155 Bacteria 1779
441 Ga0500624_047006 3300053157 Bacteria 793
442 Ga0500638_203047 3300053162 Bacteria 837
443 Ga0500638_345321 3300053162 Bacteria 554
444 Ga0500639_201043 3300053163 Bacteria 856
445 Ga0500639_269307 3300053163 Bacteria 666
446 Ga0500636_0000333 3300053177 Bacteria 26138
447 Ga0500636_0116500 3300053177 Bacteria 1503
448 Ga0500636_0140086 3300053177 Bacteria 1339
449 Ga0500636_0293590 3300053177 Bacteria 804
450 Ga0500637_0022637 3300053178 Bacteria 3427
451 Ga0500637_0064352 3300053178 Bacteria 2103
452 Ga0500637_0139114 3300053178 Bacteria 1405
453 Ga0500625_162041 3300053729 Bacteria 820
454 Ga0500552_005490 3300053733 Bacteria 1385
455 Ga0500596_001671 3300053735 Bacteria 4486
456 Ga0500601_000329 3300053737 Bacteria 8658

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8019555841 8019557420 104
2 iso_pu_bacteria 2904699407 2904702602 106
3 3300026078 Ga0207702_10321858 Ga0207702_103218582 110
4 3300010375 Ga0105239_10487658 Ga0105239_104876581 112
5 3300005536 Ga0070697_100561111 Ga0070697_1005611111 118
6 3300037068 Ga0373925_1341703 Ga0373925_1341703_20_394 123
7 3300046531 Ga0495665_0230598 Ga0495665_0230598_285_659 123
8 iso_pu_bacteria 2513237104 2513718552 126
9 3300046679 Ga0495623_0138417 Ga0495623_0138417_1003_1404 127
10 iso_pu_bacteria 2513237096 2513656719 129
11 iso_pu_bacteria 2513237137 2513857909 129
12 iso_pu_bacteria 2513237145 2513917904 129
13 iso_pu_bacteria 2517572143 2517893050 129
14 iso_pu_bacteria 2728368998 2728750386 129
15 iso_pu_bacteria 2874604998 2874609646 129
16 iso_pu_bacteria 2885374607 2885381968 129
17 iso_pu_bacteria 2903748898 2903755836 129
18 iso_pu_bacteria 2906660503 2906661441 129
19 iso_pu_bacteria 2908756301 2908760947 129
20 iso_pu_bacteria 3005474847 3005479611 129
21 3300005262 Ga0065165_1115860 Ga0065165_11158601 130
22 3300005347 Ga0070668_100452996 Ga0070668_1004529961 130
23 3300005548 Ga0070665_100115797 Ga0070665_1001157972 130
24 3300005841 Ga0068863_100081398 Ga0068863_1000813983 130
25 3300005842 Ga0068858_100897132 Ga0068858_1008971321 130
26 3300005843 Ga0068860_100000469 Ga0068860_10000046936 130
27 3300005843 Ga0068860_100498431 Ga0068860_1004984312 130
28 3300006163 Ga0070715_10672136 Ga0070715_106721361 130
29 3300006175 Ga0070712_100237699 Ga0070712_1002376992 130
30 3300006237 Ga0097621_100309268 Ga0097621_1003092682 130
31 3300006942 Ga0099824_1015795 Ga0099824_10157955 130
32 3300006943 Ga0099822_1009319 Ga0099822_10093197 130
33 3300009101 Ga0105247_10069370 Ga0105247_100693702 130
34 3300009101 Ga0105247_10417397 Ga0105247_104173972 130
35 3300009148 Ga0105243_10100149 Ga0105243_101001491 130
36 3300009174 Ga0105241_11127967 Ga0105241_111279671 130
37 3300009545 Ga0105237_10091247 Ga0105237_100912473 130
38 3300009545 Ga0105237_10424013 Ga0105237_104240132 130
39 3300009545 Ga0105237_11063797 Ga0105237_110637971 130
40 3300009545 Ga0105237_11633753 Ga0105237_116337531 130
41 3300009551 Ga0105238_10679291 Ga0105238_106792911 130
42 3300010375 Ga0105239_10137327 Ga0105239_101373271 130
43 3300010375 Ga0105239_12418124 Ga0105239_124181241 130
44 3300013297 Ga0157378_10274514 Ga0157378_102745142 130
45 3300025297 Ga0209758_1009002 Ga0209758_10090022 130
46 3300025900 Ga0207710_10060164 Ga0207710_100601641 130
47 3300025914 Ga0207671_10010265 Ga0207671_100102655 130
48 3300025924 Ga0207694_11352402 Ga0207694_113524021 130
49 3300026088 Ga0207641_10035342 Ga0207641_100353422 130
50 3300027357 Ga0209589_1000003 Ga0209589_100000335 130
51 3300027361 Ga0209489_100003 Ga0209489_10000386 130
52 3300027363 Ga0209700_100003 Ga0209700_10000386 130
53 3300028379 Ga0268266_10563233 Ga0268266_105632331 130
54 3300028381 Ga0268264_10000022 Ga0268264_10000022208 130
55 3300030521 Ga0307511_10098616 Ga0307511_100986161 130
56 3300031507 Ga0307509_10121840 Ga0307509_101218402 130
57 3300033179 Ga0307507_10036993 Ga0307507_100369936 130
