F450776

General Info

Members Datasets Scaffolds Average Seq Length
472 208 944 384

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100229266|Ga0075431_1002292661
Length 405
Sequence MGVSRTQVLATHSLPHERQPPECDVVVIGAGPAGLLTARRLATRGHRVVVLEEHDQIGAPVHCTGVLGLDAFDELGLSRRAIVGMAQAARFVAPNGTSVVVDDPGVRAAVVDRERFDCDLARDAIDAGADVRAGQRVATLEPGPNAVSVTTSRGRLAARAAVVACGASYRFNRALGFGVPSVLLHSAQLEVPFPALEHVQVHFGRRIAPGGFGWIVPFSRDDVSFARIGLLCDRDAGAAFRGFAAAIRSEYRLRDPWPEPRLKALPLAPVDRTWTDRIVAVGDAAGLVKPTTGGGIYYGLLTGHLAADVLSEALTAGEPTGSRLKEYERRWRARLGPEIRAGLAFRAVAAKLSDAAIDRLLELTRVDGIVPLLRQTADFNWHRTAARALLRHAEFRKIVVGAIFQ

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
141 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
152 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 2.12
Rhizosphere 97.67
Stem 0
Stem Tuber 0
Unclassified 10.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100229266 3300006847 Bacteria 1893
2 JGI24746J21847_1007450 3300001977 Bacteria 1674
3 Ga0065715_10006221 3300005293 Bacteria 5717
4 Ga0065707_10001331 3300005295 Bacteria 11085
5 Ga0065707_10010437 3300005295 Archaea 2071
6 Ga0070676_10064535 3300005328 Bacteria 2184
7 Ga0070676_10068622 3300005328 Bacteria 2123
8 Ga0070676_10136704 3300005328 Bacteria 1556
9 Ga0070683_100121695 3300005329 Unclassified 2466
10 Ga0070690_100033453 3300005330 Bacteria 3218
11 Ga0070670_100001633 3300005331 Bacteria 18138
12 Ga0070670_100035658 3300005331 Bacteria 4282
13 Ga0070677_10001110 3300005333 Bacteria 8650
14 Ga0068869_100001686 3300005334 Bacteria 13191
15 Ga0068869_100021836 3300005334 Bacteria 4405
16 Ga0070666_10009851 3300005335 Bacteria 5967
17 Ga0070666_10027072 3300005335 Bacteria 3751
18 Ga0068868_100011039 3300005338 Bacteria 6567
19 Ga0068868_100105896 3300005338 Bacteria 2281
20 Ga0070660_100072264 3300005339 Unclassified 2696
21 Ga0070660_100089834 3300005339 Bacteria 2421
22 Ga0070660_100347321 3300005339 Unclassified 1221
23 Ga0070689_100010754 3300005340 Bacteria 6536
24 Ga0070689_100012424 3300005340 Bacteria 6134
25 Ga0070689_100055304 3300005340 Bacteria 3075
26 Ga0070687_100045693 3300005343 Bacteria 2238
27 Ga0070692_10030018 3300005345 Bacteria 2715
28 Ga0070668_100028362 3300005347 Bacteria 4250
29 Ga0070669_100007142 3300005353 Bacteria 8026
30 Ga0070669_100025673 3300005353 Unclassified 4232
31 Ga0070669_100162468 3300005353 Unclassified 1736
32 Ga0070671_100025048 3300005355 Unclassified 4890
33 Ga0070671_100037025 3300005355 Bacteria 4046
34 Ga0070671_100114390 3300005355 Bacteria 2268
35 Ga0070674_100195845 3300005356 Bacteria 1557
36 Ga0070673_100012865 3300005364 Bacteria 5762
37 Ga0070688_100042731 3300005365 Bacteria 2789
38 Ga0070659_100196364 3300005366 Unclassified 1660
39 Ga0070667_100039907 3300005367 Bacteria 3935
40 Ga0070667_100103148 3300005367 Bacteria 2465
41 Ga0070713_100007680 3300005436 Bacteria 7591
42 Ga0070701_10135934 3300005438 Unclassified 1401
43 Ga0070705_100013674 3300005440 Bacteria 4154
44 Ga0070700_100034874 3300005441 Bacteria 3041
45 Ga0070700_100074202 3300005441 Unclassified 2179
46 Ga0070708_100153702 3300005445 Unclassified 2141
47 Ga0070708_100179143 3300005445 Bacteria 1980
48 Ga0070663_100021530 3300005455 Bacteria 4291
49 Ga0070662_100098664 3300005457 Bacteria 2207
50 Ga0068867_100031712 3300005459 Bacteria 3818
51 Ga0070707_100228435 3300005468 Bacteria 1812
52 Ga0070707_100344690 3300005468 Bacteria 1447
53 Ga0068853_100210271 3300005539 Bacteria 1773
54 Ga0070672_100011093 3300005543 Bacteria 6274
55 Ga0070672_100050115 3300005543 Bacteria 3251
56 Ga0070686_100007260 3300005544 Bacteria 6174
57 Ga0070686_100008249 3300005544 Bacteria 5832
58 Ga0070686_100021423 3300005544 Bacteria 3842
59 Ga0070686_100107119 3300005544 Bacteria 1898
60 Ga0070695_100071410 3300005545 Bacteria 2273
61 Ga0070665_100011752 3300005548 Bacteria 8839
62 Ga0070665_100052236 3300005548 Bacteria 4100
63 Ga0070704_100049206 3300005549 Bacteria 2956
64 Ga0070704_100223186 3300005549 Bacteria 1533
65 Ga0068855_100014968 3300005563 Bacteria 9342
66 Ga0070664_100003901 3300005564 Bacteria 12034
67 Ga0070664_100058294 3300005564 Bacteria 3284
68 Ga0070664_100401117 3300005564 Bacteria 1254
69 Ga0068857_100005323 3300005577 Bacteria 10961
70 Ga0068854_100009440 3300005578 Bacteria 6300
71 Ga0070702_100077670 3300005615 Bacteria 1979
72 Ga0068859_100010561 3300005617 Bacteria 9296
73 Ga0068859_100065904 3300005617 Bacteria 3656
74 Ga0068864_100023159 3300005618 Bacteria 5215
75 Ga0068866_10051530 3300005718 Bacteria 2096
76 Ga0068866_10111394 3300005718 Bacteria 1528
77 Ga0068861_100029359 3300005719 Bacteria 4023
78 Ga0068861_100066614 3300005719 Bacteria 2777
79 Ga0068870_10000379 3300005840 Bacteria 16723
80 Ga0068863_100015716 3300005841 Bacteria 7268
81 Ga0068863_100041562 3300005841 Bacteria 4372
82 Ga0068863_100297233 3300005841 Unclassified 1566
83 Ga0068858_100008277 3300005842 Bacteria 9998
84 Ga0068858_100018016 3300005842 Bacteria 6614
85 Ga0068858_100097059 3300005842 Bacteria 2747
