F450733

General Info

Members Datasets Scaffolds Average Seq Length
472 331 944 115

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_101332356|Ga0070680_1013323561
Length 126
Sequence MKEYRLFRILIILAGLMGADGVILAAAAAHLGDAARLLLPASSMLLFHATAVLAAIGLSEAGLIHPSGGIAAASGFIIATTLFAGDLSLRHFSGHGLFPLAAPTGGSLLIASWIVLAVAAAWPRRN

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
115 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
116 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
117 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
121 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
131 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
132 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
133 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
136 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
149 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
153 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
174 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
178 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
185 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
186 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
187 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
192 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
202 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
203 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
204 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
205 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
206 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
213 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
224 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
225 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
226 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
247 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
248 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
249 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
257 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
260 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
261 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
262 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
263 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
269 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
270 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
271 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
274 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
275 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
276 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
277 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
278 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
279 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
280 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
281 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
282 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
283 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
284 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
285 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
286 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
287 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
288 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
289 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
290 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
291 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
292 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
293 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
294 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
295 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
296 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
297 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
298 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
299 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
300 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
301 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
302 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
303 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
304 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
305 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
306 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
307 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
308 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
309 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
310 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
311 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
312 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
313 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
314 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
315 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
316 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
317 2906610324
318 2922425934
319 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