58 3300033180 Ga0307510_10400276 Ga0307510_104002761 130
59 3300035111 Ga0373923_0110659 Ga0373923_0110659_582_1025 130
60 3300035112 Ga0373932_0387230 Ga0373932_0387230_48_491 130
61 3300035170 Ga0373943_0053506 Ga0373943_0053506_1418_1861 130
62 3300035692 Ga0373935_0025093 Ga0373935_0025093_1529_1972 130
63 3300035695 Ga0373927_0032639 Ga0373927_0032639_113_556 130
64 3300037068 Ga0373925_0024933 Ga0373925_0024933_1465_1908 130
65 3300037471 Ga0395905_0716540 Ga0395905_0716540_209_613 130
66 3300044656 Ga0466969_0108532 Ga0466969_0108532_201_602 130
67 3300046477 Ga0495664_0281600 Ga0495664_0281600_436_879 130
68 3300046507 Ga0495606_0127161 Ga0495606_0127161_106_510 130
69 3300046557 Ga0495622_0050030 Ga0495622_0050030_383_802 130
70 3300046616 Ga0495668_0627444 Ga0495668_0627444_128_532 130
71 3300046683 Ga0495658_0680115 Ga0495658_0680115_107_550 130
72 3300047319 Ga0495674_0350909 Ga0495674_0350909_316_759 130
73 3300047322 Ga0495680_0639996 Ga0495680_0639996_34_477 130
74 3300047469 Ga0495673_0039888 Ga0495673_0039888_918_1322 130
75 3300048906 Ga0496103_0660509 Ga0496103_0660509_179_589 130
76 3300048909 Ga0496106_0000623 Ga0496106_0000623_14809_15246 130
77 3300048911 Ga0496108_0302677 Ga0496108_0302677_630_1067 130
78 3300048919 Ga0496116_0302052 Ga0496116_0302052_89_526 130
79 3300048920 Ga0496117_0006618 Ga0496117_0006618_3546_3983 130
80 3300048921 Ga0496118_0005952 Ga0496118_0005952_9626_10063 130
81 3300048922 Ga0496119_0242231 Ga0496119_0242231_460_903 130
82 3300048923 Ga0496120_0267605 Ga0496120_0267605_13_456 130
83 3300048924 Ga0496121_0001595 Ga0496121_0001595_15709_16146 130
84 3300048924 Ga0496121_0078415 Ga0496121_0078415_1873_2310 130
85 3300048927 Ga0496124_0001501 Ga0496124_0001501_19945_20382 130
86 3300048928 Ga0496125_0074283 Ga0496125_0074283_1113_1550 130
87 3300048929 Ga0496126_0004715 Ga0496126_0004715_15169_15606 130
88 3300048929 Ga0496126_0033748 Ga0496126_0033748_3944_4381 130
89 3300050492 nmdc:mga0yw44_3341_c1 nmdc:mga0yw44_3341_c1_6350_6769 130
90 3300053079 Ga0500610_0158113 Ga0500610_0158113_430_873 130
91 3300053080 Ga0500635_0110174 Ga0500635_0110174_228_638 130
92 3300053080 Ga0500635_0127930 Ga0500635_0127930_281_724 130
93 3300053086 Ga0500578_0225229 Ga0500578_0225229_94_498 130
94 3300053094 Ga0500566_0109407 Ga0500566_0109407_785_1228 130
95 3300053094 Ga0500566_0235247 Ga0500566_0235247_379_789 130
96 3300053095 Ga0500640_094592 Ga0500640_094592_259_669 130
97 3300053109 Ga0500569_147081 Ga0500569_147081_256_660 130
98 3300053111 Ga0500572_151425 Ga0500572_151425_23_433 130
99 3300053119 Ga0500595_061605 Ga0500595_061605_316_759 130
100 3300053136 Ga0500559_0014119 Ga0500559_0014119_505_915 130
101 3300053136 Ga0500559_0052261 Ga0500559_0052261_557_1000 130
102 3300053138 Ga0500564_018367 Ga0500564_018367_1594_2004 130
103 3300053140 Ga0500573_0205996 Ga0500573_0205996_551_994 130
104 3300053150 Ga0500603_005926 Ga0500603_005926_233_676 130
105 3300053154 Ga0500619_063691 Ga0500619_063691_600_1010 130
106 3300053155 Ga0500620_027159 Ga0500620_027159_202_612 130
107 3300053157 Ga0500624_047006 Ga0500624_047006_193_603 130
108 3300053162 Ga0500638_203047 Ga0500638_203047_343_786 130
109 3300053163 Ga0500639_201043 Ga0500639_201043_343_786 130
110 3300053163 Ga0500639_269307 Ga0500639_269307_132_551 130
111 3300053177 Ga0500636_0000333 Ga0500636_0000333_10461_10871 130
112 3300053177 Ga0500636_0116500 Ga0500636_0116500_847_1290 130
113 3300053177 Ga0500636_0140086 Ga0500636_0140086_420_863 130
114 3300053177 Ga0500636_0293590 Ga0500636_0293590_212_655 130
115 3300053178 Ga0500637_0139114 Ga0500637_0139114_113_556 130
116 3300053729 Ga0500625_162041 Ga0500625_162041_49_459 130
117 3300053733 Ga0500552_005490 Ga0500552_005490_761_1204 130
118 3300053735 Ga0500596_001671 Ga0500596_001671_3902_4345 130
119 3300053737 Ga0500601_000329 Ga0500601_000329_1043_1453 130
