F450730

General Info

Members Datasets Scaffolds Average Seq Length
472 230 944 105

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100800299|Ga0068869_1008002992
Length 110
Sequence MESGTAPASTARIRVVLPQHLQTLARVADREIAVDVAGVVTQRAVLDAVEARFPQLRGTIRDQATAKRRPFLRFFACEEDWSHAAPDDPLPATVASGTEPFLVVGAMAGG

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
153 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
154 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
157 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
158 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
159 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
160 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
161 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
162 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
163 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
164 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
165 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
166 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
167 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
168 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
169 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.31
Metatranscriptomes 1.69
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.69
Nodule 0
Rhizoplane 1.48
Rhizosphere 96.82
Stem 0
Stem Tuber 0
Unclassified 7.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100800299 3300005334 Bacteria 810
2 JGI24034J26672_10002694 3300002239 Bacteria 2448
3 Ga0065707_10099766 3300005295 Bacteria 2981
4 Ga0070658_10000510 3300005327 Bacteria 33665
5 Ga0070658_10191226 3300005327 Bacteria 1725
6 Ga0070676_10514487 3300005328 Bacteria 852
7 Ga0070683_100203880 3300005329 Bacteria 1878
8 Ga0070683_100339155 3300005329 Bacteria 1431
9 Ga0070690_100242299 3300005330 Bacteria 1272
10 Ga0070690_101166651 3300005330 Bacteria 613
11 Ga0068869_100014654 3300005334 Bacteria 5243
12 Ga0070666_10984254 3300005335 Bacteria 625
13 Ga0070680_100000189 3300005336 Bacteria 39692
14 Ga0070680_100056506 3300005336 Bacteria 3208
15 Ga0070682_100140820 3300005337 Bacteria 1644
16 Ga0070682_100265257 3300005337 Bacteria 1245
17 Ga0070682_101040813 3300005337 Bacteria 682
18 Ga0068868_100000178 3300005338 Bacteria 42328
19 Ga0070660_100174837 3300005339 Bacteria 1736
20 Ga0070689_100031982 3300005340 Bacteria 4000
21 Ga0070689_101386453 3300005340 Bacteria 635
22 Ga0070691_10227641 3300005341 Bacteria 991
23 Ga0070691_10530635 3300005341 Bacteria 685
24 Ga0070687_101315750 3300005343 Unclassified 537
25 Ga0070661_100002573 3300005344 Bacteria 12433
26 Ga0070661_100027267 3300005344 Bacteria 4112
27 Ga0070661_100188093 3300005344 Bacteria 1574
28 Ga0070661_100697135 3300005344 Unclassified 827
29 Ga0070661_100918530 3300005344 Unclassified 723
30 Ga0070668_100196095 3300005347 Bacteria 1656
31 Ga0070668_100924177 3300005347 Bacteria 781
32 Ga0070669_100981604 3300005353 Bacteria 724