320 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
321 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
322 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
323 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
324 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
325 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
326 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
327 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
328 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
329 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
330 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
331 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.19
Metatranscriptomes 0.21
Isolates 6.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.81
Nodule 6.57
Rhizoplane 5.72
Rhizosphere 70.76
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_101332356 3300005336 Bacteria 621
2 JGI24737J22298_10245824 3300001990 Bacteria 528
3 Ga0070683_100048308 3300005329 Bacteria 3934
4 Ga0070683_100917817 3300005329 Bacteria 840
5 Ga0070666_10138522 3300005335 Bacteria 1694
6 Ga0070666_10142036 3300005335 Bacteria 1672
7 Ga0070680_100161701 3300005336 Bacteria 1882
8 Ga0068868_100614066 3300005338 Bacteria 965
9 Ga0070660_100298376 3300005339 Bacteria 1321
10 Ga0070689_100255813 3300005340 Bacteria 1446
11 Ga0070661_100226005 3300005344 Bacteria 1437
12 Ga0070661_101133054 3300005344 Bacteria 653
13 Ga0070668_100566269 3300005347 Bacteria 990
14 Ga0070668_101093953 3300005347 Bacteria 719
15 Ga0070675_100885675 3300005354 Bacteria 818
16 Ga0070659_100897197 3300005366 Bacteria 774
17 Ga0070667_100093038 3300005367 Bacteria 2595
18 Ga0070709_10016123 3300005434 Bacteria 4259
19 Ga0070709_10034639 3300005434 Bacteria 3062
20 Ga0070709_11050011 3300005434 Bacteria 650
21 Ga0070714_100103935 3300005435 Bacteria 2506
22 Ga0070714_100338597 3300005435 Bacteria 1410
23 Ga0070714_100456170 3300005435 Bacteria 1215
24 Ga0070713_100008883 3300005436 Bacteria 7155
25 Ga0070713_100023569 3300005436 Bacteria 4779
26 Ga0070713_100107853 3300005436 Bacteria 2423
27 Ga0070713_100921013 3300005436 Bacteria 841
28 Ga0070713_101593777 3300005436 Bacteria 634
29 Ga0070710_10001420 3300005437 Bacteria 11294
30 Ga0070710_10017195 3300005437 Bacteria 3696
31 Ga0070711_100032710 3300005439 Bacteria 3460
32 Ga0070711_100076352 3300005439 Bacteria 2375
33 Ga0070711_100267986 3300005439 Bacteria 1346
34 Ga0070700_100827253 3300005441 Bacteria 748
35 Ga0070663_101493358 3300005455 Bacteria 600
36 Ga0070678_101358911 3300005456 Bacteria 662
37 Ga0070681_10087294 3300005458 Bacteria 3072
38 Ga0070681_11584961 3300005458 Bacteria 580
39 Ga0070679_100044686 3300005530 Bacteria 4413
40 Ga0070679_100059656 3300005530 Bacteria 3802
41 Ga0070684_100013219 3300005535 Bacteria 6648
42 Ga0070684_100888117 3300005535 Bacteria 835
43 Ga0070697_100199535 3300005536 Bacteria 1700
44 Ga0068853_100228194 3300005539 Bacteria 1702
45 Ga0070665_100441007 3300005548 Bacteria 1311
46 Ga0070665_100729366 3300005548 Bacteria 1004
47 Ga0070665_100755290 3300005548 Bacteria 985
48 Ga0068855_100187729 3300005563 Bacteria 2333
49 Ga0068855_100414428 3300005563 Bacteria 1474
50 Ga0068855_100514331 3300005563 Bacteria 1300
51 Ga0070664_101536644 3300005564 Bacteria 630
52 Ga0068854_100655767 3300005578 Bacteria 901
53 Ga0068854_101574278 3300005578 Bacteria 598
54 Ga0068856_100334654 3300005614 Bacteria 1532
55 Ga0068856_101093413 3300005614 Bacteria 815
56 Ga0068856_102320384 3300005614 Bacteria 545
57 Ga0068864_100152095 3300005618 Bacteria 2097
58 Ga0068863_100159501 3300005841 Bacteria 2161
59 Ga0068863_100339345 3300005841 Bacteria 1462
60 Ga0068858_100201756 3300005842 Bacteria 1881
61 Ga0068858_100562706 3300005842 Bacteria 1104
62 Ga0068858_100853006 3300005842 Bacteria 890
63 Ga0068858_101013169 3300005842 Bacteria 814
64 Ga0068860_100759457 3300005843 Bacteria 982
65 Ga0068860_100865263 3300005843 Bacteria 919
66 Ga0081455_10015989 3300005937 Bacteria 7260
67 Ga0081540_1011031 3300005983 Bacteria 6066
68 Ga0081540_1243318 3300005983 Bacteria 630
69 Ga0070717_10034234 3300006028 Bacteria 4105
70 Ga0070717_10226324 3300006028 Bacteria 1645
71 Ga0075363_100006374 3300006048 Bacteria 5348
72 Ga0070715_10002422 3300006163 Bacteria 5725
73 Ga0070715_10338031 3300006163 Bacteria 818
74 Ga0070716_100008434 3300006173 Bacteria 5112
75 Ga0070716_100011641 3300006173 Bacteria 4434
76 Ga0070712_100024001 3300006175 Bacteria 4034
77 Ga0070712_100133669 3300006175 Bacteria 1883
78 Ga0075362_10326102 3300006177 Bacteria 765
79 Ga0075369_10267334 3300006186 Bacteria 795
80 Ga0075366_10160944 3300006195 Bacteria 1360
81 Ga0097621_102035073 3300006237 Bacteria 549
82 Ga0075370_10040232 3300006353 Bacteria 2636
83 Ga0075434_100088272 3300006871 Bacteria 3102
84 Ga0099822_1007326 3300006943 Bacteria 14275
85 Ga0075435_100299449 3300007076 Bacteria 1375
86 Ga0105240_11009344 3300009093 Bacteria 890
87 Ga0105240_11019137 3300009093 Bacteria 884