120 iso_pu_bacteria 2528768022 2528851588 130
121 3300005329 Ga0070683_100022065 Ga0070683_1000220652 132
122 3300005329 Ga0070683_102053884 Ga0070683_1020538842 132
123 3300005336 Ga0070680_100009263 Ga0070680_1000092634 132
124 3300005339 Ga0070660_100012305 Ga0070660_1000123056 132
125 3300005434 Ga0070709_10475032 Ga0070709_104750322 132
126 3300005458 Ga0070681_10319064 Ga0070681_103190643 132
127 3300005530 Ga0070679_100321207 Ga0070679_1003212071 132
128 3300005535 Ga0070684_100018135 Ga0070684_1000181355 132
129 3300005539 Ga0068853_100007871 Ga0068853_1000078716 132
130 3300005563 Ga0068855_100116894 Ga0068855_1001168945 132
131 3300005563 Ga0068855_101186645 Ga0068855_1011866452 132
132 3300005564 Ga0070664_100512654 Ga0070664_1005126542 132
133 3300005577 Ga0068857_100016728 Ga0068857_1000167283 132
134 3300005834 Ga0068851_10228160 Ga0068851_102281602 132
135 3300005983 Ga0081540_1008226 Ga0081540_10082265 132
136 3300009093 Ga0105240_10051150 Ga0105240_100511503 132
137 3300009093 Ga0105240_10240744 Ga0105240_102407445 132
138 3300009545 Ga0105237_10084692 Ga0105237_100846924 132
139 3300009551 Ga0105238_10017117 Ga0105238_100171175 132
140 3300010375 Ga0105239_10574739 Ga0105239_105747392 132
141 3300011119 Ga0105246_10100140 Ga0105246_101001403 132
142 3300012483 Ga0157337_1013623 Ga0157337_10136231 132
143 3300013105 Ga0157369_10082565 Ga0157369_100825654 132
144 3300013306 Ga0163162_10856644 Ga0163162_108566442 132
145 3300017792 Ga0163161_11453268 Ga0163161_114532681 132
146 3300025321 Ga0207656_10084960 Ga0207656_100849602 132
147 3300025912 Ga0207707_10009415 Ga0207707_100094156 132
148 3300025912 Ga0207707_10503564 Ga0207707_105035642 132
149 3300025913 Ga0207695_10028180 Ga0207695_100281803 132
150 3300025914 Ga0207671_10334433 Ga0207671_103344331 132
151 3300025915 Ga0207693_10082875 Ga0207693_100828753 132
152 3300025916 Ga0207663_10447708 Ga0207663_104477082 132
153 3300025917 Ga0207660_10034871 Ga0207660_100348712 132
154 3300025919 Ga0207657_10003989 Ga0207657_100039898 132
155 3300025921 Ga0207652_10012855 Ga0207652_100128555 132
156 3300025924 Ga0207694_10041206 Ga0207694_100412064 132
157 3300025928 Ga0207700_10476154 Ga0207700_104761541 132
158 3300025949 Ga0207667_10045088 Ga0207667_100450885 132
159 3300025961 Ga0207712_10185672 Ga0207712_101856724 132
160 3300026041 Ga0207639_10005362 Ga0207639_100053625 132
161 3300026116 Ga0207674_10024558 Ga0207674_100245587 132
162 3300026142 Ga0207698_10306851 Ga0207698_103068512 132
163 3300031235 Ga0265330_10147648 Ga0265330_101476482 132
164 3300031238 Ga0265332_10022675 Ga0265332_100226751 132
165 3300031241 Ga0265325_10010874 Ga0265325_100108745 132
166 3300031247 Ga0265340_10004404 Ga0265340_100044044 132
167 3300031250 Ga0265331_10018697 Ga0265331_100186974 132
168 3300031250 Ga0265331_10182675 Ga0265331_101826751 132
169 3300031344 Ga0265316_10073238 Ga0265316_100732383 132
170 3300031344 Ga0265316_10662863 Ga0265316_106628632 132
171 3300031616 Ga0307508_10121036 Ga0307508_101210361 132
172 3300031616 Ga0307508_10549570 Ga0307508_105495701 132
173 3300031711 Ga0265314_10038940 Ga0265314_100389402 132
174 3300031712 Ga0265342_10141339 Ga0265342_101413392 132
175 3300035086 Ga0373934_0260389 Ga0373934_0260389_218_622 132
176 3300035113 Ga0373936_0420463 Ga0373936_0420463_111_512 132
177 3300041458 Ga0451798_0019876 Ga0451798_0019876_307_705 132
178 3300048904 Ga0496101_0022873 Ga0496101_0022873_1375_1779 132
179 3300048909 Ga0496106_0106756 Ga0496106_0106756_1604_2008 132
180 3300048910 Ga0496107_0053762 Ga0496107_0053762_483_905 132
181 3300048918 Ga0496115_1000154 Ga0496115_1000154_66_470 132
182 3300048924 Ga0496121_0069632 Ga0496121_0069632_1590_2012 132
183 3300048929 Ga0496126_0360133 Ga0496126_0360133_355_777 132
184 3300053078 Ga0495612_0083989 Ga0495612_0083989_190_594 132
185 3300003659 JGI25404J52841_10041783 JGI25404J52841_100417832 133
