F450748

General Info

Members Datasets Scaffolds Average Seq Length
472 235 944 70

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100569848|Ga0070708_1005698481
Length 80
Sequence MFEGLFQPMHLLVIFGIALLVFGPKKLPELGKGIGEGIRGFKSAMKEEEKAGQRQTDHGGTPKLTDEAKTNVRSAQDISA

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
114 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
172 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
173 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
181 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
182 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
183 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
184 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
185 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
186 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
187 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
188 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
197 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
198 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
210 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.88
Metatranscriptomes 2.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.39
Rhizosphere 95.34
Stem 0
Stem Tuber 0
Unclassified 45.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100569848 3300005445 Bacteria 1068
2 Ga0065712_10098956 3300005290 Unclassified 2104
3 Ga0065715_10092805 3300005293 Bacteria 4929
4 Ga0070676_10033024 3300005328 Unclassified 2968
5 Ga0070683_100044598 3300005329 Bacteria 4089
6 Ga0070690_100004905 3300005330 Bacteria 7479
7 Ga0070670_100153246 3300005331 Unclassified 1995
8 Ga0070677_10194116 3300005333 Unclassified 975
9 Ga0068869_100038105 3300005334 Unclassified 3423
10 Ga0070666_10011176 3300005335 Bacteria 5626
11 Ga0070666_10875337 3300005335 Unclassified 663
12 Ga0070680_100366571 3300005336 Unclassified 1225
13 Ga0070682_100004543 3300005337 Bacteria 7712
14 Ga0068868_100001611 3300005338 Bacteria 15395
15 Ga0068868_100070002 3300005338 Unclassified 2796
16 Ga0070660_100090090 3300005339 Unclassified 2417
17 Ga0070691_10892927 3300005341 Unclassified 548
18 Ga0070687_100276950 3300005343 Unclassified 1054
19 Ga0070661_100023928 3300005344 Bacteria 4382
20 Ga0070692_10416627 3300005345 Unclassified 852
21 Ga0070668_101269673 3300005347 Unclassified 669
22 Ga0070669_100011777 3300005353 Bacteria 6205
23 Ga0070675_100236411 3300005354 Bacteria 1595
24 Ga0070671_100516108 3300005355 Bacteria 1029
25 Ga0070688_100346502 3300005365 Unclassified 1086
26 Ga0070659_100032547 3300005366 Unclassified 4045
27 Ga0070667_100024488 3300005367 Bacteria 5013
28 Ga0070667_101896202 3300005367 Unclassified 561
29 Ga0070709_10020545 3300005434 Bacteria 3832
30 Ga0070709_10267931 3300005434 Unclassified 1236
31 Ga0070709_10292824 3300005434 Unclassified 1187
32 Ga0070709_10574231 3300005434 Bacteria 865
33 Ga0070714_100042711 3300005435 Bacteria 3831
34 Ga0070714_100086889 3300005435 Bacteria 2734
35 Ga0070714_100120153 3300005435 Bacteria 2336
36 Ga0070714_100232628 3300005435 Unclassified 1698
37 Ga0070714_100458847 3300005435 Bacteria 1211
38 Ga0070714_101180434 3300005435 Unclassified 746
39 Ga0070714_101410383 3300005435 Unclassified 680
40 Ga0070713_100103378 3300005436 Bacteria 2472
41 Ga0070713_100478084 3300005436 Bacteria 1173
42 Ga0070713_100928889 3300005436 Unclassified 837
43 Ga0070713_101070357 3300005436 Unclassified 779
44 Ga0070713_101990147 3300005436 Bacteria 564
45 Ga0070713_102216744 3300005436 Unclassified 532
46 Ga0070710_10006690 3300005437 Bacteria 5552
47 Ga0070710_11205024 3300005437 Bacteria 560
48 Ga0070701_10211659 3300005438 Bacteria 1151
49 Ga0070711_100391142 3300005439 Bacteria 1126
50 Ga0070711_100595284 3300005439 Bacteria 922
51 Ga0070711_101048060 3300005439 Unclassified 701
52 Ga0070705_100510948 3300005440 Unclassified 914
53 Ga0070705_101623280 3300005440 Bacteria 545
54 Ga0070700_100110908 3300005441 Unclassified 1824
55 Ga0070694_100530824 3300005444 Unclassified 940
56 Ga0070708_100009575 3300005445 Bacteria 7812
57 Ga0070708_100018428 3300005445 Bacteria 5844
58 Ga0070708_100018899 3300005445 Bacteria 5775
59 Ga0070708_100069407 3300005445 Bacteria 3169
60 Ga0070708_100120247 3300005445 Bacteria 2423
61 Ga0070708_100251776 3300005445 Bacteria 1659
62 Ga0070708_100290599 3300005445 Unclassified 1539
63 Ga0070708_100302206 3300005445 Bacteria 1507
64 Ga0070708_100536644 3300005445 Bacteria 1104
65 Ga0070708_100561902 3300005445 Bacteria 1076