86 Ga0068858_100184110 3300005842 Bacteria 1973
87 Ga0068860_100014377 3300005843 Bacteria 7757
88 Ga0068860_100227130 3300005843 Bacteria 1814
89 Ga0068860_100269002 3300005843 Bacteria 1663
90 Ga0068862_100045835 3300005844 Bacteria 3731
91 Ga0068862_100152352 3300005844 Bacteria 2058
92 Ga0081539_10026072 3300005985 Bacteria 3743
93 Ga0075367_10003158 3300006178 Bacteria 7762
94 Ga0097621_100010808 3300006237 Bacteria 6698
95 Ga0097621_100033981 3300006237 Bacteria 4065
96 Ga0097621_100084238 3300006237 Bacteria 2650
97 Ga0068871_100004714 3300006358 Bacteria 9537
98 Ga0068871_100006039 3300006358 Bacteria 8523
99 Ga0068871_100094635 3300006358 Bacteria 2494
100 Ga0068871_100101397 3300006358 Bacteria 2412
101 Ga0075428_100000388 3300006844 Bacteria 43622
102 Ga0075428_100008750 3300006844 Bacteria 11228
103 Ga0075428_100017967 3300006844 Bacteria 7815
104 Ga0075428_100063761 3300006844 Unclassified 4035
105 Ga0075430_100000392 3300006846 Bacteria 32268
106 Ga0075430_100020358 3300006846 Bacteria 5644
107 Ga0075431_100000076 3300006847 Bacteria 57752
108 Ga0075431_100101596 3300006847 Bacteria 2967
109 Ga0075431_100151571 3300006847 Bacteria 2387
110 Ga0075433_10009480 3300006852 Bacteria 7782
111 Ga0075433_10015228 3300006852 Bacteria 6303
112 Ga0075433_10030590 3300006852 Bacteria 4595
113 Ga0075433_10042153 3300006852 Bacteria 3959
114 Ga0075433_10113951 3300006852 Bacteria 2399
115 Ga0075434_100005730 3300006871 Bacteria 11339
116 Ga0075434_100015187 3300006871 Bacteria 7378
117 Ga0075434_100015495 3300006871 Bacteria 7313
118 Ga0075434_100036921 3300006871 Bacteria 4834
119 Ga0075434_100081396 3300006871 Unclassified 3235
120 Ga0075429_100000724 3300006880 Bacteria 25869
121 Ga0075429_100020953 3300006880 Bacteria 5671
122 Ga0068865_100010033 3300006881 Bacteria 5891
123 Ga0068865_100038093 3300006881 Bacteria 3252
124 Ga0075436_100000738 3300006914 Bacteria 21677
125 Ga0075436_100015301 3300006914 Bacteria 5255
126 Ga0075436_100018274 3300006914 Bacteria 4802
127 Ga0097620_100010561 3300006931 Bacteria 9296
128 Ga0097620_100065900 3300006931 Bacteria 3656
129 Ga0075435_100000030 3300007076 Bacteria 80021
130 Ga0075435_100004839 3300007076 Bacteria 9320
131 Ga0075435_100013059 3300007076 Bacteria 6168
132 Ga0075435_100030201 3300007076 Bacteria 4259
133 Ga0075435_100235457 3300007076 Archaea 1556
134 Ga0105240_10047477 3300009093 Bacteria 5433
135 Ga0111539_10000619 3300009094 Bacteria 46079
136 Ga0111539_10000983 3300009094 Bacteria 37367
137 Ga0111539_10007191 3300009094 Bacteria 14264
138 Ga0111539_10016474 3300009094 Bacteria 9165
139 Ga0111539_10044048 3300009094 Bacteria 5348
140 Ga0111539_10222523 3300009094 Bacteria 2198
141 Ga0111539_10281809 3300009094 Bacteria 1934
142 Ga0105245_10005866 3300009098 Bacteria 10786
143 Ga0114129_10000515 3300009147 Bacteria 47361
144 Ga0114129_10002444 3300009147 Bacteria 25788
145 Ga0114129_10005457 3300009147 Bacteria 17969
146 Ga0114129_10018655 3300009147 Bacteria 9877
147 Ga0114129_10064480 3300009147 Bacteria 5113
148 Ga0114129_10072901 3300009147 Bacteria 4785
149 Ga0114129_10166646 3300009147 Bacteria 3006
150 Ga0114129_10434940 3300009147 Unclassified 1723
151 Ga0105243_10020260 3300009148 Bacteria 5043
152 Ga0105242_10020932 3300009176 Bacteria 5131
153 Ga0105242_10091157 3300009176 Bacteria 2565
154 Ga0105248_10003831 3300009177 Bacteria 16671
155 Ga0105248_10018517 3300009177 Bacteria 7697
156 Ga0105248_10029203 3300009177 Bacteria 6150
157 Ga0105248_10118973 3300009177 Bacteria 2980
158 Ga0105249_10001137 3300009553 Bacteria 23542
159 Ga0105249_10026826 3300009553 Bacteria 5195
160 Ga0105249_10179105 3300009553 Bacteria 2061
161 Ga0105246_10041095 3300011119 Bacteria 3123
162 Ga0105246_10054271 3300011119 Bacteria 2761
163 Ga0157374_10209014 3300013296 Bacteria 1913
164 Ga0163162_10013119 3300013306 Bacteria 8090
165 Ga0163162_10155897 3300013306 Bacteria 2404
166 Ga0163162_10355170 3300013306 Unclassified 1598
167 Ga0157375_10008451 3300013308 Bacteria 9017
168 Ga0157375_10089027 3300013308 Bacteria 3142
169 Ga0163163_10035461 3300014325 Bacteria 4839
170 Ga0163163_10160361 3300014325 Bacteria 2294
171 Ga0157380_10001700 3300014326 Bacteria 14537
172 Ga0157380_10015380 3300014326 Bacteria 5625
173 Ga0157380_10017736 3300014326 Bacteria 5273
174 Ga0157380_10028733 3300014326 Bacteria 4244
175 Ga0157380_10063376 3300014326 Bacteria 2963
176 Ga0157377_10002460 3300014745 Bacteria 8197
177 Ga0157379_10003940 3300014968 Bacteria 12653
178 Ga0157379_10071640 3300014968 Bacteria 3100
179 Ga0157376_10001355 3300014969 Bacteria 16123
180 Ga0157376_10026243 3300014969 Bacteria 4601
181 Ga0163161_10023942 3300017792 Bacteria 4310
182 Ga0163161_10110343 3300017792 Bacteria 2056
183 Ga0207697_10000546 3300025315 Bacteria 21291
184 Ga0207682_10000187 3300025893 Bacteria 28111
185 Ga0207642_10035041 3300025899 Bacteria 2140
186 Ga0207688_10000605 3300025901 Bacteria 17668
187 Ga0207688_10076654 3300025901 Bacteria 1904