186 3300005330 Ga0070690_100058425 Ga0070690_1000584251 133
187 3300005339 Ga0070660_100672368 Ga0070660_1006723682 133
188 3300005340 Ga0070689_100086432 Ga0070689_1000864323 133
189 3300005340 Ga0070689_101765199 Ga0070689_1017651992 133
190 3300005344 Ga0070661_100541460 Ga0070661_1005414602 133
191 3300005347 Ga0070668_100794311 Ga0070668_1007943111 133
192 3300005354 Ga0070675_100813661 Ga0070675_1008136611 133
193 3300005354 Ga0070675_101057654 Ga0070675_1010576541 133
194 3300005356 Ga0070674_100126318 Ga0070674_1001263182 133
195 3300005356 Ga0070674_100931546 Ga0070674_1009315462 133
196 3300005365 Ga0070688_100171288 Ga0070688_1001712882 133
197 3300005366 Ga0070659_100141026 Ga0070659_1001410262 133
198 3300005366 Ga0070659_100361497 Ga0070659_1003614972 133
199 3300005434 Ga0070709_10741761 Ga0070709_107417612 133
200 3300005434 Ga0070709_11251331 Ga0070709_112513311 133
201 3300005436 Ga0070713_100824572 Ga0070713_1008245721 133
202 3300005436 Ga0070713_100835456 Ga0070713_1008354561 133
203 3300005438 Ga0070701_10081611 Ga0070701_100816111 133
204 3300005438 Ga0070701_10134755 Ga0070701_101347552 133
205 3300005439 Ga0070711_100712274 Ga0070711_1007122741 133
206 3300005445 Ga0070708_100130658 Ga0070708_1001306584 133
207 3300005455 Ga0070663_101007333 Ga0070663_1010073332 133
208 3300005456 Ga0070678_100090216 Ga0070678_1000902162 133
209 3300005456 Ga0070678_100176395 Ga0070678_1001763951 133
210 3300005456 Ga0070678_100465257 Ga0070678_1004652572 133
211 3300005456 Ga0070678_100510961 Ga0070678_1005109611 133
212 3300005456 Ga0070678_100536012 Ga0070678_1005360122 133
213 3300005458 Ga0070681_10158829 Ga0070681_101588293 133
214 3300005466 Ga0070685_10710774 Ga0070685_107107741 133
215 3300005467 Ga0070706_100493742 Ga0070706_1004937423 133
216 3300005468 Ga0070707_101394943 Ga0070707_1013949432 133
217 3300005471 Ga0070698_100165645 Ga0070698_1001656454 133
218 3300005471 Ga0070698_100431920 Ga0070698_1004319203 133
219 3300005530 Ga0070679_100472187 Ga0070679_1004721872 133
220 3300005530 Ga0070679_100895597 Ga0070679_1008955971 133
221 3300005543 Ga0070672_100072157 Ga0070672_1000721571 133
222 3300005543 Ga0070672_100201915 Ga0070672_1002019151 133
223 3300005544 Ga0070686_100279010 Ga0070686_1002790101 133
224 3300005544 Ga0070686_101066826 Ga0070686_1010668261 133
225 3300005545 Ga0070695_100383905 Ga0070695_1003839052 133
226 3300005548 Ga0070665_100415172 Ga0070665_1004151722 133
227 3300005563 Ga0068855_100069044 Ga0068855_1000690444 133
228 3300005564 Ga0070664_101304818 Ga0070664_1013048182 133
229 3300005614 Ga0068856_100290808 Ga0068856_1002908082 133
230 3300005616 Ga0068852_100038827 Ga0068852_1000388274 133
231 3300005617 Ga0068859_100477362 Ga0068859_1004773622 133
232 3300005718 Ga0068866_10090737 Ga0068866_100907372 133
233 3300005834 Ga0068851_10409266 Ga0068851_104092662 133
234 3300005840 Ga0068870_10828506 Ga0068870_108285061 133
235 3300005841 Ga0068863_100198236 Ga0068863_1001982361 133
236 3300005842 Ga0068858_100425889 Ga0068858_1004258892 133
237 3300005843 Ga0068860_100415599 Ga0068860_1004155992 133
238 3300005844 Ga0068862_100210791 Ga0068862_1002107914 133
239 3300005983 Ga0081540_1018032 Ga0081540_10180323 133
240 3300006038 Ga0075365_10037571 Ga0075365_100375714 133
241 3300006038 Ga0075365_10107814 Ga0075365_101078143 133
242 3300006048 Ga0075363_100129006 Ga0075363_1001290061 133
243 3300006173 Ga0070716_100931004 Ga0070716_1009310041 133
244 3300006175 Ga0070712_100047343 Ga0070712_1000473433 133
245 3300006178 Ga0075367_10404434 Ga0075367_104044341 133
246 3300006195 Ga0075366_10702273 Ga0075366_107022731 133
247 3300006358 Ga0068871_100057645 Ga0068871_1000576453 133
248 3300006358 Ga0068871_100580478 Ga0068871_1005804782 133
249 3300006881 Ga0068865_100010414 Ga0068865_1000104144 133
250 3300006881 Ga0068865_100601204 Ga0068865_1006012042 133