33 Ga0070669_101160920 3300005353 Bacteria 666
34 Ga0070675_100041499 3300005354 Bacteria 3758
35 Ga0070675_100471467 3300005354 Bacteria 1128
36 Ga0070671_100001359 3300005355 Bacteria 18333
37 Ga0070671_100027814 3300005355 Bacteria 4655
38 Ga0070674_100523189 3300005356 Bacteria 991
39 Ga0070688_100128573 3300005365 Bacteria 1706
40 Ga0070688_100359582 3300005365 Bacteria 1068
41 Ga0070667_100025250 3300005367 Bacteria 4939
42 Ga0070667_101387892 3300005367 Bacteria 659
43 Ga0070709_10523010 3300005434 Bacteria 904
44 Ga0070714_100420677 3300005435 Bacteria 1266
45 Ga0070714_100514111 3300005435 Bacteria 1143
46 Ga0070713_100001436 3300005436 Bacteria 15282
47 Ga0070713_100942945 3300005436 Bacteria 831
48 Ga0070711_100006753 3300005439 Bacteria 6945
49 Ga0070705_100071844 3300005440 Bacteria 2094
50 Ga0070700_100549329 3300005441 Unclassified 897
51 Ga0070694_100167912 3300005444 Bacteria 1615
52 Ga0070694_100621553 3300005444 Bacteria 872
53 Ga0070694_100675973 3300005444 Bacteria 838
54 Ga0070694_101593598 3300005444 Bacteria 554
55 Ga0070708_100216288 3300005445 Bacteria 1796
56 Ga0070663_100351051 3300005455 Bacteria 1194
57 Ga0070678_100145026 3300005456 Bacteria 1905
58 Ga0070662_101318992 3300005457 Bacteria 621
59 Ga0070681_10000937 3300005458 Bacteria 24562
60 Ga0070681_10274849 3300005458 Bacteria 1596
61 Ga0070681_10579654 3300005458 Bacteria 1036
62 Ga0070681_10999405 3300005458 Bacteria 756
63 Ga0068867_101118104 3300005459 Bacteria 720
64 Ga0070706_100415187 3300005467 Bacteria 1253
65 Ga0070707_100335337 3300005468 Bacteria 1469
66 Ga0070707_101174983 3300005468 Bacteria 733
67 Ga0070698_100009744 3300005471 Bacteria 10268
68 Ga0070698_100105083 3300005471 Bacteria 2794
69 Ga0070698_100293378 3300005471 Bacteria 1557
70 Ga0070698_100630919 3300005471 Unclassified 1012
71 Ga0070699_101455072 3300005518 Bacteria 628
72 Ga0070699_101793529 3300005518 Unclassified 562
73 Ga0070679_100008583 3300005530 Bacteria 9629
74 Ga0070679_100220306 3300005530 Bacteria 1859
75 Ga0070679_100415489 3300005530 Bacteria 1291
76 Ga0070684_100008389 3300005535 Bacteria 8072
77 Ga0070684_100067730 3300005535 Bacteria 3137
78 Ga0070684_100099411 3300005535 Bacteria 2597
79 Ga0070684_100107399 3300005535 Bacteria 2500
80 Ga0070684_100180576 3300005535 Bacteria 1919
81 Ga0070697_100007718 3300005536 Bacteria 8381
82 Ga0070697_100045968 3300005536 Bacteria 3539
83 Ga0070697_100110767 3300005536 Bacteria 2287
84 Ga0070697_100430867 3300005536 Bacteria 1147
85 Ga0068853_100000048 3300005539 Bacteria 93122
86 Ga0068853_100340180 3300005539 Bacteria 1394
87 Ga0068853_100606064 3300005539 Bacteria 1040
88 Ga0068853_101200130 3300005539 Unclassified 732
89 Ga0070672_100707937 3300005543 Bacteria 882
90 Ga0070695_100006076 3300005545 Bacteria 7136
91 Ga0070695_101384644 3300005545 Unclassified 583
92 Ga0070696_100851093 3300005546 Bacteria 754
93 Ga0070696_101037698 3300005546 Bacteria 686