88 Ga0105245_10331887 3300009098 Bacteria 1501
89 Ga0105245_10910904 3300009098 Bacteria 921
90 Ga0105241_10253095 3300009174 Bacteria 1494
91 Ga0105248_10341401 3300009177 Bacteria 1686
92 Ga0105237_10032056 3300009545 Bacteria 5321
93 Ga0105237_10095991 3300009545 Bacteria 2955
94 Ga0105237_10539976 3300009545 Bacteria 1173
95 Ga0105237_11642753 3300009545 Bacteria 650
96 Ga0105238_10029421 3300009551 Bacteria 5596
97 Ga0099796_10388320 3300010159 Bacteria 610
98 Ga0105239_10180674 3300010375 Bacteria 2361
99 Ga0105239_10559578 3300010375 Bacteria 1303
100 Ga0105239_12633205 3300010375 Bacteria 587
101 Ga0105246_10780943 3300011119 Bacteria 845
102 Ga0157370_10118665 3300013104 Bacteria 2471
103 Ga0157369_10230034 3300013105 Bacteria 1939
104 Ga0163162_11014010 3300013306 Bacteria 939
105 Ga0157375_10878259 3300013308 Bacteria 1042
106 Ga0163163_10027246 3300014325 Bacteria 5473
107 Ga0163163_10629184 3300014325 Bacteria 1137
108 Ga0163163_11393765 3300014325 Bacteria 763
109 Ga0163163_11873067 3300014325 Bacteria 660
110 Ga0157377_10681422 3300014745 Bacteria 744
111 Ga0157379_10328192 3300014968 Bacteria 1398
112 Ga0157376_10179657 3300014969 Bacteria 1933
113 Ga0206353_10248677 3300020082 Bacteria 1030
114 Ga0213873_10002500 3300021358 Bacteria 3186
115 Ga0213872_10056014 3300021361 Bacteria 1786
116 Ga0213872_10206322 3300021361 Bacteria 841
117 Ga0213874_10054573 3300021377 Bacteria 1236
118 Ga0213874_10149546 3300021377 Bacteria 814
119 Ga0213876_10002372 3300021384 Bacteria 11088
120 Ga0213876_10780481 3300021384 Bacteria 509
121 Ga0209758_1009223 3300025297 Bacteria 6191
122 Ga0209257_1025919 3300025304 Bacteria 1990
123 Ga0207692_10000852 3300025898 Bacteria 10957
124 Ga0207692_10002369 3300025898 Bacteria 7230
125 Ga0207688_10209498 3300025901 Bacteria 1171
126 Ga0207680_10483063 3300025903 Bacteria 881
127 Ga0207647_10148488 3300025904 Bacteria 1371
128 Ga0207685_10002118 3300025905 Bacteria 4449
129 Ga0207685_10056943 3300025905 Bacteria 1531
130 Ga0207699_10012280 3300025906 Bacteria 4353
131 Ga0207699_10488720 3300025906 Bacteria 887
132 Ga0207705_10022057 3300025909 Bacteria 4543
133 Ga0207705_10592467 3300025909 Bacteria 862
134 Ga0207654_10675926 3300025911 Bacteria 741
135 Ga0207707_10081150 3300025912 Bacteria 2831
136 Ga0207707_10153645 3300025912 Bacteria 2012
137 Ga0207707_10318352 3300025912 Bacteria 1343
138 Ga0207695_10869968 3300025913 Bacteria 781
139 Ga0207671_10008770 3300025914 Bacteria 8517
140 Ga0207693_10019068 3300025915 Bacteria 5459
141 Ga0207663_10006733 3300025916 Bacteria 5907
142 Ga0207663_10196541 3300025916 Bacteria 1452
143 Ga0207663_10292785 3300025916 Bacteria 1213
144 Ga0207663_10602533 3300025916 Bacteria 863
145 Ga0207660_10063776 3300025917 Bacteria 2658
146 Ga0207660_10552980 3300025917 Bacteria 936
147 Ga0207660_11149259 3300025917 Bacteria 632
148 Ga0207652_10030351 3300025921 Bacteria 4526
149 Ga0207652_10326133 3300025921 Bacteria 1386
150 Ga0207694_11057052 3300025924 Bacteria 687
151 Ga0207659_10721872 3300025926 Bacteria 854
152 Ga0207700_10014409 3300025928 Bacteria 5180
153 Ga0207700_10607698 3300025928 Bacteria 973
154 Ga0207700_10775357 3300025928 Bacteria 857
155 Ga0207664_10025078 3300025929 Bacteria 4485
156 Ga0207664_10072294 3300025929 Bacteria 2780
157 Ga0207664_10078541 3300025929 Bacteria 2677
158 Ga0207644_11201756 3300025931 Bacteria 637
159 Ga0207690_10984566 3300025932 Bacteria 701
160 Ga0207670_10308025 3300025936 Bacteria 1242
161 Ga0207669_10252438 3300025937 Bacteria 1314
162 Ga0207665_10004492 3300025939 Bacteria 9257
163 Ga0207665_10014639 3300025939 Bacteria 5163
164 Ga0207665_10226826 3300025939 Bacteria 1371
165 Ga0207711_10410789 3300025941 Bacteria 1258
166 Ga0207661_10002241 3300025944 Bacteria 13339
167 Ga0207679_10214700 3300025945 Bacteria 1615
168 Ga0207679_11252502 3300025945 Bacteria 681
169 Ga0207667_10030550 3300025949 Bacteria 5828
170 Ga0207651_10586613 3300025960 Bacteria 973
171 Ga0207651_10597005 3300025960 Bacteria 965
172 Ga0207668_10223269 3300025972 Bacteria 1514
173 Ga0207640_10328384 3300025981 Bacteria 1221
174 Ga0207658_10435000 3300025986 Bacteria 1159
175 Ga0207677_10774085 3300026023 Bacteria 857
176 Ga0207703_11112844 3300026035 Bacteria 759
177 Ga0207639_10196277 3300026041 Bacteria 1728
178 Ga0207678_10204504 3300026067 Bacteria 1689
179 Ga0207641_10291619 3300026088 Bacteria 1538
180 Ga0207676_11311583 3300026095 Bacteria 719
181 Ga0207676_11424596 3300026095 Bacteria 689
182 Ga0207675_100238058 3300026118 Bacteria 1758
183 Ga0207698_11099253 3300026142 Bacteria 808
184 Ga0209589_1000017 3300027357 Bacteria 215546
185 Ga0209489_100018 3300027361 Bacteria 215546
186 Ga0209700_100028 3300027363 Bacteria 215546
187 Ga0209813_10283307 3300027866 Bacteria 639
188 Ga0268266_11162909 3300028379 Bacteria 746
189 Ga0268264_10511869 3300028381 Bacteria 1172
190 Ga0268264_10962956 3300028381 Bacteria 859
191 Ga0265330_10103604 3300031235 Bacteria 1217
192 Ga0265330_10117991 3300031235 Bacteria 1131
193 Ga0265332_10055494 3300031238 Bacteria 1698