66 Ga0070708_101012394 3300005445 Unclassified 779
67 Ga0070708_102183080 3300005445 Bacteria 512
68 Ga0070663_100010922 3300005455 Bacteria 5675
69 Ga0070663_101408946 3300005455 Unclassified 617
70 Ga0070678_100280026 3300005456 Unclassified 1410
71 Ga0070662_100000540 3300005457 Bacteria 22952
72 Ga0070681_10228875 3300005458 Bacteria 1773
73 Ga0068867_100043261 3300005459 Unclassified 3297
74 Ga0070685_10642694 3300005466 Unclassified 768
75 Ga0070706_100001986 3300005467 Bacteria 21097
76 Ga0070706_100018511 3300005467 Bacteria 6422
77 Ga0070706_100039690 3300005467 Bacteria 4345
78 Ga0070706_100261425 3300005467 Unclassified 1615
79 Ga0070706_101000823 3300005467 Bacteria 771
80 Ga0070706_101366480 3300005467 Bacteria 649
81 Ga0070706_101784771 3300005467 Unclassified 559
82 Ga0070706_101975718 3300005467 Unclassified 528
83 Ga0070707_100000486 3300005468 Bacteria 39330
84 Ga0070707_100002543 3300005468 Bacteria 17343
85 Ga0070707_100010408 3300005468 Bacteria 8663
86 Ga0070707_100011910 3300005468 Bacteria 8114
87 Ga0070707_100195895 3300005468 Unclassified 1970
88 Ga0070707_100302064 3300005468 Unclassified 1555
89 Ga0070707_100378478 3300005468 Unclassified 1375
90 Ga0070707_100619847 3300005468 Unclassified 1044
91 Ga0070707_101356570 3300005468 Unclassified 677
92 Ga0070707_101396834 3300005468 Bacteria 667
93 Ga0070707_101399904 3300005468 Unclassified 666
94 Ga0070698_100005121 3300005471 Bacteria 14348
95 Ga0070698_100015342 3300005471 Bacteria 8097
96 Ga0070698_100335781 3300005471 Bacteria 1442
97 Ga0070698_100547394 3300005471 Unclassified 1096
98 Ga0070698_100891936 3300005471 Unclassified 835
99 Ga0070698_100936947 3300005471 Unclassified 812
100 Ga0070698_101421978 3300005471 Unclassified 644
101 Ga0070699_100003692 3300005518 Bacteria 13537
102 Ga0070699_100053619 3300005518 Bacteria 3490
103 Ga0070699_100060065 3300005518 Unclassified 3293
104 Ga0070699_100157262 3300005518 Unclassified 2011
105 Ga0070699_100316201 3300005518 Bacteria 1402
106 Ga0070699_100360506 3300005518 Bacteria 1310
107 Ga0070699_100479704 3300005518 Bacteria 1129
108 Ga0070699_100717759 3300005518 Unclassified 914
109 Ga0070699_100752914 3300005518 Bacteria 891
110 Ga0070699_101301986 3300005518 Unclassified 666
111 Ga0070699_101581633 3300005518 Unclassified 601
112 Ga0070679_100110025 3300005530 Unclassified 2741
113 Ga0070679_100607604 3300005530 Bacteria 1037
114 Ga0070684_101780704 3300005535 Unclassified 581
115 Ga0070697_100000191 3300005536 Bacteria 50606
116 Ga0070697_100001234 3300005536 Bacteria 19331
117 Ga0070697_100002837 3300005536 Bacteria 13330
118 Ga0070697_100004489 3300005536 Bacteria 10729
119 Ga0070697_100005113 3300005536 Bacteria 10072
120 Ga0070697_100013573 3300005536 Bacteria 6390
121 Ga0070697_100157343 3300005536 Unclassified 1919
122 Ga0070697_100176763 3300005536 Bacteria 1808
123 Ga0070697_100411088 3300005536 Bacteria 1175
124 Ga0070697_100425263 3300005536 Unclassified 1154
125 Ga0070697_100531723 3300005536 Bacteria 1030
126 Ga0070697_100766355 3300005536 Unclassified 853
127 Ga0070697_100991030 3300005536 Unclassified 747
128 Ga0068853_100009257 3300005539 Bacteria 7940
129 Ga0070686_100010455 3300005544 Bacteria 5233
130 Ga0070695_100024296 3300005545 Bacteria 3732
131 Ga0070695_100050007 3300005545 Bacteria 2678
132 Ga0070696_100109723 3300005546 Unclassified 1986
133 Ga0070696_100396437 3300005546 Unclassified 1079
134 Ga0070693_100012016 3300005547 Bacteria 4371
135 Ga0070665_100012105 3300005548 Bacteria 8704
136 Ga0070665_100139088 3300005548 Unclassified 2432
137 Ga0070704_100027070 3300005549 Unclassified 3797
138 Ga0070704_100346706 3300005549 Unclassified 1252
139 Ga0068855_101418011 3300005563 Bacteria 715
140 Ga0070664_100109698 3300005564 Unclassified 2407
141 Ga0068857_100566191 3300005577 Unclassified 1072
142 Ga0068854_100068697 3300005578 Unclassified 2584
143 Ga0068856_100271577 3300005614 Unclassified 1712
144 Ga0068856_101530267 3300005614 Unclassified 681
145 Ga0070702_100917407 3300005615 Unclassified 687
146 Ga0068859_100087919 3300005617 Unclassified 3156
147 Ga0068866_10041662 3300005718 Unclassified 2280
148 Ga0068861_101333642 3300005719 Unclassified 699
149 Ga0068851_10002448 3300005834 Bacteria 8146
150 Ga0068870_10015170 3300005840 Unclassified 3651
151 Ga0068863_100187394 3300005841 Bacteria 1988
152 Ga0068863_100265825 3300005841 Unclassified 1659
153 Ga0068858_100108128 3300005842 Unclassified 2596
154 Ga0068858_102422912 3300005842 Unclassified 518