188 Ga0207680_10053213 3300025903 Bacteria 2429
189 Ga0207699_10057606 3300025906 Bacteria 2321
190 Ga0207645_10000532 3300025907 Bacteria 31634
191 Ga0207645_10039027 3300025907 Bacteria 3043
192 Ga0207643_10001282 3300025908 Bacteria 14671
193 Ga0207643_10067799 3300025908 Bacteria 2049
194 Ga0207663_10158538 3300025916 Bacteria 1595
195 Ga0207662_10001399 3300025918 Bacteria 11663
196 Ga0207662_10001463 3300025918 Bacteria 11461
197 Ga0207662_10116730 3300025918 Bacteria 1669
198 Ga0207657_10022262 3300025919 Bacteria 5938
199 Ga0207649_10064398 3300025920 Unclassified 2318
200 Ga0207650_10011337 3300025925 Bacteria 6134
201 Ga0207659_10015567 3300025926 Bacteria 4932
202 Ga0207687_10013723 3300025927 Bacteria 5290
203 Ga0207700_10009767 3300025928 Bacteria 6016
204 Ga0207644_10041494 3300025931 Bacteria 3255
205 Ga0207690_10044090 3300025932 Bacteria 2938
206 Ga0207690_10092328 3300025932 Bacteria 2142
207 Ga0207706_10000934 3300025933 Bacteria 29880
208 Ga0207706_10063763 3300025933 Bacteria 3244
209 Ga0207706_10096116 3300025933 Bacteria 2605
210 Ga0207706_10124510 3300025933 Bacteria 2268
211 Ga0207686_10009054 3300025934 Bacteria 5391
212 Ga0207686_10046982 3300025934 Bacteria 2667
213 Ga0207709_10010615 3300025935 Bacteria 5075
214 Ga0207709_10041107 3300025935 Bacteria 2773
215 Ga0207670_10187086 3300025936 Unclassified 1564
216 Ga0207670_10209581 3300025936 Unclassified 1485
217 Ga0207669_10050950 3300025937 Bacteria 2478
218 Ga0207669_10193572 3300025937 Bacteria 1469
219 Ga0207704_10011063 3300025938 Bacteria 4427
220 Ga0207691_10000275 3300025940 Bacteria 50845
221 Ga0207691_10073272 3300025940 Bacteria 3088
222 Ga0207711_10019030 3300025941 Bacteria 5714
223 Ga0207711_10024351 3300025941 Bacteria 5070
224 Ga0207711_10031070 3300025941 Bacteria 4507
225 Ga0207711_10199997 3300025941 Bacteria 1823
226 Ga0207711_10239509 3300025941 Bacteria 1663
227 Ga0207689_10001855 3300025942 Bacteria 19997
228 Ga0207689_10019895 3300025942 Bacteria 5654
229 Ga0207689_10080011 3300025942 Bacteria 2686
230 Ga0207679_10020648 3300025945 Bacteria 4448
231 Ga0207679_10063641 3300025945 Bacteria 2754
232 Ga0207667_10079010 3300025949 Unclassified 3409
233 Ga0207651_10050989 3300025960 Bacteria 2813
234 Ga0207651_10130841 3300025960 Bacteria 1921
235 Ga0207651_10319429 3300025960 Unclassified 1297
236 Ga0207712_10016464 3300025961 Bacteria 4789
237 Ga0207640_10064094 3300025981 Bacteria 2445
238 Ga0207658_10143435 3300025986 Bacteria 1936
239 Ga0207658_10145198 3300025986 Bacteria 1926
240 Ga0207703_10070082 3300026035 Bacteria 2893
241 Ga0207703_10139226 3300026035 Bacteria 2104
242 Ga0207639_10204975 3300026041 Bacteria 1694
243 Ga0207639_10249629 3300026041 Bacteria 1547
244 Ga0207678_10027693 3300026067 Unclassified 4947
245 Ga0207678_10108762 3300026067 Bacteria 2365
246 Ga0207708_10006442 3300026075 Bacteria 8700
247 Ga0207708_10012491 3300026075 Bacteria 6331
248 Ga0207708_10029957 3300026075 Bacteria 4126
249 Ga0207708_10078129 3300026075 Bacteria 2541
250 Ga0207641_10010256 3300026088 Bacteria 7705
251 Ga0207641_10027777 3300026088 Bacteria 4674
252 Ga0207641_10104577 3300026088 Bacteria 2500
253 Ga0207641_10327039 3300026088 Bacteria 1455
254 Ga0207648_10003816 3300026089 Bacteria 15755
255 Ga0207648_10051646 3300026089 Bacteria 3594
256 Ga0207648_10053037 3300026089 Bacteria 3546
257 Ga0207674_10037311 3300026116 Bacteria 5055
258 Ga0207675_100001425 3300026118 Bacteria 23964
259 Ga0207675_100033974 3300026118 Bacteria 4753
260 Ga0207675_100050596 3300026118 Bacteria 3877
261 Ga0207675_100053586 3300026118 Bacteria 3764
262 Ga0207675_100161514 3300026118 Bacteria 2137
263 Ga0207683_10193052 3300026121 Bacteria 1849
264 Ga0207698_10061890 3300026142 Bacteria 2919
265 Ga0207428_10004893 3300027907 Bacteria 12617
266 Ga0207428_10035329 3300027907 Bacteria 4085
267 Ga0207428_10065372 3300027907 Bacteria 2869
268 Ga0207428_10080623 3300027907 Bacteria 2542
269 Ga0268266_10026435 3300028379 Bacteria 4938
270 Ga0268264_10136930 3300028381 Bacteria 2178
271 Ga0268264_10217604 3300028381 Bacteria 1757
272 Ga0265332_10040224 3300031238 Bacteria 2024
273 Ga0307413_10085377 3300031824 Unclassified 2038
274 Ga0307410_10059621 3300031852 Unclassified 2606
275 Ga0307407_10025606 3300031903 Bacteria 3112
276 Ga0307407_10109317 3300031903 Bacteria 1733
277 Ga0307416_100067716 3300032002 Bacteria 2946
278 Ga0307416_100208754 3300032002 Unclassified 1861
279 Ga0307415_100162841 3300032126 Bacteria 1731
280 Ga0373943_0008749 3300035170 Bacteria 4534
281 Ga0373946_0001316 3300035171 Bacteria 8579
282 Ga0373955_0006684 3300035172 Bacteria 5262
283 Ga0373961_0056214 3300035241 Unclassified 1181
284 Ga0373924_0082349 3300035410 Unclassified 1370
285 Ga0373924_0084422 3300035410 Bacteria 1353
286 Ga0373935_0107168 3300035692 Unclassified 1850
287 Ga0373935_0197903 3300035692 Bacteria 1387
288 Ga0373947_0005843 3300035725 Bacteria 7167
289 Ga0373937_0209449 3300036401 Archaea 1834