194 Ga0265339_10140485 3300031249 Bacteria 1229
195 Ga0265331_10260322 3300031250 Bacteria 778
196 Ga0307408_101387477 3300031548 Bacteria 661
197 Ga0307508_10001545 3300031616 Bacteria 25766
198 Ga0307508_10217430 3300031616 Bacteria 1511
199 Ga0307508_10250065 3300031616 Bacteria 1369
200 Ga0265342_10144722 3300031712 Bacteria 1324
201 Ga0307516_10450770 3300031730 Bacteria 943
202 Ga0307516_10521916 3300031730 Bacteria 841
203 Ga0307516_10793871 3300031730 Bacteria 608
204 Ga0307409_101388090 3300031995 Bacteria 729
205 Ga0307415_100157674 3300032126 Bacteria 1755
206 Ga0373926_0131252 3300035083 Bacteria 949
207 Ga0373934_0191147 3300035086 Bacteria 842
208 Ga0373952_0271580 3300035092 Bacteria 520
209 Ga0373923_0067385 3300035111 Bacteria 1531
210 Ga0373936_0037479 3300035113 Bacteria 1936
211 Ga0373936_0420447 3300035113 Bacteria 615
212 Ga0373953_0016061 3300035117 Bacteria 2726
213 Ga0373954_0003353 3300035118 Bacteria 6778
214 Ga0373956_0056247 3300035119 Bacteria 1775
215 Ga0373956_0070074 3300035119 Bacteria 1599
216 Ga0373957_0026469 3300035120 Bacteria 2098
217 Ga0373955_0251986 3300035172 Bacteria 1058
218 Ga0373955_0581645 3300035172 Bacteria 685
219 Ga0373924_0060363 3300035410 Bacteria 1585
220 Ga0373924_0319059 3300035410 Bacteria 691
221 Ga0373935_0410654 3300035692 Bacteria 973
222 Ga0373927_0006051 3300035695 Bacteria 8289
223 Ga0373927_0409179 3300035695 Bacteria 895
224 Ga0373927_0687918 3300035695 Bacteria 676
225 Ga0373947_0421806 3300035725 Bacteria 902
226 Ga0373947_0939428 3300035725 Bacteria 590
227 Ga0373937_0066501 3300036401 Bacteria 3319
228 Ga0395900_0873068 3300037418 Bacteria 824
229 Ga0395898_0202314 3300037466 Bacteria 1896
230 Ga0436365_0754586 3300039437 Bacteria 7800
231 Ga0436360_0044610 3300039438 Bacteria 1146
232 Ga0436360_0705674 3300039438 Bacteria 527
233 Ga0436360_1334706 3300039438 Bacteria 910
234 Ga0436361_0208327 3300039447 Bacteria 2922
235 Ga0436361_0764341 3300039447 Bacteria 504
236 Ga0436361_0771956 3300039447 Bacteria 987
237 Ga0436361_0802620 3300039447 Bacteria 953
238 Ga0436363_0343305 3300039450 Bacteria 1130
239 Ga0436363_1478935 3300039450 Bacteria 1809
240 Ga0436362_0322535 3300039453 Bacteria 6674
241 Ga0436362_0936619 3300039453 Bacteria 1973
242 Ga0451793_1888635 3300041452 Bacteria 594
243 Ga0439431_0008148 3300041997 Bacteria 2351
244 Ga0466969_0354003 3300044656 Bacteria 665
245 Ga0466969_0536081 3300044656 Unclassified 535
246 Ga0466966_0083024 3300044684 Bacteria 1994
247 Ga0466963_0558088 3300044694 Bacteria 809
248 Ga0466968_0208858 3300044735 Bacteria 917
249 Ga0466957_0077685 3300044842 Bacteria 2063
250 Ga0466957_0206988 3300044842 Bacteria 1291
251 Ga0466959_0551744 3300045049 Bacteria 777
252 Ga0466967_0207384 3300045976 Bacteria 1858
253 Ga0495617_030070 3300046452 Bacteria 1826
254 Ga0495617_281974 3300046452 Bacteria 509
255 Ga0495592_0044296 3300046454 Bacteria 3325
256 Ga0495603_0159780 3300046455 Bacteria 1307
257 Ga0495629_0055125 3300046459 Bacteria 2780
258 Ga0495629_0248032 3300046459 Bacteria 1225
259 Ga0495638_0083865 3300046460 Bacteria 1929
260 Ga0495638_0561341 3300046460 Bacteria 566
261 Ga0495651_0121082 3300046462 Bacteria 1922
262 Ga0495653_0369982 3300046463 Bacteria 918
263 Ga0495653_0811266 3300046463 Bacteria 562
264 Ga0495650_0094187 3300046471 Bacteria 1134
265 Ga0495639_0574940 3300046475 Bacteria 578
266 Ga0495639_0639169 3300046475 Bacteria 548
267 Ga0495662_0177262 3300046476 Bacteria 1050
268 Ga0495664_0009975 3300046477 Bacteria 5329
269 Ga0495664_0298674 3300046477 Bacteria 972
270 Ga0495585_0166663 3300046492 Bacteria 1140
271 Ga0495596_0139542 3300046500 Bacteria 941
272 Ga0495583_0420798 3300046506 Bacteria 524
273 Ga0495606_0202059 3300046507 Bacteria 1132
274 Ga0495606_0502440 3300046507 Bacteria 612
275 Ga0495608_0033200 3300046511 Bacteria 3490
276 Ga0495608_0312387 3300046511 Bacteria 972
277 Ga0495610_0114702 3300046512 Bacteria 1189
278 Ga0495616_0183011 3300046513 Bacteria 930
279 Ga0495616_0266841 3300046513 Bacteria 731
280 Ga0495618_0158392 3300046514 Bacteria 1444
281 Ga0495628_1075179 3300046516 Bacteria 550
282 Ga0495628_1169437 3300046516 Bacteria 523
283 Ga0495630_0027389 3300046517 Bacteria 4228
284 Ga0495631_0282862 3300046518 Bacteria 706
285 Ga0495632_0134379 3300046519 Bacteria 1150
286 Ga0495643_0258047 3300046522 Bacteria 810
287 Ga0495644_0076710 3300046523 Bacteria 1259
288 Ga0495644_0141430 3300046523 Bacteria 919
289 Ga0495648_0188195 3300046524 Bacteria 1043
290 Ga0495663_0043868 3300046525 Bacteria 1367
291 Ga0495652_0233302 3300046529 Bacteria 1374
292 Ga0495640_0009118 3300046533 Bacteria 7744
293 Ga0495587_0170769 3300046536 Bacteria 1235
294 Ga0495598_0377305 3300046537 Bacteria 550
295 Ga0495609_0211470 3300046538 Bacteria 808
296 Ga0495609_0232020 3300046538 Bacteria 764
297 Ga0495645_0014513 3300046543 Bacteria 5592
298 Ga0495667_0098427 3300046559 Bacteria 1894
299 Ga0495667_0102635 3300046559 Bacteria 1849
300 Ga0495656_0117077 3300046615 Bacteria 1253