155 Ga0068860_100230029 3300005843 Unclassified 1802
156 Ga0068862_100012904 3300005844 Bacteria 6910
157 Ga0070717_10015875 3300006028 Bacteria 5825
158 Ga0070717_10017807 3300006028 Bacteria 5536
159 Ga0070717_10065706 3300006028 Bacteria 3015
160 Ga0070717_10084991 3300006028 Bacteria 2662
161 Ga0070717_10133488 3300006028 Bacteria 2137
162 Ga0070717_10139150 3300006028 Unclassified 2093
163 Ga0070717_10341707 3300006028 Bacteria 1337
164 Ga0070717_10355681 3300006028 Unclassified 1310
165 Ga0070717_10642796 3300006028 Bacteria 963
166 Ga0070717_12118813 3300006028 Unclassified 506
167 Ga0070715_10002521 3300006163 Bacteria 5643
168 Ga0070715_10094212 3300006163 Bacteria 1384
169 Ga0070715_10952753 3300006163 Bacteria 532
170 Ga0070716_100000373 3300006173 Bacteria 18388
171 Ga0070716_100001335 3300006173 Bacteria 10929
172 Ga0070716_100228000 3300006173 Unclassified 1256
173 Ga0070716_100517876 3300006173 Bacteria 883
174 Ga0070716_100642218 3300006173 Unclassified 804
175 Ga0070716_100732516 3300006173 Bacteria 759
176 Ga0070716_100924602 3300006173 Unclassified 685
177 Ga0070716_101188015 3300006173 Bacteria 612
178 Ga0070712_100014402 3300006175 Bacteria 5075
179 Ga0070712_100016693 3300006175 Unclassified 4745
180 Ga0070712_100041390 3300006175 Unclassified 3164
181 Ga0070712_100058848 3300006175 Unclassified 2704
182 Ga0097621_100062098 3300006237 Unclassified 3067
183 Ga0097621_100318767 3300006237 Bacteria 1376
184 Ga0068871_100034618 3300006358 Unclassified 4009
185 Ga0075433_10029144 3300006852 Bacteria 4700
186 Ga0075433_10038147 3300006852 Bacteria 4148
187 Ga0075434_100034614 3300006871 Bacteria 4989
188 Ga0075434_100040140 3300006871 Bacteria 4636
189 Ga0075434_100257777 3300006871 Unclassified 1763
190 Ga0075434_100412129 3300006871 Bacteria 1372
191 Ga0075429_100284156 3300006880 Bacteria 1449
192 Ga0068865_100011603 3300006881 Bacteria 5522
193 Ga0075436_100001352 3300006914 Bacteria 16679
194 Ga0075436_100064623 3300006914 Unclassified 2530
195 Ga0075436_100204238 3300006914 Bacteria 1400
196 Ga0075436_100366221 3300006914 Bacteria 1040
197 Ga0075436_100748773 3300006914 Unclassified 726
198 Ga0075436_101227494 3300006914 Unclassified 566
199 Ga0097620_100087919 3300006931 Unclassified 3156
200 Ga0075435_100023952 3300007076 Bacteria 4730
201 Ga0075435_100028955 3300007076 Bacteria 4347
202 Ga0075435_100034994 3300007076 Bacteria 3984
203 Ga0075435_100190518 3300007076 Unclassified 1736
204 Ga0075435_100565268 3300007076 Unclassified 985
205 Ga0075435_101266274 3300007076 Unclassified 646
206 Ga0099794_10011246 3300007265 Bacteria 3826
207 Ga0099794_10190151 3300007265 Bacteria 1050
208 Ga0099794_10199491 3300007265 Unclassified 1024
209 Ga0099794_10242186 3300007265 Bacteria 929
210 Ga0099794_10312091 3300007265 Bacteria 815
211 Ga0099795_10365920 3300007788 Unclassified 648
212 Ga0105250_10246891 3300009092 Unclassified 762
213 Ga0105240_10027181 3300009093 Bacteria 7496
214 Ga0105240_10032883 3300009093 Bacteria 6708
215 Ga0105240_10155027 3300009093 Unclassified 2725
216 Ga0105240_10247479 3300009093 Bacteria 2063
217 Ga0105240_11450695 3300009093 Bacteria 720
218 Ga0111539_10739030 3300009094 Bacteria 1145
219 Ga0105245_10020706 3300009098 Bacteria 5765
220 Ga0105245_11845459 3300009098 Unclassified 657
221 Ga0105247_10007808 3300009101 Bacteria 6545
222 Ga0105247_10192921 3300009101 Bacteria 1365
223 Ga0114129_10130501 3300009147 Bacteria 3452
224 Ga0114129_10335588 3300009147 Bacteria 2006
225 Ga0114129_11263765 3300009147 Unclassified 917
226 Ga0105243_10026081 3300009148 Bacteria 4472
227 Ga0105241_10012074 3300009174 Bacteria 6345
228 Ga0105241_11147029 3300009174 Unclassified 734
229 Ga0105241_12681198 3300009174 Bacteria 502
230 Ga0105242_10062814 3300009176 Unclassified 3057
231 Ga0105242_10761632 3300009176 Bacteria 954
232 Ga0105248_10017951 3300009177 Bacteria 7809
233 Ga0105248_10077593 3300009177 Unclassified 3734
234 Ga0105237_11228094 3300009545 Unclassified 756
235 Ga0105237_11989747 3300009545 Unclassified 590
236 Ga0105237_12345676 3300009545 Unclassified 544
237 Ga0105238_10020939 3300009551 Bacteria 6661
238 Ga0105238_10026784 3300009551 Bacteria 5877
239 Ga0105249_10009560 3300009553 Bacteria 8495
240 Ga0099796_10233764 3300010159 Unclassified 758
241 Ga0105239_10126660 3300010375 Unclassified 2839
242 Ga0105239_10515964 3300010375 Unclassified 1359
243 Ga0105239_12456137 3300010375 Bacteria 607
244 Ga0105246_10004778 3300011119 Bacteria 8247