251 3300006931 Ga0097620_100477323 Ga0097620_1004773232 133
252 3300007265 Ga0099794_10032149 Ga0099794_100321492 133
253 3300007265 Ga0099794_10033703 Ga0099794_100337034 133
254 3300007788 Ga0099795_10022065 Ga0099795_100220653 133
255 3300009093 Ga0105240_10502751 Ga0105240_105027513 133
256 3300009101 Ga0105247_10009434 Ga0105247_100094346 133
257 3300009101 Ga0105247_10167731 Ga0105247_101677312 133
258 3300009177 Ga0105248_10880219 Ga0105248_108802191 133
259 3300009553 Ga0105249_10754043 Ga0105249_107540431 133
260 3300010159 Ga0099796_10033256 Ga0099796_100332562 133
261 3300010375 Ga0105239_10144153 Ga0105239_101441533 133
262 3300011119 Ga0105246_10861007 Ga0105246_108610072 133
263 3300013105 Ga0157369_11838967 Ga0157369_118389672 133
264 3300013296 Ga0157374_10914462 Ga0157374_109144622 133
265 3300013296 Ga0157374_11286653 Ga0157374_112866531 133
266 3300013296 Ga0157374_12040832 Ga0157374_120408321 133
267 3300013297 Ga0157378_10048156 Ga0157378_100481562 133
268 3300013297 Ga0157378_11703937 Ga0157378_117039371 133
269 3300013306 Ga0163162_10614388 Ga0163162_106143881 133
270 3300013306 Ga0163162_10706508 Ga0163162_107065081 133
271 3300013307 Ga0157372_10191237 Ga0157372_101912372 133
272 3300013308 Ga0157375_10073807 Ga0157375_100738074 133
273 3300014325 Ga0163163_10855348 Ga0163163_108553483 133
274 3300014326 Ga0157380_11123145 Ga0157380_111231451 133
275 3300014326 Ga0157380_11540141 Ga0157380_115401411 133
276 3300014497 Ga0182008_10164649 Ga0182008_101646492 133
277 3300014968 Ga0157379_10466712 Ga0157379_104667122 133
278 3300014969 Ga0157376_10357859 Ga0157376_103578591 133
279 3300017792 Ga0163161_10016627 Ga0163161_100166276 133
280 3300025315 Ga0207697_10291740 Ga0207697_102917402 133
281 3300025893 Ga0207682_10519851 Ga0207682_105198511 133
282 3300025901 Ga0207688_10088446 Ga0207688_100884464 133
283 3300025910 Ga0207684_10338198 Ga0207684_103381983 133
284 3300025913 Ga0207695_10469271 Ga0207695_104692711 133
285 3300025917 Ga0207660_10350272 Ga0207660_103502721 133
286 3300025919 Ga0207657_10243297 Ga0207657_102432974 133
287 3300025921 Ga0207652_10853699 Ga0207652_108536991 133
288 3300025922 Ga0207646_10231545 Ga0207646_102315454 133
289 3300025926 Ga0207659_10448066 Ga0207659_104480661 133
290 3300025929 Ga0207664_10301838 Ga0207664_103018382 133
291 3300025933 Ga0207706_10021355 Ga0207706_100213553 133
292 3300025935 Ga0207709_10149732 Ga0207709_101497322 133
293 3300025936 Ga0207670_10202327 Ga0207670_102023272 133
294 3300025937 Ga0207669_10073695 Ga0207669_100736953 133
295 3300025938 Ga0207704_10026146 Ga0207704_100261462 133
296 3300025940 Ga0207691_10022479 Ga0207691_100224793 133
297 3300025940 Ga0207691_10195560 Ga0207691_101955604 133
298 3300025942 Ga0207689_10130988 Ga0207689_101309882 133
299 3300025945 Ga0207679_10571965 Ga0207679_105719652 133
300 3300025949 Ga0207667_10180050 Ga0207667_101800502 133
301 3300025949 Ga0207667_11677130 Ga0207667_116771302 133
302 3300025972 Ga0207668_10451124 Ga0207668_104511242 133
303 3300025986 Ga0207658_10614389 Ga0207658_106143892 133
304 3300026035 Ga0207703_10775754 Ga0207703_107757541 133
305 3300026035 Ga0207703_11445403 Ga0207703_114454032 133
306 3300026067 Ga0207678_10585937 Ga0207678_105859373 133
307 3300026075 Ga0207708_10111321 Ga0207708_101113213 133
308 3300026078 Ga0207702_10375871 Ga0207702_103758712 133
309 3300026089 Ga0207648_10310996 Ga0207648_103109961 133
310 3300026095 Ga0207676_11224474 Ga0207676_112244741 133
311 3300026118 Ga0207675_100649072 Ga0207675_1006490722 133
312 3300026121 Ga0207683_10307056 Ga0207683_103070564 133
313 3300026121 Ga0207683_10502364 Ga0207683_105023642 133
314 3300026121 Ga0207683_10554599 Ga0207683_105545992 133
315 3300026121 Ga0207683_10751022 Ga0207683_107510221 133
316 3300026142 Ga0207698_10298495 Ga0207698_102984951 133
317 3300027671 Ga0209588_1013366 Ga0209588_10133662 133