290 Ga0373937_0256655 3300036401 Bacteria 1648
291 Ga0373925_0012016 3300037068 Bacteria 6270
292 Ga0439464_0026194 3300042439 Bacteria 1617
293 Ga0451577_0038079 3300042876 Bacteria 4326
294 Ga0495592_0100999 3300046454 Bacteria 2056
295 Ga0495582_0120887 3300046473 Archaea 1476
296 Ga0495639_0064282 3300046475 Bacteria 1686
297 Ga0495639_0098600 3300046475 Bacteria 1378
298 Ga0495659_0005186 3300046664 Bacteria 4095
299 Ga0495659_0007788 3300046664 Bacteria 3397
300 Ga0495647_0009383 3300046681 Bacteria 3313
301 Ga0495658_0020355 3300046683 Unclassified 3480
302 Ga0495669_0066808 3300046684 Bacteria 1634
303 Ga0495684_0053346 3300047471 Unclassified 3085
304 Ga0495684_0103179 3300047471 Bacteria 2155
305 Ga0496101_0006106 3300048904 Bacteria 7736
306 Ga0496102_0101444 3300048905 Bacteria 2673
307 Ga0496102_0109439 3300048905 Bacteria 2575
308 Ga0496104_0004854 3300048907 Bacteria 11714
309 Ga0496106_0027621 3300048909 Bacteria 4228
310 Ga0496111_0211088 3300048914 Bacteria 1442
311 Ga0496112_0145074 3300048915 Unclassified 2342
312 Ga0496112_0280618 3300048915 Bacteria 1613
313 Ga0496112_0348728 3300048915 Bacteria 1423
314 Ga0496114_0002434 3300048917 Bacteria 14197
315 Ga0501031_0000533 3300049568 Bacteria 22247
316 Ga0501031_0036377 3300049568 Bacteria 3211
317 Ga0501032_0053471 3300049569 Bacteria 2719
318 Ga0501032_0071000 3300049569 Bacteria 2321
319 Ga0501033_0001060 3300049570 Bacteria 25153
320 Ga0501033_0004041 3300049570 Bacteria 11852
321 Ga0501033_0057766 3300049570 Bacteria 2866
322 Ga0501034_0002300 3300049571 Bacteria 23413
323 Ga0501034_0024090 3300049571 Bacteria 6193
324 Ga0501034_0177214 3300049571 Unclassified 2097
325 Ga0501034_0206467 3300049571 Unclassified 1920
326 Ga0501034_0227706 3300049571 Unclassified 1814
327 Ga0501036_0001365 3300049572 Bacteria 18711
328 Ga0501036_0001518 3300049572 Bacteria 17903
329 Ga0501036_0007073 3300049572 Bacteria 9130
330 Ga0501036_0035487 3300049572 Bacteria 4219
331 Ga0501036_0130861 3300049572 Unclassified 2119
332 Ga0501037_0002350 3300049573 Bacteria 13662
333 Ga0501037_0119841 3300049573 Bacteria 1892
334 Ga0501038_0002976 3300049574 Bacteria 15789
335 Ga0501038_0007446 3300049574 Bacteria 10099
336 Ga0501039_0002059 3300049575 Bacteria 14907
337 Ga0501039_0005876 3300049575 Bacteria 9298
338 Ga0501039_0015551 3300049575 Bacteria 5823
339 Ga0501039_0226558 3300049575 Unclassified 1469
340 Ga0501040_0016401 3300049576 Bacteria 4904
341 Ga0501040_0053206 3300049576 Bacteria 2772
342 Ga0501040_0114140 3300049576 Bacteria 1891
343 Ga0501041_0038501 3300049577 Bacteria 2900
344 Ga0501041_0137931 3300049577 Unclassified 1520
345 Ga0501042_0012821 3300049578 Bacteria 5691
346 Ga0501042_0191488 3300049578 Bacteria 1475
347 Ga0501043_0003148 3300049579 Bacteria 13655
348 Ga0501043_0003319 3300049579 Bacteria 13262
349 Ga0501043_0048594 3300049579 Bacteria 3335
350 Ga0501046_0002862 3300049580 Bacteria 16039
351 Ga0501046_0003508 3300049580 Bacteria 14373
352 Ga0501046_0013062 3300049580 Bacteria 7048
353 Ga0501046_0030922 3300049580 Bacteria 4344
354 Ga0501046_0110353 3300049580 Bacteria 2102
355 Ga0501047_0000468 3300049581 Bacteria 43993
356 Ga0501047_0012643 3300049581 Bacteria 7997
357 Ga0501047_0087299 3300049581 Bacteria 2996
358 Ga0501048_0008310 3300049582 Bacteria 7851
359 Ga0501048_0064319 3300049582 Bacteria 2594
360 Ga0501048_0125299 3300049582 Unclassified 1816
361 Ga0501048_0137699 3300049582 Bacteria 1725
362 Ga0501048_0253647 3300049582 Unclassified 1249
363 Ga0501067_0005408 3300049583 Bacteria 7091
364 Ga0501067_0098121 3300049583 Bacteria 1627
365 Ga0501067_0149643 3300049583 Unclassified 1300
366 Ga0501068_0003553 3300049584 Bacteria 8424
367 Ga0501068_0006608 3300049584 Bacteria 6400
368 Ga0501068_0007240 3300049584 Bacteria 6143
369 Ga0501069_0000319 3300049585 Bacteria 21857
370 Ga0501069_0004894 3300049585 Bacteria 6939
371 Ga0501069_0027702 3300049585 Bacteria 3106
372 Ga0501069_0070213 3300049585 Bacteria 1962
373 Ga0501070_0050457 3300049586 Bacteria 3454
374 Ga0501070_0110486 3300049586 Bacteria 2272
375 Ga0501071_0011249 3300049587 Bacteria 6022
376 Ga0501071_0023039 3300049587 Bacteria 4345
377 Ga0501071_0043373 3300049587 Bacteria 3225
378 Ga0501072_0136003 3300049588 Bacteria 1959
379 Ga0501072_0141057 3300049588 Bacteria 1921
380 Ga0501072_0210735 3300049588 Unclassified 1548
381 Ga0501073_0000506 3300049589 Bacteria 27275
382 Ga0501073_0007989 3300049589 Bacteria 7854
383 Ga0501073_0008626 3300049589 Bacteria 7552
384 Ga0501073_0009511 3300049589 Bacteria 7176
385 Ga0501073_0023036 3300049589 Bacteria 4478
386 Ga0501073_0038982 3300049589 Bacteria 3368
387 Ga0501074_0000843 3300049590 Bacteria 19521
388 Ga0501074_0008937 3300049590 Bacteria 7265
389 Ga0501074_0048769 3300049590 Bacteria 3059
390 Ga0501075_0009204 3300049591 Bacteria 6906
391 Ga0501075_0031812 3300049591 Bacteria 3919
392 Ga0501075_0143599 3300049591 Archaea 1819
393 Ga0501076_0008198 3300049592 Bacteria 7653
394 Ga0501076_0018683 3300049592 Bacteria 5290