245 Ga0105246_10110959 3300011119 Unclassified 2015
246 Ga0157373_10295746 3300013100 Unclassified 1149
247 Ga0157373_10525419 3300013100 Unclassified 856
248 Ga0157373_11431804 3300013100 Unclassified 526
249 Ga0157371_10010545 3300013102 Bacteria 7185
250 Ga0157370_10082713 3300013104 Unclassified 3019
251 Ga0157370_10275974 3300013104 Unclassified 1553
252 Ga0157369_10011695 3300013105 Bacteria 9965
253 Ga0157369_10366393 3300013105 Bacteria 1496
254 Ga0157374_10002143 3300013296 Bacteria 16629
255 Ga0157378_10045199 3300013297 Unclassified 3912
256 Ga0157378_10144722 3300013297 Bacteria 2210
257 Ga0163162_10003485 3300013306 Bacteria 15042
258 Ga0163162_10004329 3300013306 Bacteria 13667
259 Ga0157372_10008822 3300013307 Bacteria 10709
260 Ga0157372_11898738 3300013307 Unclassified 685
261 Ga0157375_10005106 3300013308 Bacteria 11392
262 Ga0157375_10404660 3300013308 Bacteria 1531
263 Ga0163163_10035492 3300014325 Unclassified 4837
264 Ga0163163_10319266 3300014325 Unclassified 1607
265 Ga0157379_10035130 3300014968 Unclassified 4469
266 Ga0157379_10038929 3300014968 Unclassified 4242
267 Ga0157376_10019497 3300014969 Bacteria 5230
268 Ga0157376_10084035 3300014969 Bacteria 2740
269 Ga0213874_10033475 3300021377 Unclassified 1498
270 Ga0228598_1006554 3300024227 Bacteria 2407
271 Ga0207656_10044754 3300025321 Bacteria 1891
272 Ga0207682_10206605 3300025893 Unclassified 904
273 Ga0207692_10033975 3300025898 Bacteria 2466
274 Ga0207692_10253135 3300025898 Unclassified 1056
275 Ga0207692_10844767 3300025898 Bacteria 600
276 Ga0207692_10928256 3300025898 Bacteria 573
277 Ga0207642_10749491 3300025899 Unclassified 618
278 Ga0207710_10035994 3300025900 Unclassified 2181
279 Ga0207680_10151316 3300025903 Unclassified 1547
280 Ga0207647_10086308 3300025904 Bacteria 1876
281 Ga0207685_10658518 3300025905 Unclassified 567
282 Ga0207685_10829235 3300025905 Unclassified 511
283 Ga0207699_10280778 3300025906 Unclassified 1157
284 Ga0207699_10290862 3300025906 Unclassified 1138
285 Ga0207699_10792639 3300025906 Bacteria 696
286 Ga0207699_10806287 3300025906 Bacteria 690
287 Ga0207699_10837587 3300025906 Bacteria 677
288 Ga0207699_11254473 3300025906 Unclassified 549
289 Ga0207645_10004834 3300025907 Bacteria 9896
290 Ga0207643_10041954 3300025908 Unclassified 2579
291 Ga0207684_10007237 3300025910 Bacteria 10027
292 Ga0207684_10009407 3300025910 Bacteria 8629
293 Ga0207684_10009987 3300025910 Bacteria 8369
294 Ga0207684_10484903 3300025910 Bacteria 1060
295 Ga0207684_11131220 3300025910 Bacteria 651
296 Ga0207654_10024099 3300025911 Unclassified 3268
297 Ga0207654_11134693 3300025911 Unclassified 570
298 Ga0207707_10973514 3300025912 Bacteria 697
299 Ga0207707_11469223 3300025912 Unclassified 541
300 Ga0207695_10054468 3300025913 Unclassified 4177
301 Ga0207695_10157572 3300025913 Bacteria 2204
302 Ga0207695_10257832 3300025913 Bacteria 1642
303 Ga0207671_10200291 3300025914 Unclassified 1559
304 Ga0207693_10016009 3300025915 Bacteria 6002
305 Ga0207693_10123782 3300025915 Unclassified 2032
306 Ga0207693_10884545 3300025915 Unclassified 686
307 Ga0207663_10275665 3300025916 Unclassified 1247
308 Ga0207663_10628382 3300025916 Bacteria 846
309 Ga0207663_10681156 3300025916 Unclassified 813
310 Ga0207663_11061754 3300025916 Bacteria 650
311 Ga0207662_10700945 3300025918 Unclassified 710
312 Ga0207657_10005626 3300025919 Bacteria 13080
313 Ga0207649_10027845 3300025920 Unclassified 3322
314 Ga0207652_11038955 3300025921 Unclassified 719
315 Ga0207646_10000052 3300025922 Bacteria 167602
316 Ga0207646_10000519 3300025922 Bacteria 51444
317 Ga0207646_10081278 3300025922 Unclassified 2897
318 Ga0207646_10149614 3300025922 Unclassified 2105
319 Ga0207646_10266948 3300025922 Unclassified 1547
320 Ga0207646_10282739 3300025922 Unclassified 1499
321 Ga0207646_10414403 3300025922 Unclassified 1216
322 Ga0207646_10581832 3300025922 Unclassified 1006
323 Ga0207646_10712139 3300025922 Bacteria 897
324 Ga0207646_10869726 3300025922 Unclassified 801
325 Ga0207646_11317404 3300025922 Unclassified 630
326 Ga0207646_11584301 3300025922 Bacteria 565
327 Ga0207681_10010541 3300025923 Bacteria 5663
328 Ga0207694_10072306 3300025924 Bacteria 2696
329 Ga0207694_10680846 3300025924 Unclassified 867
330 Ga0207659_10581222 3300025926 Unclassified 954
331 Ga0207687_10003207 3300025927 Bacteria 11080
332 Ga0207687_10126574 3300025927 Bacteria 1919
333 Ga0207700_10137363 3300025928 Unclassified 2004
334 Ga0207700_10891967 3300025928 Bacteria 796