318 3300028379 Ga0268266_10546672 Ga0268266_105466721 133
319 3300028379 Ga0268266_10769463 Ga0268266_107694631 133
320 3300031711 Ga0265314_10041341 Ga0265314_100413412 133
321 3300032005 Ga0307411_11940839 Ga0307411_119408391 133
322 3300033180 Ga0307510_10061950 Ga0307510_100619501 133
323 3300033442 Ga0315911_1000001 Ga0315911_10000011025 133
324 3300035083 Ga0373926_0218519 Ga0373926_0218519_28_447 133
325 3300035085 Ga0373929_0046364 Ga0373929_0046364_491_907 133
326 3300035086 Ga0373934_0022928 Ga0373934_0022928_1326_1730 133
327 3300035086 Ga0373934_0101876 Ga0373934_0101876_180_599 133
328 3300035089 Ga0373944_0077284 Ga0373944_0077284_31_450 133
329 3300035111 Ga0373923_0044635 Ga0373923_0044635_867_1286 133
330 3300035111 Ga0373923_0051159 Ga0373923_0051159_690_1094 133
331 3300035113 Ga0373936_0015833 Ga0373936_0015833_2246_2665 133
332 3300035113 Ga0373936_0573897 Ga0373936_0573897_80_481 133
333 3300035116 Ga0373945_0018308 Ga0373945_0018308_1520_1939 133
334 3300035117 Ga0373953_0000391 Ga0373953_0000391_1568_1972 133
335 3300035118 Ga0373954_0000035 Ga0373954_0000035_22981_23385 133
336 3300035118 Ga0373954_0006222 Ga0373954_0006222_3218_3637 133
337 3300035119 Ga0373956_0000207 Ga0373956_0000207_12302_12706 133
338 3300035119 Ga0373956_0428988 Ga0373956_0428988_59_478 133
339 3300035120 Ga0373957_0001128 Ga0373957_0001128_556_960 133
340 3300035170 Ga0373943_0015005 Ga0373943_0015005_1395_1814 133
341 3300035171 Ga0373946_0004658 Ga0373946_0004658_4266_4685 133
342 3300035172 Ga0373955_0001026 Ga0373955_0001026_11321_11725 133
343 3300035172 Ga0373955_0107721 Ga0373955_0107721_650_1069 133
344 3300035410 Ga0373924_0006045 Ga0373924_0006045_3653_4057 133
345 3300035410 Ga0373924_0080478 Ga0373924_0080478_746_1165 133
346 3300035691 Ga0373931_0081607 Ga0373931_0081607_1004_1456 133
347 3300035691 Ga0373931_0350007 Ga0373931_0350007_164_571 133
348 3300035692 Ga0373935_0000256 Ga0373935_0000256_14412_14831 133
349 3300035692 Ga0373935_1398112 Ga0373935_1398112_35_442 133
350 3300035695 Ga0373927_0005857 Ga0373927_0005857_5451_5870 133
351 3300035724 Ga0373933_0000037 Ga0373933_0000037_47345_47749 133
352 3300035725 Ga0373947_0001480 Ga0373947_0001480_10285_10704 133
353 3300036401 Ga0373937_0000118 Ga0373937_0000118_20020_20424 133
354 3300036401 Ga0373937_0076968 Ga0373937_0076968_1953_2372 133
355 3300037068 Ga0373925_0020476 Ga0373925_0020476_927_1346 133
356 3300037068 Ga0373925_0370803 Ga0373925_0370803_467_871 133
357 3300037068 Ga0373925_0805655 Ga0373925_0805655_214_639 133
358 3300037471 Ga0395905_1042395 Ga0395905_1042395_253_696 133
359 3300041512 Ga0451853_1679816 Ga0451853_1679816_23_478 133
360 3300046454 Ga0495592_0000649 Ga0495592_0000649_18145_18549 133
361 3300046454 Ga0495592_0087410 Ga0495592_0087410_232_684 133
362 3300046455 Ga0495603_0000027 Ga0495603_0000027_36718_37137 133
363 3300046455 Ga0495603_0008387 Ga0495603_0008387_5457_5861 133
364 3300046459 Ga0495629_0000290 Ga0495629_0000290_28569_28988 133
365 3300046459 Ga0495629_0001487 Ga0495629_0001487_114_518 133
366 3300046460 Ga0495638_0528787 Ga0495638_0528787_106_513 133
367 3300046461 Ga0495641_0004283 Ga0495641_0004283_1607_2026 133
368 3300046462 Ga0495651_0000412 Ga0495651_0000412_5576_5980 133
369 3300046462 Ga0495651_0084347 Ga0495651_0084347_1496_1909 133
370 3300046462 Ga0495651_0918980 Ga0495651_0918980_50_466 133
371 3300046463 Ga0495653_0000161 Ga0495653_0000161_31941_32345 133
372 3300046463 Ga0495653_0100958 Ga0495653_0100958_501_920 133
373 3300046463 Ga0495653_0591316 Ga0495653_0591316_37_492 133
374 3300046472 Ga0495580_0000610 Ga0495580_0000610_15379_15798 133
375 3300046473 Ga0495582_0000425 Ga0495582_0000425_21256_21675 133
376 3300046475 Ga0495639_0000048 Ga0495639_0000048_14409_14828 133
377 3300046476 Ga0495662_0000505 Ga0495662_0000505_6145_6564 133
378 3300046477 Ga0495664_0050706 Ga0495664_0050706_2020_2439 133