94 Ga0070693_100798938 3300005547 Bacteria 699
95 Ga0070665_100000225 3300005548 Bacteria 94249
96 Ga0070665_100022857 3300005548 Bacteria 6296
97 Ga0070665_100841517 3300005548 Bacteria 931
98 Ga0070665_101109004 3300005548 Bacteria 803
99 Ga0068855_100003334 3300005563 Bacteria 19648
100 Ga0068855_100013025 3300005563 Bacteria 10033
101 Ga0068855_100022704 3300005563 Bacteria 7518
102 Ga0068855_100663533 3300005563 Bacteria 1119
103 Ga0068855_100757348 3300005563 Bacteria 1035
104 Ga0070664_100137038 3300005564 Bacteria 2153
105 Ga0070664_101590269 3300005564 Unclassified 619
106 Ga0068857_100015300 3300005577 Bacteria 6697
107 Ga0068857_100052095 3300005577 Bacteria 3632
108 Ga0068857_100161237 3300005577 Bacteria 2035
109 Ga0068857_100857696 3300005577 Bacteria 869
110 Ga0068854_100039895 3300005578 Bacteria 3310
111 Ga0068854_100098439 3300005578 Bacteria 2189
112 Ga0068856_100001672 3300005614 Bacteria 23230
113 Ga0068856_100024476 3300005614 Bacteria 5879
114 Ga0068856_100049147 3300005614 Bacteria 4157
115 Ga0068856_100105400 3300005614 Bacteria 2813
116 Ga0068856_100202476 3300005614 Bacteria 1999
117 Ga0068856_100256138 3300005614 Bacteria 1765
118 Ga0070702_100299495 3300005615 Bacteria 1112
119 Ga0068852_100000076 3300005616 Bacteria 69262
120 Ga0068852_100000105 3300005616 Bacteria 55996
121 Ga0068852_100179738 3300005616 Bacteria 1989
122 Ga0068852_100503771 3300005616 Bacteria 1206
123 Ga0068852_101015400 3300005616 Bacteria 848
124 Ga0068852_102302405 3300005616 Unclassified 560
125 Ga0068859_100013866 3300005617 Bacteria 8082
126 Ga0068859_100055512 3300005617 Bacteria 3986
127 Ga0068859_100103018 3300005617 Bacteria 2912
128 Ga0068859_100620489 3300005617 Bacteria 1174
129 Ga0068864_100004282 3300005618 Bacteria 11732
130 Ga0068864_100347716 3300005618 Bacteria 1398
131 Ga0068864_101694478 3300005618 Bacteria 637
132 Ga0068866_11122098 3300005718 Unclassified 564
133 Ga0068861_100124569 3300005719 Bacteria 2083
134 Ga0068861_100267758 3300005719 Bacteria 1466
135 Ga0068861_102334398 3300005719 Bacteria 537
136 Ga0068851_10027451 3300005834 Bacteria 2806
137 Ga0068851_10069932 3300005834 Bacteria 1814
138 Ga0068851_10096340 3300005834 Bacteria 1564
139 Ga0068851_11013098 3300005834 Bacteria 524
140 Ga0068863_100016745 3300005841 Bacteria 7033
141 Ga0068863_100395463 3300005841 Bacteria 1351
142 Ga0068858_100001937 3300005842 Bacteria 21103
143 Ga0068858_100020173 3300005842 Bacteria 6232
144 Ga0068858_100478143 3300005842 Bacteria 1202
145 Ga0068860_100000881 3300005843 Bacteria 33318
146 Ga0068860_100037368 3300005843 Bacteria 4648
147 Ga0068862_100064479 3300005844 Bacteria 3154
148 Ga0068862_100295050 3300005844 Bacteria 1490
149 Ga0068862_101125094 3300005844 Bacteria 781
150 Ga0068862_101718169 3300005844 Bacteria 636
151 Ga0068862_102160495 3300005844 Bacteria 568
152 Ga0070717_10004374 3300006028 Bacteria 10195
153 Ga0070717_10804803 3300006028 Unclassified 855