335 Ga0207700_11557394 3300025928 Unclassified 585
336 Ga0207664_10217435 3300025929 Bacteria 1656
337 Ga0207664_10530437 3300025929 Unclassified 1055
338 Ga0207664_10658243 3300025929 Unclassified 941
339 Ga0207664_11283351 3300025929 Unclassified 652
340 Ga0207664_11867300 3300025929 Unclassified 523
341 Ga0207644_10202416 3300025931 Bacteria 1567
342 Ga0207690_10116852 3300025932 Bacteria 1930
343 Ga0207706_10000102 3300025933 Bacteria 89878
344 Ga0207686_10007590 3300025934 Bacteria 5843
345 Ga0207669_10407353 3300025937 Unclassified 1067
346 Ga0207704_10993947 3300025938 Unclassified 709
347 Ga0207665_10001532 3300025939 Bacteria 15555
348 Ga0207665_10142821 3300025939 Unclassified 1709
349 Ga0207665_10344993 3300025939 Bacteria 1123
350 Ga0207665_10940388 3300025939 Bacteria 686
351 Ga0207665_11371811 3300025939 Unclassified 563
352 Ga0207711_10001134 3300025941 Bacteria 25438
353 Ga0207689_10029596 3300025942 Bacteria 4571
354 Ga0207661_10559164 3300025944 Unclassified 1048
355 Ga0207679_10075261 3300025945 Unclassified 2561
356 Ga0207667_10019266 3300025949 Bacteria 7626
357 Ga0207667_11752220 3300025949 Unclassified 586
358 Ga0207712_10043178 3300025961 Unclassified 3109
359 Ga0207668_10083414 3300025972 Unclassified 2325
360 Ga0207640_10360457 3300025981 Bacteria 1171
361 Ga0207658_10770468 3300025986 Unclassified 872
362 Ga0207677_10009465 3300026023 Bacteria 5484
363 Ga0207703_10821135 3300026035 Unclassified 888
364 Ga0207639_10110828 3300026041 Bacteria 2236
365 Ga0207678_10000513 3300026067 Bacteria 35127
366 Ga0207678_11251089 3300026067 Unclassified 657
367 Ga0207702_10053784 3300026078 Unclassified 3409
368 Ga0207702_10779880 3300026078 Bacteria 944
369 Ga0207641_10018362 3300026088 Bacteria 5734
370 Ga0207641_10571862 3300026088 Unclassified 1104
371 Ga0207648_10018916 3300026089 Bacteria 6221
372 Ga0207674_10114728 3300026116 Unclassified 2666
373 Ga0207675_100015855 3300026118 Bacteria 7028
374 Ga0207683_10033380 3300026121 Bacteria 4469
375 Ga0207698_10009764 3300026142 Bacteria 6130
376 Ga0265354_1001259 3300028016 Bacteria 3784
377 Ga0265356_1007121 3300028017 Unclassified 1295
378 Ga0265355_1011671 3300028036 Unclassified 724
379 Ga0268266_10015936 3300028379 Bacteria 6431
380 Ga0268265_10006496 3300028380 Bacteria 7926
381 Ga0268264_10343656 3300028381 Bacteria 1418
382 Ga0265762_1000573 3300030760 Bacteria 6485
383 Ga0265762_1044600 3300030760 Bacteria 876
384 Ga0265773_1037294 3300031018 Bacteria 545
385 Ga0265760_10000944 3300031090 Bacteria 8393
386 Ga0265760_10001868 3300031090 Bacteria 6185
387 Ga0265760_10003383 3300031090 Unclassified 4645
388 Ga0265760_10064999 3300031090 Bacteria 1113
389 Ga0265760_10079341 3300031090 Bacteria 1015
390 Ga0265760_10084227 3300031090 Bacteria 988
391 Ga0265760_10378679 3300031090 Unclassified 509
392 Ga0265340_10278682 3300031247 Unclassified 743
393 Ga0265340_10298497 3300031247 Bacteria 715
394 Ga0265339_10096789 3300031249 Unclassified 1540
395 Ga0265316_10063880 3300031344 Bacteria 2853
396 Ga0265314_10102590 3300031711 Bacteria 1835
397 Ga0316214_1012599 3300033545 Bacteria 1155
398 Ga0316212_1065417 3300033547 Unclassified 526
399 Ga0373944_0409252 3300035089 Bacteria 524
400 Ga0373932_0091607 3300035112 Unclassified 976
401 Ga0373953_0253904 3300035117 Bacteria 764
402 Ga0373960_0194957 3300035121 Bacteria 714
403 Ga0373943_0922924 3300035170 Unclassified 522
404 Ga0373931_0446463 3300035691 Unclassified 826
405 Ga0373933_0138506 3300035724 Bacteria 1535
406 Ga0373933_0577008 3300035724 Bacteria 738
407 Ga0373947_0342020 3300035725 Unclassified 1003
408 Ga0373947_1083234 3300035725 Bacteria 546
409 Ga0373937_0880393 3300036401 Unclassified 844
410 Ga0373937_1174908 3300036401 Unclassified 716
411 Ga0373925_0382716 3300037068 Unclassified 1146
412 Ga0436363_1193357 3300039450 Unclassified 1641
413 Ga0436363_1461786 3300039450 Bacteria 7412
414 Ga0451839_0279758 3300041496 Unclassified 688
415 Ga0439448_0075086 3300042005 Bacteria 1130
416 Ga0451577_0045002 3300042876 Bacteria 3950
417 Ga0453683_0184220 3300044673 Bacteria 1324
418 Ga0453683_0640415 3300044673 Unclassified 694
419 Ga0466961_0223664 3300044693 Bacteria 1160
420 Ga0453684_0052558 3300044712 Bacteria 5326
421 Ga0453684_0053167 3300044712 Bacteria 5288
422 Ga0451576_0030357 3300045051 Bacteria 5777
423 Ga0495580_0004435 3300046472 Bacteria 11794
424 Ga0495594_0284053 3300046499 Bacteria 943
425 Ga0495630_0317060 3300046517 Unclassified 1192
426 Ga0495587_0425536 3300046536 Unclassified 737