379 3300046477 Ga0495664_0096962 Ga0495664_0096962_830_1285 133
380 3300046477 Ga0495664_0703819 Ga0495664_0703819_128_532 133
381 3300046491 Ga0495584_0307757 Ga0495584_0307757_57_476 133
382 3300046492 Ga0495585_0265705 Ga0495585_0265705_97_513 133
383 3300046499 Ga0495594_0000279 Ga0495594_0000279_12438_12857 133
384 3300046511 Ga0495608_0000337 Ga0495608_0000337_672_1076 133
385 3300046511 Ga0495608_0349304 Ga0495608_0349304_222_641 133
386 3300046514 Ga0495618_0074656 Ga0495618_0074656_1377_1781 133
387 3300046515 Ga0495620_0150551 Ga0495620_0150551_55_471 133
388 3300046516 Ga0495628_0002406 Ga0495628_0002406_5326_5730 133
389 3300046517 Ga0495630_0008325 Ga0495630_0008325_1346_1765 133
390 3300046518 Ga0495631_0095919 Ga0495631_0095919_658_1068 133
391 3300046520 Ga0495637_0330750 Ga0495637_0330750_13_429 133
392 3300046524 Ga0495648_0376063 Ga0495648_0376063_202_603 133
393 3300046526 Ga0495666_0092289 Ga0495666_0092289_78_497 133
394 3300046529 Ga0495652_0000604 Ga0495652_0000604_34268_34672 133
395 3300046529 Ga0495652_0016212 Ga0495652_0016212_990_1409 133
396 3300046531 Ga0495665_0000165 Ga0495665_0000165_11332_11751 133
397 3300046533 Ga0495640_0002246 Ga0495640_0002246_9301_9720 133
398 3300046533 Ga0495640_0009295 Ga0495640_0009295_253_657 133
399 3300046535 Ga0495586_0277184 Ga0495586_0277184_213_632 133
400 3300046536 Ga0495587_0012948 Ga0495587_0012948_126_530 133
401 3300046543 Ga0495645_0047900 Ga0495645_0047900_797_1201 133
402 3300046543 Ga0495645_0181486 Ga0495645_0181486_640_1095 133
403 3300046557 Ga0495622_0050752 Ga0495622_0050752_1337_1756 133
404 3300046558 Ga0495633_0101446 Ga0495633_0101446_592_1008 133
405 3300046559 Ga0495667_0000147 Ga0495667_0000147_31679_32083 133
406 3300046559 Ga0495667_0034694 Ga0495667_0034694_1060_1479 133
407 3300046642 Ga0495634_0001502 Ga0495634_0001502_19520_19939 133
408 3300046642 Ga0495634_0002287 Ga0495634_0002287_5372_5776 133
409 3300046663 Ga0495635_0000517 Ga0495635_0000517_19345_19749 133
410 3300046663 Ga0495635_0004027 Ga0495635_0004027_1977_2396 133
411 3300046663 Ga0495635_0310910 Ga0495635_0310910_476_931 133
412 3300046674 Ga0495588_0032126 Ga0495588_0032126_1629_2048 133
413 3300046675 Ga0495657_0000995 Ga0495657_0000995_4715_5119 133
414 3300046675 Ga0495657_0108342 Ga0495657_0108342_1161_1580 133
415 3300046678 Ga0495599_0000253 Ga0495599_0000253_33147_33551 133
416 3300046679 Ga0495623_0000549 Ga0495623_0000549_19894_20298 133
417 3300046679 Ga0495623_0250590 Ga0495623_0250590_192_647 133
418 3300046680 Ga0495646_0003057 Ga0495646_0003057_2867_3271 133
419 3300046680 Ga0495646_0039365 Ga0495646_0039365_1472_1891 133
420 3300046681 Ga0495647_0000836 Ga0495647_0000836_4231_4650 133
421 3300046683 Ga0495658_0001036 Ga0495658_0001036_2233_2652 133
422 3300046684 Ga0495669_0037419 Ga0495669_0037419_1282_1698 133
423 3300046689 Ga0495613_0030930 Ga0495613_0030930_567_986 133
424 3300046689 Ga0495613_0204447 Ga0495613_0204447_269_673 133
425 3300046690 Ga0495624_0000380 Ga0495624_0000380_28461_28880 133
426 3300046809 Ga0495600_0001048 Ga0495600_0001048_14431_14835 133
427 3300047315 Ga0495581_0006694 Ga0495581_0006694_5734_6153 133
428 3300047315 Ga0495581_0302570 Ga0495581_0302570_127_651 133
429 3300047317 Ga0495604_0000253 Ga0495604_0000253_15310_15714 133
430 3300047319 Ga0495674_0007638 Ga0495674_0007638_6251_6670 133
431 3300047319 Ga0495674_0161694 Ga0495674_0161694_686_1090 133
432 3300047319 Ga0495674_0350771 Ga0495674_0350771_645_1169 133
433 3300047321 Ga0495676_0031535 Ga0495676_0031535_2651_3070 133
434 3300047322 Ga0495680_0000406 Ga0495680_0000406_31925_32329 133
435 3300047444 Ga0495675_0000285 Ga0495675_0000285_4175_4579 133
436 3300047445 Ga0495677_0048091 Ga0495677_0048091_616_1032 133
437 3300047471 Ga0495684_0000184 Ga0495684_0000184_12209_12613 133
438 3300047471 Ga0495684_0038153 Ga0495684_0038153_1628_2047 133