301 Ga0495656_0732223 3300046615 Bacteria 533
302 Ga0495668_0189144 3300046616 Bacteria 1127
303 Ga0495668_0868554 3300046616 Bacteria 500
304 Ga0495634_0727019 3300046642 Bacteria 569
305 Ga0495611_0148989 3300046648 Bacteria 1092
306 Ga0495611_0190804 3300046648 Bacteria 956
307 Ga0495625_0507863 3300046660 Bacteria 736
308 Ga0495635_0394699 3300046663 Bacteria 919
309 Ga0495659_0020083 3300046664 Bacteria 2240
310 Ga0495659_0479744 3300046664 Bacteria 543
311 Ga0495661_0043217 3300046665 Bacteria 2772
312 Ga0495661_0246511 3300046665 Bacteria 914
313 Ga0495588_0001460 3300046674 Bacteria 10144
314 Ga0495657_0069458 3300046675 Bacteria 2305
315 Ga0495599_0674473 3300046678 Bacteria 597
316 Ga0495623_0169910 3300046679 Bacteria 1274
317 Ga0495646_0047842 3300046680 Bacteria 2601
318 Ga0495647_0046399 3300046681 Bacteria 1674
319 Ga0495658_0088680 3300046683 Bacteria 1829
320 Ga0495613_0089938 3300046689 Bacteria 2224
321 Ga0495613_0741356 3300046689 Bacteria 644
322 Ga0495624_0349995 3300046690 Bacteria 889
323 Ga0495670_0083799 3300046691 Bacteria 1626
324 Ga0495670_0283312 3300046691 Bacteria 886
325 Ga0495589_0107263 3300046794 Bacteria 1349
326 Ga0495600_0308852 3300046809 Bacteria 996
327 Ga0495581_0785710 3300047315 Bacteria 547
328 Ga0495604_0186424 3300047317 Bacteria 1448
329 Ga0495674_0078989 3300047319 Bacteria 2826
330 Ga0495674_0182729 3300047319 Bacteria 1746
331 Ga0495672_0460736 3300047320 Bacteria 571
332 Ga0495676_0054912 3300047321 Bacteria 3163
333 Ga0495680_0406164 3300047322 Bacteria 939
334 Ga0495680_0577478 3300047322 Bacteria 754
335 Ga0495687_069581 3300047443 Bacteria 1416
336 Ga0495675_0164612 3300047444 Bacteria 1364
337 Ga0495677_0039255 3300047445 Bacteria 1731
338 Ga0495685_152613 3300047447 Bacteria 750
339 Ga0495673_0190784 3300047469 Bacteria 771
340 Ga0495681_0096037 3300047470 Bacteria 1302
341 Ga0495684_0004946 3300047471 Bacteria 10410
342 Ga0495593_0384633 3300047673 Bacteria 702
343 Ga0495602_0206525 3300048088 Bacteria 1494
344 Ga0495602_1137764 3300048088 Bacteria 510
345 Ga0495626_0052302 3300048091 Bacteria 1883
346 Ga0496101_0455554 3300048904 Bacteria 1009
347 Ga0496101_1564974 3300048904 Bacteria 512
348 Ga0496102_0233877 3300048905 Bacteria 1732
349 Ga0496102_0491878 3300048905 Bacteria 1148
350 Ga0496102_1899332 3300048905 Bacteria 512
351 Ga0496103_0007175 3300048906 Bacteria 6645
352 Ga0496104_0053542 3300048907 Bacteria 3813
353 Ga0496104_0229957 3300048907 Bacteria 1766
354 Ga0496105_0015974 3300048908 Bacteria 5988
355 Ga0496106_0106617 3300048909 Bacteria 2178
356 Ga0496106_0633944 3300048909 Bacteria 855
357 Ga0496106_1057046 3300048909 Bacteria 637
358 Ga0496107_0228290 3300048910 Bacteria 1385
359 Ga0496108_0526040 3300048911 Bacteria 1032
360 Ga0496109_0068910 3300048912 Bacteria 3243
361 Ga0496110_0161537 3300048913 Bacteria 2031
362 Ga0496110_0383135 3300048913 Bacteria 1281
363 Ga0496111_0089154 3300048914 Bacteria 2259
364 Ga0496111_0356036 3300048914 Bacteria 1083
365 Ga0496112_0005624 3300048915 Bacteria 10875
366 Ga0496112_0090434 3300048915 Bacteria 3030
367 Ga0496112_0248000 3300048915 Bacteria 1732
368 Ga0496113_0142120 3300048916 Bacteria 1889
369 Ga0496113_0571536 3300048916 Bacteria 906
370 Ga0496113_1451230 3300048916 Bacteria 530
371 Ga0496115_0217621 3300048918 Bacteria 1576
372 Ga0496117_0111501 3300048920 Bacteria 1703
373 Ga0496119_0177363 3300048922 Bacteria 1120
374 Ga0496121_0441538 3300048924 Bacteria 841
375 Ga0496121_0508413 3300048924 Bacteria 763
376 Ga0496121_0655996 3300048924 Bacteria 638
377 Ga0496122_0324013 3300048925 Bacteria 818
378 Ga0496125_0156506 3300048928 Bacteria 1556
379 Ga0496125_0272803 3300048928 Bacteria 1053
380 Ga0496125_0676835 3300048928 Bacteria 551
381 Ga0496126_0168652 3300048929 Bacteria 1867
382 Ga0496126_0439183 3300048929 Bacteria 1052
383 Ga0501034_1580951 3300049571 Bacteria 529
384 Ga0501041_0561467 3300049577 Bacteria 728
385 Ga0501076_0619797 3300049592 Bacteria 893
386 Ga0501083_1040812 3300049744 Bacteria 533
387 Ga0501035_0475210 3300049822 Bacteria 1032
388 nmdc:mga03683_253007_c1 3300050489 Bacteria 818
389 nmdc:mga03n38_430773_c1 3300050490 Bacteria 731
390 nmdc:mga00v17_157921_c1 3300050491 Bacteria 1459
391 nmdc:mga0yw44_6256_c1 3300050492 Bacteria 5734
392 nmdc:mga0k408_2821_c1 3300050493 Bacteria 9224
393 nmdc:mga0k408_327675_c1 3300050493 Bacteria 914
394 nmdc:mga06z11_141489_c1 3300050494 Bacteria 1361
395 nmdc:mga04h51_317813_c1 3300050495 Bacteria 638
396 nmdc:mga07m45_96466_c1 3300050496 Bacteria 1697
397 nmdc:mga0n895_81430_c1 3300050512 Bacteria 3226
398 nmdc:mga0rr50_420970_c1 3300050513 Bacteria 1130
399 nmdc:mga0sz30_447777_c1 3300050516 Bacteria 580
400 nmdc:mga0sz30_536823_c1 3300050516 Bacteria 527
401 Ga0495601_0023452 3300053077 Bacteria 3791
402 Ga0495601_0287520 3300053077 Bacteria 1072
403 Ga0495612_0030264 3300053078 Bacteria 2180
404 Ga0500610_0171383 3300053079 Bacteria 1071
405 Ga0495655_0034051 3300053083 Bacteria 1258
406 Ga0495655_0170577 3300053083 Bacteria 696