427 Ga0495635_1031095 3300046663 Unclassified 523
428 Ga0495588_0699312 3300046674 Unclassified 530
429 Ga0495624_0236485 3300046690 Bacteria 1106
430 Ga0495600_0250040 3300046809 Bacteria 1128
431 Ga0495604_0761026 3300047317 Unclassified 612
432 Ga0495675_0856254 3300047444 Unclassified 500
433 Ga0495602_0165460 3300048088 Unclassified 1722
434 Ga0495602_0852496 3300048088 Bacteria 609
435 Ga0496100_0217862 3300048903 Bacteria 1399
436 Ga0496101_0235375 3300048904 Unclassified 1424
437 Ga0496102_0130732 3300048905 Bacteria 2349
438 Ga0496103_0286159 3300048906 Unclassified 1060
439 Ga0496104_0183529 3300048907 Unclassified 2002
440 Ga0496106_0759132 3300048909 Bacteria 771
441 Ga0496106_1163883 3300048909 Unclassified 602
442 Ga0496108_1042402 3300048911 Unclassified 697
443 Ga0496108_1159272 3300048911 Bacteria 655
444 Ga0496109_0032694 3300048912 Bacteria 4678
445 Ga0496109_0116766 3300048912 Bacteria 2484
446 Ga0496112_0130712 3300048915 Unclassified 2482
447 Ga0496112_0161628 3300048915 Bacteria 2206
448 Ga0496113_0191522 3300048916 Bacteria 1623
449 Ga0496114_0396491 3300048917 Bacteria 1222
450 Ga0496115_0060605 3300048918 Unclassified 3049
451 nmdc:mga05p37_1035346_c1 3300050507 Unclassified 868
452 nmdc:mga05p37_65146_c1 3300050507 Bacteria 4484
453 nmdc:mga05p37_91458_c1 3300050507 Bacteria 3749
454 nmdc:mga09592_370232_c1 3300050508 Bacteria 1239
455 nmdc:mga06r32_405908_c1 3300050510 Bacteria 1344
456 nmdc:mga0n895_30362_c1 3300050512 Bacteria 5165
457 nmdc:mga0n895_31483_c1 3300050512 Bacteria 5080
458 nmdc:mga0rr50_38730_c1 3300050513 Bacteria 3452
459 nmdc:mga0rr50_43088_c1 3300050513 Bacteria 3300
460 nmdc:mga0rr50_558280_c1 3300050513 Unclassified 975
461 nmdc:mga0rr50_56709_c1 3300050513 Unclassified 2928
462 nmdc:mga08x19_108519_c1 3300050514 Bacteria 1849
463 nmdc:mga08x19_1089550_c1 3300050514 Unclassified 567
464 nmdc:mga08x19_181638_c1 3300050514 Bacteria 1436
465 nmdc:mga08x19_429595_c1 3300050514 Unclassified 928
466 nmdc:mga08x19_5030_c1 3300050514 Bacteria 7820
467 nmdc:mga08x19_6881_c1 3300050514 Bacteria 6751
468 nmdc:mga08x19_77370_c1 3300050514 Unclassified 2179
469 nmdc:mga0a205_15570_c1 3300050515 Bacteria 7107
470 nmdc:mga0a205_19024_c1 3300050515 Bacteria 6471
471 Ga0495601_0530109 3300053077 Unclassified 759
472 Ga0495619_0547052 3300053085 Unclassified 794
473 Ga0070708_100569848
474 Ga0065712_10098956
475 Ga0065715_10092805
476 Ga0070676_10033024
477 Ga0070683_100044598
478 Ga0070690_100004905
479 Ga0070670_100153246
480 Ga0070677_10194116
481 Ga0068869_100038105
482 Ga0070666_10011176
483 Ga0070666_10875337
484 Ga0070680_100366571
485 Ga0070682_100004543
486 Ga0068868_100001611
487 Ga0068868_100070002
488 Ga0070660_100090090
489 Ga0070691_10892927
490 Ga0070687_100276950
491 Ga0070661_100023928
492 Ga0070692_10416627
493 Ga0070668_101269673
494 Ga0070669_100011777
495 Ga0070675_100236411
496 Ga0070671_100516108
497 Ga0070688_100346502
498 Ga0070659_100032547
499 Ga0070667_100024488
500 Ga0070667_101896202
501 Ga0070709_10020545
502 Ga0070709_10267931
503 Ga0070709_10292824
504 Ga0070709_10574231
505 Ga0070714_100042711
506 Ga0070714_100086889
507 Ga0070714_100120153
508 Ga0070714_100232628
509 Ga0070714_100458847
510 Ga0070714_101180434
511 Ga0070714_101410383
512 Ga0070713_100103378
513 Ga0070713_100478084
514 Ga0070713_100928889
515 Ga0070713_101070357
516 Ga0070713_101990147
517 Ga0070713_102216744
518 Ga0070710_10006690
519 Ga0070710_11205024
520 Ga0070701_10211659
521 Ga0070711_100391142
522 Ga0070711_100595284
523 Ga0070711_101048060
524 Ga0070705_100510948
525 Ga0070705_101623280
526 Ga0070700_100110908
527 Ga0070694_100530824
528 Ga0070708_100009575
529 Ga0070708_100018428
530 Ga0070708_100018899
531 Ga0070708_100069407
532 Ga0070708_100120247
533 Ga0070708_100251776
534 Ga0070708_100290599
535 Ga0070708_100302206
536 Ga0070708_100536644
537 Ga0070708_100561902
538 Ga0070708_101012394
539 Ga0070708_102183080
540 Ga0070663_100010922
541 Ga0070663_101408946
542 Ga0070678_100280026
543 Ga0070662_100000540
544 Ga0070681_10228875
545 Ga0068867_100043261
546 Ga0070685_10642694
547 Ga0070706_100001986
548 Ga0070706_100018511
549 Ga0070706_100039690
550 Ga0070706_100261425
551 Ga0070706_101000823
552 Ga0070706_101366480
553 Ga0070706_101784771
554 Ga0070706_101975718
555 Ga0070707_100000486
556 Ga0070707_100002543
557 Ga0070707_100010408
558 Ga0070707_100011910
559 Ga0070707_100195895
560 Ga0070707_100302064
561 Ga0070707_100378478
562 Ga0070707_100619847
563 Ga0070707_101356570