395 Ga0501076_0055450 3300049592 Bacteria 3143
396 Ga0501076_0156265 3300049592 Bacteria 1857
397 Ga0501076_0188262 3300049592 Bacteria 1684
398 Ga0501076_0228244 3300049592 Unclassified 1522
399 Ga0501079_0001827 3300049741 Bacteria 15228
400 Ga0501079_0031018 3300049741 Bacteria 4108
401 Ga0501079_0114570 3300049741 Bacteria 2095
402 Ga0501079_0149240 3300049741 Unclassified 1822
403 Ga0501080_0006260 3300049742 Bacteria 10678
404 Ga0501080_0026019 3300049742 Bacteria 5436
405 Ga0501080_0055181 3300049742 Bacteria 3701
406 Ga0501080_0100902 3300049742 Bacteria 2677
407 Ga0501081_0064546 3300049743 Bacteria 2543
408 Ga0501081_0184504 3300049743 Bacteria 1510
409 Ga0501083_0006976 3300049744 Bacteria 8014
410 Ga0501083_0011147 3300049744 Bacteria 6309
411 Ga0501083_0029145 3300049744 Bacteria 3799
412 Ga0501083_0062675 3300049744 Unclassified 2480
413 Ga0501083_0098921 3300049744 Bacteria 1924
414 Ga0501035_0011400 3300049822 Bacteria 8240
415 Ga0501035_0126120 3300049822 Bacteria 2234
416 Ga0501035_0275106 3300049822 Bacteria 1424
417 Ga0501044_0033606 3300049823 Bacteria 5387
418 Ga0501044_0089287 3300049823 Bacteria 3110
419 Ga0501044_0123587 3300049823 Bacteria 2586
420 Ga0501045_0003563 3300049824 Bacteria 10695
421 Ga0501045_0003588 3300049824 Bacteria 10658
422 nmdc:mga05p37_10976_c1 3300050507 Bacteria 10758
423 nmdc:mga05p37_150496_c1 3300050507 Bacteria 2847
424 nmdc:mga05p37_254219_c1 3300050507 Bacteria 2106
425 nmdc:mga05p37_45425_c1 3300050507 Bacteria 5402
426 nmdc:mga05p37_55_c1 3300050507 Bacteria 98735
427 nmdc:mga05p37_67353_c1 3300050507 Bacteria 4405
428 nmdc:mga05p37_93521_c1 3300050507 Bacteria 3704
429 nmdc:mga09592_226048_c1 3300050508 Unclassified 1621
430 nmdc:mga09592_51206_c1 3300050508 Unclassified 3483
431 nmdc:mga09592_562_c1 3300050508 Bacteria 28196
432 nmdc:mga0qj67_22482_c1 3300050509 Bacteria 4843
433 nmdc:mga0qj67_23829_c1 3300050509 Bacteria 4114
434 nmdc:mga0qj67_2440_c1 3300050509 Bacteria 13243
435 nmdc:mga06r32_218512_c1 3300050510 Bacteria 1894
436 nmdc:mga06r32_38977_c1 3300050510 Bacteria 4505
437 nmdc:mga06r32_8316_c1 3300050510 Bacteria 9338
438 nmdc:mga08y16_118383_c1 3300050511 Bacteria 2757
439 nmdc:mga08y16_12142_c1 3300050511 Bacteria 9053
440 nmdc:mga08y16_18576_c1 3300050511 Bacteria 7326
441 nmdc:mga08y16_19717_c1 3300050511 Bacteria 7110
442 nmdc:mga08y16_26348_c1 3300050511 Bacteria 6130
443 nmdc:mga0n895_117615_c1 3300050512 Bacteria 2678
444 nmdc:mga0n895_237638_c1 3300050512 Unclassified 1849
445 nmdc:mga0n895_28_c1 3300050512 Bacteria 89106
446 nmdc:mga0n895_433125_c1 3300050512 Unclassified 1329
447 nmdc:mga0n895_50102_c1 3300050512 Bacteria 4094
448 nmdc:mga0n895_61317_c1 3300050512 Bacteria 3713
449 nmdc:mga0rr50_10666_c1 3300050513 Bacteria 5846
450 nmdc:mga0rr50_15093_c1 3300050513 Bacteria 5091
451 nmdc:mga0rr50_23783_c1 3300050513 Unclassified 4233
452 nmdc:mga0rr50_31_c1 3300050513 Bacteria 102135
453 nmdc:mga0rr50_48657_c1 3300050513 Bacteria 3135
454 nmdc:mga08x19_105299_c1 3300050514 Bacteria 1876
455 nmdc:mga08x19_147_c1 3300050514 Bacteria 60119
456 nmdc:mga08x19_38617_c1 3300050514 Bacteria 3032
457 nmdc:mga0a205_177776_c1 3300050515 Bacteria 2023
458 nmdc:mga0a205_20787_c1 3300050515 Bacteria 6200
459 nmdc:mga0a205_35968_c2 3300050515 Bacteria 4190
460 nmdc:mga0a205_53344_c1 3300050515 Bacteria 3902
461 nmdc:mga0a205_7813_c1 3300050515 Bacteria 9713
462 Ga0495619_0031464 3300053085 Unclassified 3438
463 Ga0501084_0001392 3300054114 Bacteria 19136
464 Ga0501084_0022533 3300054114 Bacteria 5256
465 Ga0501084_0036832 3300054114 Bacteria 4088
466 Ga0501084_0088837 3300054114 Bacteria 2594
467 Ga0590071_002654 3300059421 Bacteria 4492
468 Ga0590071_005267 3300059421 Unclassified 3118
469 Ga0501082_0001316 3300060353 Bacteria 21744
470 Ga0501082_0007012 3300060353 Bacteria 9722
471 Ga0501082_0015935 3300060353 Bacteria 6465
472 Ga0530510_0049414 3300061734 Bacteria 3040
473 Ga0075431_100229266
474 JGI24746J21847_1007450
475 Ga0065715_10006221
476 Ga0065707_10001331
477 Ga0065707_10010437
478 Ga0070676_10064535
479 Ga0070676_10068622
480 Ga0070676_10136704
481 Ga0070683_100121695
482 Ga0070690_100033453
483 Ga0070670_100001633
484 Ga0070670_100035658
485 Ga0070677_10001110
486 Ga0068869_100001686
487 Ga0068869_100021836
488 Ga0070666_10009851
489 Ga0070666_10027072
490 Ga0068868_100011039
491 Ga0068868_100105896
492 Ga0070660_100072264
493 Ga0070660_100089834
494 Ga0070660_100347321
495 Ga0070689_100010754
496 Ga0070689_100012424
497 Ga0070689_100055304
498 Ga0070687_100045693
499 Ga0070692_10030018
500 Ga0070668_100028362
501 Ga0070669_100007142
502 Ga0070669_100025673
503 Ga0070669_100162468
504 Ga0070671_100025048
505 Ga0070671_100037025
506 Ga0070671_100114390
507 Ga0070674_100195845
508 Ga0070673_100012865
509 Ga0070688_100042731
510 Ga0070659_100196364
511 Ga0070667_100039907
512 Ga0070667_100103148
513 Ga0070713_100007680
514 Ga0070701_10135934
515 Ga0070705_100013674
516 Ga0070700_100034874