407 Ga0495595_0034561 3300053084 Bacteria 2286
408 Ga0495619_0057981 3300053085 Bacteria 2569
409 Ga0500644_0118552 3300053088 Bacteria 1028
410 Ga0500647_0047755 3300053091 Bacteria 2058
411 Ga0500651_0014125 3300053093 Bacteria 4881
412 Ga0500566_0000839 3300053094 Bacteria 17527
413 Ga0500566_0106191 3300053094 Bacteria 1532
414 Ga0500641_0133484 3300053096 Bacteria 1071
415 Ga0500572_015347 3300053111 Bacteria 1931
416 Ga0500591_155898 3300053115 Bacteria 873
417 Ga0500595_000476 3300053119 Bacteria 24760
418 Ga0500608_026420 3300053122 Bacteria 2727
419 Ga0500642_0017022 3300053130 Bacteria 2776
420 Ga0500559_0052207 3300053136 Bacteria 1806
421 Ga0500590_173507 3300053148 Bacteria 945
422 Ga0500603_006144 3300053150 Bacteria 2605
423 Ga0500616_0000038 3300053153 Bacteria 386801
424 Ga0500619_148953 3300053154 Bacteria 796
425 Ga0500622_0075903 3300053156 Bacteria 1691
426 Ga0500630_256664 3300053159 Bacteria 613
427 Ga0500638_000534 3300053162 Bacteria 9528
428 Ga0500638_157882 3300053162 Bacteria 1001
429 Ga0500639_102589 3300053163 Bacteria 1404
430 Ga0500636_0080867 3300053177 Bacteria 1872
431 Ga0500636_0105435 3300053177 Bacteria 1598
432 Ga0500637_0000172 3300053178 Bacteria 24102
433 Ga0500637_0545368 3300053178 Bacteria 563
434 Ga0500576_138817 3300053725 Bacteria 928
435 Ga0500645_011680 3300053730 Bacteria 2859
436 Ga0500609_031643 3300053731 Bacteria 727
437 Ga0500596_005635 3300053735 Bacteria 2182
438 Ga0500661_000919 3300055283 Bacteria 5525
439 Ga0500661_016718 3300055283 Bacteria 1311
440 2509149883 2508501128 Bacteria 8613869
441 2511393266 2511231028 Bacteria 8046582
442 2513694334 2513237101 Bacteria 7952346
443 2513889619 2513237141 Bacteria 8496279
444 2728754252 2728368998 Bacteria 8720350
445 2793071014 2791355197 Bacteria 8420563
446 2818243379 2816332527 Bacteria 8933356
447 2857516626 2857509624 Bacteria 7472071
448 2874595593 2874590934 Bacteria 8299676
449 2874647112 2874645413 Bacteria 8214782
450 2876775787 2876771140 Bacteria 8287509
451 2876823779 2876818435 Bacteria 8274608
452 2879079878 2879074833 Bacteria 8279565
453 2879131069 2879127579 Bacteria 8294491
454 2879150276 2879142872 Bacteria 8267021
455 2888378813 2888378607 Bacteria 9652610
456 2903750029 2903748898 Bacteria 9972761
457 2904692444 2904690495 Bacteria 9412302
458 2906613170
459 2922433669
460 2935634713 2935630451 Bacteria 8169952
461 2935982337 2935975950 Bacteria 8347125
462 2941511957 2941507105 Bacteria 8166816
463 2941519659 2941515067 Bacteria 8166720
464 2941527649 2941523033 Bacteria 8169134
465 2941535912 2941531003 Bacteria 7653939
466 3005711634 3005710791 Bacteria 7622528
467 8019563093 8019555841 Bacteria 9642137
468 8019573174 8019565922 Bacteria 9639779
469 8019638639 8019629233 Bacteria 8687553
470 8019666441 8019659431 Bacteria 8577854
471 8019676102 8019668869 Bacteria 8791617
472 8019679883 8019678201 Bacteria 8863603
473 Ga0070680_101332356
474 JGI24737J22298_10245824
475 Ga0070683_100048308
476 Ga0070683_100917817
477 Ga0070666_10138522
478 Ga0070666_10142036
479 Ga0070680_100161701
480 Ga0068868_100614066
481 Ga0070660_100298376
482 Ga0070689_100255813
483 Ga0070661_100226005
484 Ga0070661_101133054
485 Ga0070668_100566269
486 Ga0070668_101093953
487 Ga0070675_100885675
488 Ga0070659_100897197
489 Ga0070667_100093038
490 Ga0070709_10016123
491 Ga0070709_10034639
492 Ga0070709_11050011
493 Ga0070714_100103935
494 Ga0070714_100338597
495 Ga0070714_100456170
496 Ga0070713_100008883
497 Ga0070713_100023569
498 Ga0070713_100107853
499 Ga0070713_100921013
500 Ga0070713_101593777
501 Ga0070710_10001420
502 Ga0070710_10017195
503 Ga0070711_100032710
504 Ga0070711_100076352
505 Ga0070711_100267986
506 Ga0070700_100827253
507 Ga0070663_101493358
508 Ga0070678_101358911
509 Ga0070681_10087294
510 Ga0070681_11584961
511 Ga0070679_100044686
512 Ga0070679_100059656
513 Ga0070684_100013219
514 Ga0070684_100888117
515 Ga0070697_100199535
516 Ga0068853_100228194
517 Ga0070665_100441007
518 Ga0070665_100729366
519 Ga0070665_100755290
520 Ga0068855_100187729
521 Ga0068855_100414428
522 Ga0068855_100514331
523 Ga0070664_101536644
524 Ga0068854_100655767
525 Ga0068854_101574278
526 Ga0068856_100334654
527 Ga0068856_101093413
528 Ga0068856_102320384
529 Ga0068864_100152095
530 Ga0068863_100159501
531 Ga0068863_100339345
532 Ga0068858_100201756
533 Ga0068858_100562706
534 Ga0068858_100853006
535 Ga0068858_101013169
536 Ga0068860_100759457
537 Ga0068860_100865263
538 Ga0081455_10015989
539 Ga0081540_1011031
540 Ga0081540_1243318
541 Ga0070717_10034234
542 Ga0070717_10226324
543 Ga0075363_100006374
544 Ga0070715_10002422
545 Ga0070715_10338031
546 Ga0070716_100008434
547 Ga0070716_100011641
548 Ga0070712_100024001
549 Ga0070712_100133669
550 Ga0075362_10326102
551 Ga0075369_10267334
552 Ga0075366_10160944
553 Ga0097621_102035073
554 Ga0075370_10040232
555 Ga0075434_100088272
556 Ga0099822_1007326
557 Ga0075435_100299449
558 Ga0105240_11009344
559 Ga0105240_11019137
560 Ga0105245_10331887
561 Ga0105245_10910904
562 Ga0105241_10253095