564 Ga0070707_101396834
565 Ga0070707_101399904
566 Ga0070698_100005121
567 Ga0070698_100015342
568 Ga0070698_100335781
569 Ga0070698_100547394
570 Ga0070698_100891936
571 Ga0070698_100936947
572 Ga0070698_101421978
573 Ga0070699_100003692
574 Ga0070699_100053619
575 Ga0070699_100060065
576 Ga0070699_100157262
577 Ga0070699_100316201
578 Ga0070699_100360506
579 Ga0070699_100479704
580 Ga0070699_100717759
581 Ga0070699_100752914
582 Ga0070699_101301986
583 Ga0070699_101581633
584 Ga0070679_100110025
585 Ga0070679_100607604
586 Ga0070684_101780704
587 Ga0070697_100000191
588 Ga0070697_100001234
589 Ga0070697_100002837
590 Ga0070697_100004489
591 Ga0070697_100005113
592 Ga0070697_100013573
593 Ga0070697_100157343
594 Ga0070697_100176763
595 Ga0070697_100411088
596 Ga0070697_100425263
597 Ga0070697_100531723
598 Ga0070697_100766355
599 Ga0070697_100991030
600 Ga0068853_100009257
601 Ga0070686_100010455
602 Ga0070695_100024296
603 Ga0070695_100050007
604 Ga0070696_100109723
605 Ga0070696_100396437
606 Ga0070693_100012016
607 Ga0070665_100012105
608 Ga0070665_100139088
609 Ga0070704_100027070
610 Ga0070704_100346706
611 Ga0068855_101418011
612 Ga0070664_100109698
613 Ga0068857_100566191
614 Ga0068854_100068697
615 Ga0068856_100271577
616 Ga0068856_101530267
617 Ga0070702_100917407
618 Ga0068859_100087919
619 Ga0068866_10041662
620 Ga0068861_101333642
621 Ga0068851_10002448
622 Ga0068870_10015170
623 Ga0068863_100187394
624 Ga0068863_100265825
625 Ga0068858_100108128
626 Ga0068858_102422912
627 Ga0068860_100230029
628 Ga0068862_100012904
629 Ga0070717_10015875
630 Ga0070717_10017807
631 Ga0070717_10065706
632 Ga0070717_10084991
633 Ga0070717_10133488
634 Ga0070717_10139150
635 Ga0070717_10341707
636 Ga0070717_10355681
637 Ga0070717_10642796
638 Ga0070717_12118813
639 Ga0070715_10002521
640 Ga0070715_10094212
641 Ga0070715_10952753
642 Ga0070716_100000373
643 Ga0070716_100001335
644 Ga0070716_100228000
645 Ga0070716_100517876
646 Ga0070716_100642218
647 Ga0070716_100732516
648 Ga0070716_100924602
649 Ga0070716_101188015
650 Ga0070712_100014402
651 Ga0070712_100016693
652 Ga0070712_100041390
653 Ga0070712_100058848
654 Ga0097621_100062098
655 Ga0097621_100318767
656 Ga0068871_100034618
657 Ga0075433_10029144
658 Ga0075433_10038147
659 Ga0075434_100034614
660 Ga0075434_100040140
661 Ga0075434_100257777
662 Ga0075434_100412129
663 Ga0075429_100284156
664 Ga0068865_100011603
665 Ga0075436_100001352
666 Ga0075436_100064623
667 Ga0075436_100204238
668 Ga0075436_100366221
669 Ga0075436_100748773
670 Ga0075436_101227494
671 Ga0097620_100087919
672 Ga0075435_100023952
673 Ga0075435_100028955
674 Ga0075435_100034994
675 Ga0075435_100190518
676 Ga0075435_100565268
677 Ga0075435_101266274
678 Ga0099794_10011246
679 Ga0099794_10190151
680 Ga0099794_10199491
681 Ga0099794_10242186
682 Ga0099794_10312091
683 Ga0099795_10365920
684 Ga0105250_10246891
685 Ga0105240_10027181
686 Ga0105240_10032883
687 Ga0105240_10155027
688 Ga0105240_10247479
689 Ga0105240_11450695
690 Ga0111539_10739030
691 Ga0105245_10020706
692 Ga0105245_11845459
693 Ga0105247_10007808
694 Ga0105247_10192921
695 Ga0114129_10130501
696 Ga0114129_10335588
697 Ga0114129_11263765
698 Ga0105243_10026081
699 Ga0105241_10012074
700 Ga0105241_11147029
701 Ga0105241_12681198
702 Ga0105242_10062814
703 Ga0105242_10761632
704 Ga0105248_10017951
705 Ga0105248_10077593
706 Ga0105237_11228094
707 Ga0105237_11989747
708 Ga0105237_12345676
709 Ga0105238_10020939
710 Ga0105238_10026784
711 Ga0105249_10009560
712 Ga0099796_10233764
713 Ga0105239_10126660
714 Ga0105239_10515964
715 Ga0105239_12456137
716 Ga0105246_10004778
717 Ga0105246_10110959
718 Ga0157373_10295746
719 Ga0157373_10525419
720 Ga0157373_11431804
721 Ga0157371_10010545
722 Ga0157370_10082713
723 Ga0157370_10275974
724 Ga0157369_10011695
725 Ga0157369_10366393
726 Ga0157374_10002143
727 Ga0157378_10045199
728 Ga0157378_10144722
729 Ga0163162_10003485
730 Ga0163162_10004329
731 Ga0157372_10008822
732 Ga0157372_11898738
733 Ga0157375_10005106
734 Ga0157375_10404660
735 Ga0163163_10035492
736 Ga0163163_10319266
737 Ga0157379_10035130
738 Ga0157379_10038929
739 Ga0157376_10019497
740 Ga0157376_10084035
741 Ga0213874_10033475
742 Ga0228598_1006554
743 Ga0207656_10044754
744 Ga0207682_10206605
745 Ga0207692_10033975
746 Ga0207692_10253135
747 Ga0207692_10844767
748 Ga0207692_10928256
749 Ga0207642_10749491
750 Ga0207710_10035994
751 Ga0207680_10151316
752 Ga0207647_10086308
753 Ga0207685_10658518
754 Ga0207685_10829235