517 Ga0070700_100074202
518 Ga0070708_100153702
519 Ga0070708_100179143
520 Ga0070663_100021530
521 Ga0070662_100098664
522 Ga0068867_100031712
523 Ga0070707_100228435
524 Ga0070707_100344690
525 Ga0068853_100210271
526 Ga0070672_100011093
527 Ga0070672_100050115
528 Ga0070686_100007260
529 Ga0070686_100008249
530 Ga0070686_100021423
531 Ga0070686_100107119
532 Ga0070695_100071410
533 Ga0070665_100011752
534 Ga0070665_100052236
535 Ga0070704_100049206
536 Ga0070704_100223186
537 Ga0068855_100014968
538 Ga0070664_100003901
539 Ga0070664_100058294
540 Ga0070664_100401117
541 Ga0068857_100005323
542 Ga0068854_100009440
543 Ga0070702_100077670
544 Ga0068859_100010561
545 Ga0068859_100065904
546 Ga0068864_100023159
547 Ga0068866_10051530
548 Ga0068866_10111394
549 Ga0068861_100029359
550 Ga0068861_100066614
551 Ga0068870_10000379
552 Ga0068863_100015716
553 Ga0068863_100041562
554 Ga0068863_100297233
555 Ga0068858_100008277
556 Ga0068858_100018016
557 Ga0068858_100097059
558 Ga0068858_100184110
559 Ga0068860_100014377
560 Ga0068860_100227130
561 Ga0068860_100269002
562 Ga0068862_100045835
563 Ga0068862_100152352
564 Ga0081539_10026072
565 Ga0075367_10003158
566 Ga0097621_100010808
567 Ga0097621_100033981
568 Ga0097621_100084238
569 Ga0068871_100004714
570 Ga0068871_100006039
571 Ga0068871_100094635
572 Ga0068871_100101397
573 Ga0075428_100000388
574 Ga0075428_100008750
575 Ga0075428_100017967
576 Ga0075428_100063761
577 Ga0075430_100000392
578 Ga0075430_100020358
579 Ga0075431_100000076
580 Ga0075431_100101596
581 Ga0075431_100151571
582 Ga0075433_10009480
583 Ga0075433_10015228
584 Ga0075433_10030590
585 Ga0075433_10042153
586 Ga0075433_10113951
587 Ga0075434_100005730
588 Ga0075434_100015187
589 Ga0075434_100015495
590 Ga0075434_100036921
591 Ga0075434_100081396
592 Ga0075429_100000724
593 Ga0075429_100020953
594 Ga0068865_100010033
595 Ga0068865_100038093
596 Ga0075436_100000738
597 Ga0075436_100015301
598 Ga0075436_100018274
599 Ga0097620_100010561
600 Ga0097620_100065900
601 Ga0075435_100000030
602 Ga0075435_100004839
603 Ga0075435_100013059
604 Ga0075435_100030201
605 Ga0075435_100235457
606 Ga0105240_10047477
607 Ga0111539_10000619
608 Ga0111539_10000983
609 Ga0111539_10007191
610 Ga0111539_10016474
611 Ga0111539_10044048
612 Ga0111539_10222523
613 Ga0111539_10281809
614 Ga0105245_10005866
615 Ga0114129_10000515
616 Ga0114129_10002444
617 Ga0114129_10005457
618 Ga0114129_10018655
619 Ga0114129_10064480
620 Ga0114129_10072901
621 Ga0114129_10166646
622 Ga0114129_10434940
623 Ga0105243_10020260
624 Ga0105242_10020932
625 Ga0105242_10091157
626 Ga0105248_10003831
627 Ga0105248_10018517
628 Ga0105248_10029203
629 Ga0105248_10118973
630 Ga0105249_10001137
631 Ga0105249_10026826
632 Ga0105249_10179105
633 Ga0105246_10041095
634 Ga0105246_10054271
635 Ga0157374_10209014
636 Ga0163162_10013119
637 Ga0163162_10155897
638 Ga0163162_10355170
639 Ga0157375_10008451
640 Ga0157375_10089027
641 Ga0163163_10035461
642 Ga0163163_10160361
643 Ga0157380_10001700
644 Ga0157380_10015380
645 Ga0157380_10017736
646 Ga0157380_10028733
647 Ga0157380_10063376
648 Ga0157377_10002460
649 Ga0157379_10003940
650 Ga0157379_10071640
651 Ga0157376_10001355
652 Ga0157376_10026243
653 Ga0163161_10023942
654 Ga0163161_10110343
655 Ga0207697_10000546
656 Ga0207682_10000187
657 Ga0207642_10035041
658 Ga0207688_10000605
659 Ga0207688_10076654
660 Ga0207680_10053213
661 Ga0207699_10057606
662 Ga0207645_10000532
663 Ga0207645_10039027
664 Ga0207643_10001282
665 Ga0207643_10067799
666 Ga0207663_10158538
667 Ga0207662_10001399
668 Ga0207662_10001463
669 Ga0207662_10116730
670 Ga0207657_10022262
671 Ga0207649_10064398
672 Ga0207650_10011337
673 Ga0207659_10015567
674 Ga0207687_10013723
675 Ga0207700_10009767
676 Ga0207644_10041494
677 Ga0207690_10044090
678 Ga0207690_10092328
679 Ga0207706_10000934
680 Ga0207706_10063763
681 Ga0207706_10096116
682 Ga0207706_10124510
683 Ga0207686_10009054
684 Ga0207686_10046982
685 Ga0207709_10010615
686 Ga0207709_10041107
687 Ga0207670_10187086
688 Ga0207670_10209581
689 Ga0207669_10050950
690 Ga0207669_10193572
691 Ga0207704_10011063
692 Ga0207691_10000275
693 Ga0207691_10073272
694 Ga0207711_10019030
695 Ga0207711_10024351
696 Ga0207711_10031070
697 Ga0207711_10199997
698 Ga0207711_10239509
699 Ga0207689_10001855
700 Ga0207689_10019895
701 Ga0207689_10080011
702 Ga0207679_10020648
703 Ga0207679_10063641
704 Ga0207667_10079010
705 Ga0207651_10050989
706 Ga0207651_10130841
707 Ga0207651_10319429
708 Ga0207712_10016464
709 Ga0207640_10064094
710 Ga0207658_10143435
711 Ga0207658_10145198
712 Ga0207703_10070082
713 Ga0207703_10139226
714 Ga0207639_10204975
715 Ga0207639_10249629
716 Ga0207678_10027693
717 Ga0207678_10108762
718 Ga0207708_10006442
719 Ga0207708_10012491
720 Ga0207708_10029957
721 Ga0207708_10078129
722 Ga0207641_10010256
723 Ga0207641_10027777
724 Ga0207641_10104577
725 Ga0207641_10327039
726 Ga0207648_10003816
727 Ga0207648_10051646
728 Ga0207648_10053037