439 3300047673 Ga0495593_0000160 Ga0495593_0000160_19285_19704 133
440 3300047673 Ga0495593_0007660 Ga0495593_0007660_208_612 133
441 3300048088 Ga0495602_0001148 Ga0495602_0001148_322_726 133
442 3300048088 Ga0495602_0782071 Ga0495602_0782071_46_459 133
443 3300048088 Ga0495602_0811547 Ga0495602_0811547_179_586 133
444 3300048089 Ga0495614_0027200 Ga0495614_0027200_525_944 133
445 3300048904 Ga0496101_1291764 Ga0496101_1291764_136_543 133
446 3300048911 Ga0496108_1188927 Ga0496108_1188927_214_621 133
447 3300048912 Ga0496109_0363360 Ga0496109_0363360_355_762 133
448 3300048913 Ga0496110_0454695 Ga0496110_0454695_516_923 133
449 3300048913 Ga0496110_0798716 Ga0496110_0798716_130_573 133
450 3300048915 Ga0496112_0268308 Ga0496112_0268308_33_476 133
451 3300048922 Ga0496119_0438543 Ga0496119_0438543_108_518 133
452 3300048924 Ga0496121_0413785 Ga0496121_0413785_437_868 133
453 3300048929 Ga0496126_0126655 Ga0496126_0126655_671_1093 133
454 3300048929 Ga0496126_0272311 Ga0496126_0272311_923_1348 133
455 3300050490 nmdc:mga03n38_499769_c1 nmdc:mga03n38_499769_c1_232_657 133
456 3300050492 nmdc:mga0yw44_569505_c1 nmdc:mga0yw44_569505_c1_244_654 133
457 3300050494 nmdc:mga06z11_385778_c1 nmdc:mga06z11_385778_c1_59_490 133
458 3300050496 nmdc:mga07m45_60739_c1 nmdc:mga07m45_60739_c1_534_935 133
459 3300050514 nmdc:mga08x19_480019_c1 nmdc:mga08x19_480019_c1_350_751 133
460 3300053077 Ga0495601_0004707 Ga0495601_0004707_3303_3707 133
461 3300053080 Ga0500635_0026146 Ga0500635_0026146_1393_1797 133
462 3300053084 Ga0495595_0000318 Ga0495595_0000318_12489_12893 133
463 3300053084 Ga0495595_0605417 Ga0495595_0605417_109_519 133
464 3300053085 Ga0495619_0000209 Ga0495619_0000209_10185_10589 133
465 3300053085 Ga0495619_0316714 Ga0495619_0316714_127_546 133
466 3300053085 Ga0495619_0669380 Ga0495619_0669380_47_457 133
467 3300053102 Ga0500554_049232 Ga0500554_049232_388_792 133
468 3300053150 Ga0500603_034089 Ga0500603_034089_467_871 133
469 3300053162 Ga0500638_345321 Ga0500638_345321_114_518 133
470 3300053178 Ga0500637_0022637 Ga0500637_0022637_585_1001 133
471 3300053178 Ga0500637_0064352 Ga0500637_0064352_1545_1949 133
472 iso_pu_bacteria 2908739725 2908743439 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00042

Globin

Globin

25

127

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ohd-assembly1.cif.gz_A crystal structure of ferric murine neuroglobin cdless mutant 0.8158 7 131
1v5h-assembly1.cif.gz_A-2 crystal structure of human cytoglobin (ferric form) 0.804 7 132
4mu5-assembly1.cif.gz_A crystal structure of murine neuroglobin mutant m144w 0.8018 7 126
5o1k-assembly1.cif.gz_A crystal structure of murine neuroglobin mutant v140w under 20 bar xenon pressure 0.798 7 126
6h6i-assembly1.cif.gz_A ferric murine neuroglobin gly-loop mutant 0.7971 7 131
ID Description Score Start End Superfamily
af_Q9I7P6_29_169_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8084 1 129 1.10.490.10
1v5hA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.804 7 132 1.10.490.10
af_Q22663_26_170_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.795 7 130 1.10.490.10
af_Q9I7P6_29_169_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.7813 1 129 1.10.490.10
3ubvG00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.7811 7 130 1.10.490.10
ID Description Score Start End GO Terms
AF-A0A1G9XHT6-F1-model_v4 Hemoglobin-like flavoprotein 0.9623 1 133 GO:0019825
GO:0020037
AF-A0A1G9XHT6-F1-model_v4 Hemoglobin-like flavoprotein 0.9553 1 133 GO:0019825
GO:0020037
AF-A0A0Q8U910-F1-model_v4 Globin domain-containing protein 0.9471 7 132 GO:0005344
GO:0019825
GO:0020037
AF-A0A257ELJ9-F1-model_v4 Globin 0.9444 7 132 GO:0019825
GO:0020037
AF-A0A537QWN2-F1-model_v4 Globin 0.9442 1 132 GO:0005344
GO:0019825
GO:0020037

Feature Viewer

pLDDT pTM Quality
87.26 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map