563 Ga0105248_10341401
564 Ga0105237_10032056
565 Ga0105237_10095991
566 Ga0105237_10539976
567 Ga0105237_11642753
568 Ga0105238_10029421
569 Ga0099796_10388320
570 Ga0105239_10180674
571 Ga0105239_10559578
572 Ga0105239_12633205
573 Ga0105246_10780943
574 Ga0157370_10118665
575 Ga0157369_10230034
576 Ga0163162_11014010
577 Ga0157375_10878259
578 Ga0163163_10027246
579 Ga0163163_10629184
580 Ga0163163_11393765
581 Ga0163163_11873067
582 Ga0157377_10681422
583 Ga0157379_10328192
584 Ga0157376_10179657
585 Ga0206353_10248677
586 Ga0213873_10002500
587 Ga0213872_10056014
588 Ga0213872_10206322
589 Ga0213874_10054573
590 Ga0213874_10149546
591 Ga0213876_10002372
592 Ga0213876_10780481
593 Ga0209758_1009223
594 Ga0209257_1025919
595 Ga0207692_10000852
596 Ga0207692_10002369
597 Ga0207688_10209498
598 Ga0207680_10483063
599 Ga0207647_10148488
600 Ga0207685_10002118
601 Ga0207685_10056943
602 Ga0207699_10012280
603 Ga0207699_10488720
604 Ga0207705_10022057
605 Ga0207705_10592467
606 Ga0207654_10675926
607 Ga0207707_10081150
608 Ga0207707_10153645
609 Ga0207707_10318352
610 Ga0207695_10869968
611 Ga0207671_10008770
612 Ga0207693_10019068
613 Ga0207663_10006733
614 Ga0207663_10196541
615 Ga0207663_10292785
616 Ga0207663_10602533
617 Ga0207660_10063776
618 Ga0207660_10552980
619 Ga0207660_11149259
620 Ga0207652_10030351
621 Ga0207652_10326133
622 Ga0207694_11057052
623 Ga0207659_10721872
624 Ga0207700_10014409
625 Ga0207700_10607698
626 Ga0207700_10775357
627 Ga0207664_10025078
628 Ga0207664_10072294
629 Ga0207664_10078541
630 Ga0207644_11201756
631 Ga0207690_10984566
632 Ga0207670_10308025
633 Ga0207669_10252438
634 Ga0207665_10004492
635 Ga0207665_10014639
636 Ga0207665_10226826
637 Ga0207711_10410789
638 Ga0207661_10002241
639 Ga0207679_10214700
640 Ga0207679_11252502
641 Ga0207667_10030550
642 Ga0207651_10586613
643 Ga0207651_10597005
644 Ga0207668_10223269
645 Ga0207640_10328384
646 Ga0207658_10435000
647 Ga0207677_10774085
648 Ga0207703_11112844
649 Ga0207639_10196277
650 Ga0207678_10204504
651 Ga0207641_10291619
652 Ga0207676_11311583
653 Ga0207676_11424596
654 Ga0207675_100238058
655 Ga0207698_11099253
656 Ga0209589_1000017
657 Ga0209489_100018
658 Ga0209700_100028
659 Ga0209813_10283307
660 Ga0268266_11162909
661 Ga0268264_10511869
662 Ga0268264_10962956
663 Ga0265330_10103604
664 Ga0265330_10117991
665 Ga0265332_10055494
666 Ga0265339_10140485
667 Ga0265331_10260322
668 Ga0307408_101387477
669 Ga0307508_10001545
670 Ga0307508_10217430
671 Ga0307508_10250065
672 Ga0265342_10144722
673 Ga0307516_10450770
674 Ga0307516_10521916
675 Ga0307516_10793871
676 Ga0307409_101388090
677 Ga0307415_100157674
678 Ga0373926_0131252
679 Ga0373934_0191147
680 Ga0373952_0271580
681 Ga0373923_0067385
682 Ga0373936_0037479
683 Ga0373936_0420447
684 Ga0373953_0016061
685 Ga0373954_0003353
686 Ga0373956_0056247
687 Ga0373956_0070074
688 Ga0373957_0026469
689 Ga0373955_0251986
690 Ga0373955_0581645
691 Ga0373924_0060363
692 Ga0373924_0319059
693 Ga0373935_0410654
694 Ga0373927_0006051
695 Ga0373927_0409179
696 Ga0373927_0687918
697 Ga0373947_0421806
698 Ga0373947_0939428
699 Ga0373937_0066501
700 Ga0395900_0873068
701 Ga0395898_0202314
702 Ga0436365_0754586
703 Ga0436360_0044610
704 Ga0436360_0705674
705 Ga0436360_1334706
706 Ga0436361_0208327
707 Ga0436361_0764341
708 Ga0436361_0771956
709 Ga0436361_0802620
710 Ga0436363_0343305
711 Ga0436363_1478935
712 Ga0436362_0322535
713 Ga0436362_0936619
714 Ga0451793_1888635
715 Ga0439431_0008148
716 Ga0466969_0354003
717 Ga0466969_0536081
718 Ga0466966_0083024
719 Ga0466963_0558088
720 Ga0466968_0208858
721 Ga0466957_0077685
722 Ga0466957_0206988
723 Ga0466959_0551744
724 Ga0466967_0207384
725 Ga0495617_030070
726 Ga0495617_281974
727 Ga0495592_0044296
728 Ga0495603_0159780
729 Ga0495629_0055125
730 Ga0495629_0248032
731 Ga0495638_0083865
732 Ga0495638_0561341
733 Ga0495651_0121082
734 Ga0495653_0369982
735 Ga0495653_0811266
736 Ga0495650_0094187
737 Ga0495639_0574940
738 Ga0495639_0639169
739 Ga0495662_0177262
740 Ga0495664_0009975
741 Ga0495664_0298674
742 Ga0495585_0166663
743 Ga0495596_0139542
744 Ga0495583_0420798
745 Ga0495606_0202059
746 Ga0495606_0502440
747 Ga0495608_0033200
748 Ga0495608_0312387
749 Ga0495610_0114702
750 Ga0495616_0183011
751 Ga0495616_0266841
752 Ga0495618_0158392
753 Ga0495628_1075179
754 Ga0495628_1169437
755 Ga0495630_0027389
756 Ga0495631_0282862
757 Ga0495632_0134379
758 Ga0495643_0258047
759 Ga0495644_0076710
760 Ga0495644_0141430
761 Ga0495648_0188195
762 Ga0495663_0043868
763 Ga0495652_0233302
764 Ga0495640_0009118
765 Ga0495587_0170769
766 Ga0495598_0377305
767 Ga0495609_0211470
768 Ga0495609_0232020
769 Ga0495645_0014513
770 Ga0495667_0098427
771 Ga0495667_0102635
772 Ga0495656_0117077
773 Ga0495656_0732223
774 Ga0495668_0189144
775 Ga0495668_0868554
776 Ga0495634_0727019
777 Ga0495611_0148989
778 Ga0495611_0190804
779 Ga0495625_0507863
780 Ga0495635_0394699
781 Ga0495659_0020083
782 Ga0495659_0479744
783 Ga0495661_0043217
784 Ga0495661_0246511
785 Ga0495588_0001460