729 Ga0207674_10037311
730 Ga0207675_100001425
731 Ga0207675_100033974
732 Ga0207675_100050596
733 Ga0207675_100053586
734 Ga0207675_100161514
735 Ga0207683_10193052
736 Ga0207698_10061890
737 Ga0207428_10004893
738 Ga0207428_10035329
739 Ga0207428_10065372
740 Ga0207428_10080623
741 Ga0268266_10026435
742 Ga0268264_10136930
743 Ga0268264_10217604
744 Ga0265332_10040224
745 Ga0307413_10085377
746 Ga0307410_10059621
747 Ga0307407_10025606
748 Ga0307407_10109317
749 Ga0307416_100067716
750 Ga0307416_100208754
751 Ga0307415_100162841
752 Ga0373943_0008749
753 Ga0373946_0001316
754 Ga0373955_0006684
755 Ga0373961_0056214
756 Ga0373924_0082349
757 Ga0373924_0084422
758 Ga0373935_0107168
759 Ga0373935_0197903
760 Ga0373947_0005843
761 Ga0373937_0209449
762 Ga0373937_0256655
763 Ga0373925_0012016
764 Ga0439464_0026194
765 Ga0451577_0038079
766 Ga0495592_0100999
767 Ga0495582_0120887
768 Ga0495639_0064282
769 Ga0495639_0098600
770 Ga0495659_0005186
771 Ga0495659_0007788
772 Ga0495647_0009383
773 Ga0495658_0020355
774 Ga0495669_0066808
775 Ga0495684_0053346
776 Ga0495684_0103179
777 Ga0496101_0006106
778 Ga0496102_0101444
779 Ga0496102_0109439
780 Ga0496104_0004854
781 Ga0496106_0027621
782 Ga0496111_0211088
783 Ga0496112_0145074
784 Ga0496112_0280618
785 Ga0496112_0348728
786 Ga0496114_0002434
787 Ga0501031_0000533
788 Ga0501031_0036377
789 Ga0501032_0053471
790 Ga0501032_0071000
791 Ga0501033_0001060
792 Ga0501033_0004041
793 Ga0501033_0057766
794 Ga0501034_0002300
795 Ga0501034_0024090
796 Ga0501034_0177214
797 Ga0501034_0206467
798 Ga0501034_0227706
799 Ga0501036_0001365
800 Ga0501036_0001518
801 Ga0501036_0007073
802 Ga0501036_0035487
803 Ga0501036_0130861
804 Ga0501037_0002350
805 Ga0501037_0119841
806 Ga0501038_0002976
807 Ga0501038_0007446
808 Ga0501039_0002059
809 Ga0501039_0005876
810 Ga0501039_0015551
811 Ga0501039_0226558
812 Ga0501040_0016401
813 Ga0501040_0053206
814 Ga0501040_0114140
815 Ga0501041_0038501
816 Ga0501041_0137931
817 Ga0501042_0012821
818 Ga0501042_0191488
819 Ga0501043_0003148
820 Ga0501043_0003319
821 Ga0501043_0048594
822 Ga0501046_0002862
823 Ga0501046_0003508
824 Ga0501046_0013062
825 Ga0501046_0030922
826 Ga0501046_0110353
827 Ga0501047_0000468
828 Ga0501047_0012643
829 Ga0501047_0087299
830 Ga0501048_0008310
831 Ga0501048_0064319
832 Ga0501048_0125299
833 Ga0501048_0137699
834 Ga0501048_0253647
835 Ga0501067_0005408
836 Ga0501067_0098121
837 Ga0501067_0149643
838 Ga0501068_0003553
839 Ga0501068_0006608
840 Ga0501068_0007240
841 Ga0501069_0000319
842 Ga0501069_0004894
843 Ga0501069_0027702
844 Ga0501069_0070213
845 Ga0501070_0050457
846 Ga0501070_0110486
847 Ga0501071_0011249
848 Ga0501071_0023039
849 Ga0501071_0043373
850 Ga0501072_0136003
851 Ga0501072_0141057
852 Ga0501072_0210735
853 Ga0501073_0000506
854 Ga0501073_0007989
855 Ga0501073_0008626
856 Ga0501073_0009511
857 Ga0501073_0023036
858 Ga0501073_0038982
859 Ga0501074_0000843
860 Ga0501074_0008937
861 Ga0501074_0048769
862 Ga0501075_0009204
863 Ga0501075_0031812
864 Ga0501075_0143599
865 Ga0501076_0008198
866 Ga0501076_0018683
867 Ga0501076_0055450
868 Ga0501076_0156265
869 Ga0501076_0188262
870 Ga0501076_0228244
871 Ga0501079_0001827
872 Ga0501079_0031018
873 Ga0501079_0114570
874 Ga0501079_0149240
875 Ga0501080_0006260
876 Ga0501080_0026019
877 Ga0501080_0055181
878 Ga0501080_0100902
879 Ga0501081_0064546
880 Ga0501081_0184504
881 Ga0501083_0006976
882 Ga0501083_0011147
883 Ga0501083_0029145
884 Ga0501083_0062675
885 Ga0501083_0098921
886 Ga0501035_0011400
887 Ga0501035_0126120
888 Ga0501035_0275106
889 Ga0501044_0033606
890 Ga0501044_0089287
891 Ga0501044_0123587
892 Ga0501045_0003563
893 Ga0501045_0003588
894 nmdc:mga05p37_10976_c1
895 nmdc:mga05p37_150496_c1
896 nmdc:mga05p37_254219_c1
897 nmdc:mga05p37_45425_c1
898 nmdc:mga05p37_55_c1
899 nmdc:mga05p37_67353_c1
900 nmdc:mga05p37_93521_c1
901 nmdc:mga09592_226048_c1
902 nmdc:mga09592_51206_c1
903 nmdc:mga09592_562_c1
904 nmdc:mga0qj67_22482_c1
905 nmdc:mga0qj67_23829_c1
906 nmdc:mga0qj67_2440_c1
907 nmdc:mga06r32_218512_c1
908 nmdc:mga06r32_38977_c1
909 nmdc:mga06r32_8316_c1
910 nmdc:mga08y16_118383_c1
911 nmdc:mga08y16_12142_c1
912 nmdc:mga08y16_18576_c1
913 nmdc:mga08y16_19717_c1
914 nmdc:mga08y16_26348_c1
915 nmdc:mga0n895_117615_c1
916 nmdc:mga0n895_237638_c1
917 nmdc:mga0n895_28_c1
918 nmdc:mga0n895_433125_c1
919 nmdc:mga0n895_50102_c1
920 nmdc:mga0n895_61317_c1
921 nmdc:mga0rr50_10666_c1
922 nmdc:mga0rr50_15093_c1
923 nmdc:mga0rr50_23783_c1
924 nmdc:mga0rr50_31_c1
925 nmdc:mga0rr50_48657_c1
926 nmdc:mga08x19_105299_c1
927 nmdc:mga08x19_147_c1
928 nmdc:mga08x19_38617_c1
929 nmdc:mga0a205_177776_c1
930 nmdc:mga0a205_20787_c1
931 nmdc:mga0a205_35968_c2
932 nmdc:mga0a205_53344_c1
933 nmdc:mga0a205_7813_c1
934 Ga0495619_0031464
935 Ga0501084_0001392
936 Ga0501084_0022533
937 Ga0501084_0036832
938 Ga0501084_0088837
939 Ga0590071_002654
940 Ga0590071_005267
941 Ga0501082_0001316
942 Ga0501082_0007012
943 Ga0501082_0015935
944 Ga0530510_0049414