154 Ga0075364_10035047 3300006051 Bacteria 3242
155 Ga0070715_10156335 3300006163 Bacteria 1122
156 Ga0070712_100001546 3300006175 Bacteria 14064
157 Ga0075367_10027442 3300006178 Bacteria 3239
158 Ga0075366_10066576 3300006195 Bacteria 2143
159 Ga0097621_100000984 3300006237 Bacteria 20000
160 Ga0097621_100113675 3300006237 Bacteria 2290
161 Ga0068871_100023304 3300006358 Bacteria 4786
162 Ga0068871_100026825 3300006358 Bacteria 4499
163 Ga0068871_100667720 3300006358 Bacteria 950
164 Ga0068871_100791674 3300006358 Unclassified 873
165 Ga0075428_100002950 3300006844 Bacteria 18546
166 Ga0075428_100237595 3300006844 Bacteria 1966
167 Ga0075428_102751321 3300006844 Unclassified 501
168 Ga0075430_100166509 3300006846 Bacteria 1834
169 Ga0075431_101210681 3300006847 Unclassified 718
170 Ga0075433_10144376 3300006852 Bacteria 2115
171 Ga0075433_10254073 3300006852 Bacteria 1559
172 Ga0075434_100334938 3300006871 Bacteria 1534
173 Ga0075434_101191117 3300006871 Bacteria 774
174 Ga0075429_100043852 3300006880 Bacteria 3891
175 Ga0075429_100528541 3300006880 Bacteria 1034
176 Ga0075436_100009826 3300006914 Bacteria 6544
177 Ga0075436_100177670 3300006914 Bacteria 1504
178 Ga0097620_100013866 3300006931 Bacteria 8082
179 Ga0097620_100055512 3300006931 Bacteria 3986
180 Ga0097620_100103016 3300006931 Bacteria 2912
181 Ga0097620_100620508 3300006931 Bacteria 1174
182 Ga0097620_101281058 3300006931 Unclassified 808
183 Ga0075435_100160615 3300007076 Bacteria 1893
184 Ga0075435_100383708 3300007076 Bacteria 1207
185 Ga0105240_10001620 3300009093 Bacteria 38182
186 Ga0105240_10006110 3300009093 Bacteria 17764
187 Ga0105240_10006333 3300009093 Bacteria 17422
188 Ga0105240_10006426 3300009093 Bacteria 17277
189 Ga0105240_10007803 3300009093 Bacteria 15461
190 Ga0105240_10014714 3300009093 Bacteria 10672
191 Ga0105240_10095116 3300009093 Bacteria 3633
192 Ga0105240_11686033 3300009093 Bacteria 662
193 Ga0105240_12440338 3300009093 Bacteria 541
194 Ga0111539_10036972 3300009094 Bacteria 5900
195 Ga0111539_10045535 3300009094 Bacteria 5251
196 Ga0111539_10049852 3300009094 Bacteria 4990
197 Ga0111539_10057337 3300009094 Bacteria 4626
198 Ga0111539_11125732 3300009094 Bacteria 912
199 Ga0111539_13165711 3300009094 Bacteria 531
200 Ga0105245_10000274 3300009098 Bacteria 48955
201 Ga0105245_10009530 3300009098 Bacteria 8467
202 Ga0105245_10083880 3300009098 Unclassified 2918
203 Ga0105247_10001592 3300009101 Bacteria 16074
204 Ga0105247_10677957 3300009101 Bacteria 773
205 Ga0105247_11213089 3300009101 Bacteria 601
206 Ga0114129_10034866 3300009147 Bacteria 7109
207 Ga0114129_10154935 3300009147 Bacteria 3134
208 Ga0114129_10441059 3300009147 Bacteria 1709
209 Ga0114129_10890246 3300009147 Bacteria 1129
210 Ga0105243_12266686 3300009148 Bacteria 580
211 Ga0105243_12758120 3300009148 Bacteria 532
212 Ga0105241_10000150 3300009174 Bacteria 49793
213 Ga0105241_10002039 3300009174 Bacteria 15278