786 Ga0495657_0069458
787 Ga0495599_0674473
788 Ga0495623_0169910
789 Ga0495646_0047842
790 Ga0495647_0046399
791 Ga0495658_0088680
792 Ga0495613_0089938
793 Ga0495613_0741356
794 Ga0495624_0349995
795 Ga0495670_0083799
796 Ga0495670_0283312
797 Ga0495589_0107263
798 Ga0495600_0308852
799 Ga0495581_0785710
800 Ga0495604_0186424
801 Ga0495674_0078989
802 Ga0495674_0182729
803 Ga0495672_0460736
804 Ga0495676_0054912
805 Ga0495680_0406164
806 Ga0495680_0577478
807 Ga0495687_069581
808 Ga0495675_0164612
809 Ga0495677_0039255
810 Ga0495685_152613
811 Ga0495673_0190784
812 Ga0495681_0096037
813 Ga0495684_0004946
814 Ga0495593_0384633
815 Ga0495602_0206525
816 Ga0495602_1137764
817 Ga0495626_0052302
818 Ga0496101_0455554
819 Ga0496101_1564974
820 Ga0496102_0233877
821 Ga0496102_0491878
822 Ga0496102_1899332
823 Ga0496103_0007175
824 Ga0496104_0053542
825 Ga0496104_0229957
826 Ga0496105_0015974
827 Ga0496106_0106617
828 Ga0496106_0633944
829 Ga0496106_1057046
830 Ga0496107_0228290
831 Ga0496108_0526040
832 Ga0496109_0068910
833 Ga0496110_0161537
834 Ga0496110_0383135
835 Ga0496111_0089154
836 Ga0496111_0356036
837 Ga0496112_0005624
838 Ga0496112_0090434
839 Ga0496112_0248000
840 Ga0496113_0142120
841 Ga0496113_0571536
842 Ga0496113_1451230
843 Ga0496115_0217621
844 Ga0496117_0111501
845 Ga0496119_0177363
846 Ga0496121_0441538
847 Ga0496121_0508413
848 Ga0496121_0655996
849 Ga0496122_0324013
850 Ga0496125_0156506
851 Ga0496125_0272803
852 Ga0496125_0676835
853 Ga0496126_0168652
854 Ga0496126_0439183
855 Ga0501034_1580951
856 Ga0501041_0561467
857 Ga0501076_0619797
858 Ga0501083_1040812
859 Ga0501035_0475210
860 nmdc:mga03683_253007_c1
861 nmdc:mga03n38_430773_c1
862 nmdc:mga00v17_157921_c1
863 nmdc:mga0yw44_6256_c1
864 nmdc:mga0k408_2821_c1
865 nmdc:mga0k408_327675_c1
866 nmdc:mga06z11_141489_c1
867 nmdc:mga04h51_317813_c1
868 nmdc:mga07m45_96466_c1
869 nmdc:mga0n895_81430_c1
870 nmdc:mga0rr50_420970_c1
871 nmdc:mga0sz30_447777_c1
872 nmdc:mga0sz30_536823_c1
873 Ga0495601_0023452
874 Ga0495601_0287520
875 Ga0495612_0030264
876 Ga0500610_0171383
877 Ga0495655_0034051
878 Ga0495655_0170577
879 Ga0495595_0034561
880 Ga0495619_0057981
881 Ga0500644_0118552
882 Ga0500647_0047755
883 Ga0500651_0014125
884 Ga0500566_0000839
885 Ga0500566_0106191
886 Ga0500641_0133484
887 Ga0500572_015347
888 Ga0500591_155898
889 Ga0500595_000476
890 Ga0500608_026420
891 Ga0500642_0017022
892 Ga0500559_0052207
893 Ga0500590_173507
894 Ga0500603_006144
895 Ga0500616_0000038
896 Ga0500619_148953
897 Ga0500622_0075903
898 Ga0500630_256664
899 Ga0500638_000534
900 Ga0500638_157882
901 Ga0500639_102589
902 Ga0500636_0080867
903 Ga0500636_0105435
904 Ga0500637_0000172
905 Ga0500637_0545368
906 Ga0500576_138817
907 Ga0500645_011680
908 Ga0500609_031643
909 Ga0500596_005635
910 Ga0500661_000919
911 Ga0500661_016718
912 2509149883
913 2511393266
914 2513694334
915 2513889619
916 2728754252
917 2793071014
918 2818243379
919 2857516626
920 2874595593
921 2874647112
922 2876775787
923 2876823779
924 2879079878
925 2879131069
926 2879150276
927 2888378813
928 2903750029
929 2904692444
930 2906613170
931 2922433669
932 2935634713
933 2935982337
934 2941511957
935 2941519659
936 2941527649
937 2941535912
938 3005711634
939 8019563093
940 8019573174
941 8019638639
942 8019666441
943 8019676102
944 8019679883

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bqs-assembly1.cif.gz_Da cryo-em structure of the i-ii-iii2-iv2 respiratory supercomplex from tetrahymena thermophila 0.8556 42 102
7wux-assembly1.cif.gz_D crystal structure of aziu3/u2 complexed with (5s,6s)-o7-sulfo dadh from streptomyces sahachiroi 0.6253 50 102
6cfe-assembly1.cif.gz_A crystal structure of c2s5: a computationally designed immunogen to target carbohydrate-occluded epitopes on the hiv envelope 0.6057 12 101
8eup-assembly1.cif.gz_b ytm1 associated 60s nascent ribosome state 1a 0.6026 15 101
5ys3-assembly1.cif.gz_A 1.8 angstrom crystal structure of succinate-acetate permease from citrobacter koseri 0.5949 15 97
ID Description Score Start End Superfamily
af_F1LYI7_22_101_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8354 14 84 1.20.120.550
af_Q2FZK0_30_556_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.8185 42 99 1.20.210.10
af_Q568J8_21_102_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8153 14 84 1.20.120.550
af_Q9U2Z9_62_144_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8105 14 84 1.20.120.550
af_O21042_10_509_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.7959 42 103 1.20.210.10
ID Description Score Start End GO Terms
AF-A0A833D5K2-F1-model_v4 DUF423 domain-containing protein 0.9284 18 103 GO:0016020
AF-A0A7Y4L9H4-F1-model_v4 DUF423 domain-containing protein 0.9284 25 97 GO:0005886
AF-A0A4D7QHV9-F1-model_v4 DUF423 domain-containing protein 0.9279 18 103 GO:0016020
AF-A0A522TJC9-F1-model_v4 DUF423 domain-containing protein 0.9228 18 98 GO:0005886
AF-A0A7W9WMR9-F1-model_v4 Uncharacterized membrane protein YgdD (TMEM256/DUF423 family) 0.9215 18 100 GO:0016020

Map