755 Ga0207699_10280778
756 Ga0207699_10290862
757 Ga0207699_10792639
758 Ga0207699_10806287
759 Ga0207699_10837587
760 Ga0207699_11254473
761 Ga0207645_10004834
762 Ga0207643_10041954
763 Ga0207684_10007237
764 Ga0207684_10009407
765 Ga0207684_10009987
766 Ga0207684_10484903
767 Ga0207684_11131220
768 Ga0207654_10024099
769 Ga0207654_11134693
770 Ga0207707_10973514
771 Ga0207707_11469223
772 Ga0207695_10054468
773 Ga0207695_10157572
774 Ga0207695_10257832
775 Ga0207671_10200291
776 Ga0207693_10016009
777 Ga0207693_10123782
778 Ga0207693_10884545
779 Ga0207663_10275665
780 Ga0207663_10628382
781 Ga0207663_10681156
782 Ga0207663_11061754
783 Ga0207662_10700945
784 Ga0207657_10005626
785 Ga0207649_10027845
786 Ga0207652_11038955
787 Ga0207646_10000052
788 Ga0207646_10000519
789 Ga0207646_10081278
790 Ga0207646_10149614
791 Ga0207646_10266948
792 Ga0207646_10282739
793 Ga0207646_10414403
794 Ga0207646_10581832
795 Ga0207646_10712139
796 Ga0207646_10869726
797 Ga0207646_11317404
798 Ga0207646_11584301
799 Ga0207681_10010541
800 Ga0207694_10072306
801 Ga0207694_10680846
802 Ga0207659_10581222
803 Ga0207687_10003207
804 Ga0207687_10126574
805 Ga0207700_10137363
806 Ga0207700_10891967
807 Ga0207700_11557394
808 Ga0207664_10217435
809 Ga0207664_10530437
810 Ga0207664_10658243
811 Ga0207664_11283351
812 Ga0207664_11867300
813 Ga0207644_10202416
814 Ga0207690_10116852
815 Ga0207706_10000102
816 Ga0207686_10007590
817 Ga0207669_10407353
818 Ga0207704_10993947
819 Ga0207665_10001532
820 Ga0207665_10142821
821 Ga0207665_10344993
822 Ga0207665_10940388
823 Ga0207665_11371811
824 Ga0207711_10001134
825 Ga0207689_10029596
826 Ga0207661_10559164
827 Ga0207679_10075261
828 Ga0207667_10019266
829 Ga0207667_11752220
830 Ga0207712_10043178
831 Ga0207668_10083414
832 Ga0207640_10360457
833 Ga0207658_10770468
834 Ga0207677_10009465
835 Ga0207703_10821135
836 Ga0207639_10110828
837 Ga0207678_10000513
838 Ga0207678_11251089
839 Ga0207702_10053784
840 Ga0207702_10779880
841 Ga0207641_10018362
842 Ga0207641_10571862
843 Ga0207648_10018916
844 Ga0207674_10114728
845 Ga0207675_100015855
846 Ga0207683_10033380
847 Ga0207698_10009764
848 Ga0265354_1001259
849 Ga0265356_1007121
850 Ga0265355_1011671
851 Ga0268266_10015936
852 Ga0268265_10006496
853 Ga0268264_10343656
854 Ga0265762_1000573
855 Ga0265762_1044600
856 Ga0265773_1037294
857 Ga0265760_10000944
858 Ga0265760_10001868
859 Ga0265760_10003383
860 Ga0265760_10064999
861 Ga0265760_10079341
862 Ga0265760_10084227
863 Ga0265760_10378679
864 Ga0265340_10278682
865 Ga0265340_10298497
866 Ga0265339_10096789
867 Ga0265316_10063880
868 Ga0265314_10102590
869 Ga0316214_1012599
870 Ga0316212_1065417
871 Ga0373944_0409252
872 Ga0373932_0091607
873 Ga0373953_0253904
874 Ga0373960_0194957
875 Ga0373943_0922924
876 Ga0373931_0446463
877 Ga0373933_0138506
878 Ga0373933_0577008
879 Ga0373947_0342020
880 Ga0373947_1083234
881 Ga0373937_0880393
882 Ga0373937_1174908
883 Ga0373925_0382716
884 Ga0436363_1193357
885 Ga0436363_1461786
886 Ga0451839_0279758
887 Ga0439448_0075086
888 Ga0451577_0045002
889 Ga0453683_0184220
890 Ga0453683_0640415
891 Ga0466961_0223664
892 Ga0453684_0052558
893 Ga0453684_0053167
894 Ga0451576_0030357
895 Ga0495580_0004435
896 Ga0495594_0284053
897 Ga0495630_0317060
898 Ga0495587_0425536
899 Ga0495635_1031095
900 Ga0495588_0699312
901 Ga0495624_0236485
902 Ga0495600_0250040
903 Ga0495604_0761026
904 Ga0495675_0856254
905 Ga0495602_0165460
906 Ga0495602_0852496
907 Ga0496100_0217862
908 Ga0496101_0235375
909 Ga0496102_0130732
910 Ga0496103_0286159
911 Ga0496104_0183529
912 Ga0496106_0759132
913 Ga0496106_1163883
914 Ga0496108_1042402
915 Ga0496108_1159272
916 Ga0496109_0032694
917 Ga0496109_0116766
918 Ga0496112_0130712
919 Ga0496112_0161628
920 Ga0496113_0191522
921 Ga0496114_0396491
922 Ga0496115_0060605
923 nmdc:mga05p37_1035346_c1
924 nmdc:mga05p37_65146_c1
925 nmdc:mga05p37_91458_c1
926 nmdc:mga09592_370232_c1
927 nmdc:mga06r32_405908_c1
928 nmdc:mga0n895_30362_c1
929 nmdc:mga0n895_31483_c1
930 nmdc:mga0rr50_38730_c1
931 nmdc:mga0rr50_43088_c1
932 nmdc:mga0rr50_558280_c1
933 nmdc:mga0rr50_56709_c1
934 nmdc:mga08x19_108519_c1
935 nmdc:mga08x19_1089550_c1
936 nmdc:mga08x19_181638_c1
937 nmdc:mga08x19_429595_c1
938 nmdc:mga08x19_5030_c1
939 nmdc:mga08x19_6881_c1
940 nmdc:mga08x19_77370_c1
941 nmdc:mga0a205_15570_c1
942 nmdc:mga0a205_19024_c1
943 Ga0495601_0530109
944 Ga0495619_0547052

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02416

TatA_B_E

mttA/Hcf106 family

7

74

0.91

Map