214 Ga0105241_10310876 3300009174 Bacteria 1356
215 Ga0105242_12439116 3300009176 Bacteria 571
216 Ga0105248_10019971 3300009177 Bacteria 7417
217 Ga0105248_10150676 3300009177 Bacteria 2624
218 Ga0105237_10020861 3300009545 Bacteria 6746
219 Ga0105237_10317668 3300009545 Bacteria 1561
220 Ga0105237_10929731 3300009545 Bacteria 877
221 Ga0105237_11046406 3300009545 Unclassified 823
222 Ga0105237_11403481 3300009545 Bacteria 705
223 Ga0105237_11929263 3300009545 Unclassified 599
224 Ga0105237_12370521 3300009545 Bacteria 541
225 Ga0105238_10000251 3300009551 Bacteria 59944
226 Ga0105238_10000626 3300009551 Bacteria 37164
227 Ga0105238_10003911 3300009551 Bacteria 14796
228 Ga0105238_10154354 3300009551 Bacteria 2271
229 Ga0105238_10228224 3300009551 Bacteria 1839
230 Ga0105238_10489767 3300009551 Unclassified 1229
231 Ga0105238_10494532 3300009551 Bacteria 1223
232 Ga0105249_10017760 3300009553 Bacteria 6319
233 Ga0105249_10850989 3300009553 Bacteria 977
234 Ga0105249_11033377 3300009553 Bacteria 891
235 Ga0105249_11459441 3300009553 Bacteria 756
236 Ga0105239_10000725 3300010375 Bacteria 46872
237 Ga0105239_10005068 3300010375 Bacteria 15560
238 Ga0105239_10045106 3300010375 Bacteria 4831
239 Ga0105239_10197665 3300010375 Bacteria 2252
240 Ga0105246_10001271 3300011119 Bacteria 14813
241 Ga0105246_11657276 3300011119 Bacteria 606
242 Ga0157370_10000128 3300013104 Bacteria 90605
243 Ga0157370_10560195 3300013104 Bacteria 1047
244 Ga0157370_10740003 3300013104 Bacteria 896
245 Ga0157370_11879530 3300013104 Bacteria 537
246 Ga0157370_12127384 3300013104 Bacteria 503
247 Ga0157369_10000175 3300013105 Bacteria 90148
248 Ga0157369_10000369 3300013105 Bacteria 59934
249 Ga0157369_10004534 3300013105 Bacteria 16345
250 Ga0157369_10007975 3300013105 Bacteria 12168
251 Ga0157369_10009288 3300013105 Bacteria 11248
252 Ga0157369_10337976 3300013105 Bacteria 1564
253 Ga0157369_10715925 3300013105 Unclassified 1030
254 Ga0157369_10807325 3300013105 Bacteria 964
255 Ga0157369_11266024 3300013105 Bacteria 752
256 Ga0157369_11372148 3300013105 Archaea 720
257 Ga0157374_10014614 3300013296 Bacteria 6871
258 Ga0157374_10124646 3300013296 Bacteria 2489
259 Ga0157378_10003951 3300013297 Bacteria 13100
260 Ga0157378_10005796 3300013297 Bacteria 10827
261 Ga0157378_10032477 3300013297 Bacteria 4612
262 Ga0157378_10066009 3300013297 Bacteria 3240
263 Ga0157378_10154126 3300013297 Bacteria 2143
264 Ga0157378_11509199 3300013297 Unclassified 717
265 Ga0163162_10189956 3300013306 Bacteria 2181
266 Ga0163162_10513298 3300013306 Bacteria 1328
267 Ga0157372_10000098 3300013307 Bacteria 90215
268 Ga0157372_10000659 3300013307 Bacteria 37935
269 Ga0157372_10036378 3300013307 Bacteria 5426
270 Ga0157372_10073287 3300013307 Bacteria 3860
271 Ga0157372_10695319 3300013307 Bacteria 1183
272 Ga0157372_11065445 3300013307 Bacteria 936
273 Ga0157372_11338167 3300013307 Bacteria 826
274 Ga0157372_11746263 3300013307 Bacteria 716