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

27

73

0.93

PF01946

Thi4

Thi4 family

12

81

0.9

PF00890

FAD_binding_2

FAD binding domain

24

71

0.87

PF01266

DAO

FAD dependent oxidoreductase

24

93

0.83

PF01494

FAD_binding_3

FAD binding domain

22

176

0.83

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

23

189

0.81

PF05834

Lycopene_cycl

Lycopene cyclase protein

24

187

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ocm-assembly1.cif.gz_A imine reductase from streptosporangium roseum in complex with nadp+ and 2,2,2-trifluoroacetophenone hydrate 0.9353 2 34
6dv2-assembly3.cif.gz_L crystal structure of human mitochondrial trifunctional protein 0.9337 2 30
3l6d-assembly1.cif.gz_A crystal structure of putative oxidoreductase from pseudomonas putida kt2440 0.9312 2 34
8i4n-assembly1.cif.gz_B crystal strcuture of 6-phosphogluconate dehydrogenase from corynebacterium glutamicum 0.9258 1 32
7xe8-assembly2.cif.gz_B crystal structure of imine reductase from streptomyces albidoflavus 0.9195 2 29
ID Description Score Start End Superfamily
af_I6XF25_1_136_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9797 3 34 3.40.50.720
1mfzC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9735 3 32 3.40.50.720
af_P0A6S7_1_191_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.971 2 34 3.40.50.720
af_Q58454_1_196_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9669 3 34 3.40.50.720
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.963 3 30 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V8MMY4-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.986 1 383 GO:0016628
AF-A0A7C5UA00-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9681 1 112
AF-A0A2V8C594-F1-model_v4 FAD/NAD(P)-binding domain-containing protein 0.9647 1 226 GO:0016491
AF-A0A847EFR0-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9627 1 382 GO:0016628
GO:0071949
AF-A0A7C3BV55-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9625 1 384 GO:0016628
GO:0071949

Map