275 Ga0157375_10017534 3300013308 Bacteria 6465
276 Ga0157375_10602291 3300013308 Bacteria 1258
277 Ga0157375_10951427 3300013308 Bacteria 1001
278 Ga0157375_11097088 3300013308 Bacteria 931
279 Ga0157375_11529008 3300013308 Bacteria 788
280 Ga0157375_12618595 3300013308 Unclassified 603
281 Ga0163163_10000308 3300014325 Bacteria 48146
282 Ga0163163_11100083 3300014325 Unclassified 858
283 Ga0157380_11163865 3300014326 Bacteria 813
284 Ga0157380_11178741 3300014326 Bacteria 809
285 Ga0157380_12079418 3300014326 Bacteria 630
286 Ga0157377_10010640 3300014745 Bacteria 4559
287 Ga0157377_10737440 3300014745 Bacteria 719
288 Ga0157379_10107913 3300014968 Bacteria 2499
289 Ga0157376_10410269 3300014969 Bacteria 1312
290 Ga0197907_10572396 3300020069 Bacteria 631
291 Ga0206356_10296919 3300020070 Bacteria 662
292 Ga0206352_10254630 3300020078 Bacteria 1769
293 Ga0206354_10052765 3300020081 Bacteria 606
294 Ga0207656_10220552 3300025321 Bacteria 922
295 Ga0207710_10001603 3300025900 Bacteria 11070
296 Ga0207710_10366931 3300025900 Bacteria 735
297 Ga0207699_10001136 3300025906 Bacteria 12600
298 Ga0207705_10217026 3300025909 Bacteria 1452
299 Ga0207705_10374132 3300025909 Bacteria 1100
300 Ga0207654_10000180 3300025911 Bacteria 39043
301 Ga0207654_10000548 3300025911 Bacteria 21477
302 Ga0207654_10001207 3300025911 Bacteria 13830
303 Ga0207654_10136042 3300025911 Bacteria 1561
304 Ga0207654_10590601 3300025911 Unclassified 792
305 Ga0207695_10000047 3300025913 Bacteria 422459
306 Ga0207695_10000150 3300025913 Bacteria 207099
307 Ga0207695_10000162 3300025913 Bacteria 198155
308 Ga0207695_10001900 3300025913 Bacteria 32599
309 Ga0207695_10009043 3300025913 Bacteria 12380
310 Ga0207695_10125451 3300025913 Bacteria 2530
311 Ga0207695_10275581 3300025913 Bacteria 1577
312 Ga0207671_10000155 3300025914 Bacteria 106931
313 Ga0207671_10001417 3300025914 Bacteria 27842
314 Ga0207671_10191132 3300025914 Bacteria 1596
315 Ga0207671_10238251 3300025914 Bacteria 1429
316 Ga0207693_10000065 3300025915 Bacteria 91476
317 Ga0207663_10004470 3300025916 Bacteria 6956
318 Ga0207649_10001760 3300025920 Bacteria 12425
319 Ga0207649_10098958 3300025920 Bacteria 1926
320 Ga0207649_10173556 3300025920 Bacteria 1504
321 Ga0207649_10486240 3300025920 Unclassified 937
322 Ga0207652_11112179 3300025921 Unclassified 691
323 Ga0207694_10000142 3300025924 Bacteria 74189
324 Ga0207694_10000146 3300025924 Bacteria 72706
325 Ga0207694_10001885 3300025924 Bacteria 17384
326 Ga0207694_10009282 3300025924 Bacteria 7422
327 Ga0207694_11399037 3300025924 Unclassified 591
328 Ga0207687_10005869 3300025927 Bacteria 8120
329 Ga0207687_11095246 3300025927 Unclassified 684
330 Ga0207700_10887307 3300025928 Bacteria 798
331 Ga0207664_10044194 3300025929 Bacteria 3488
332 Ga0207664_11624562 3300025929 Unclassified 568
333 Ga0207644_10047216 3300025931 Bacteria 3071
334 Ga0207644_10064928 3300025931 Bacteria 2653
335 Ga0207665_10018887 3300025939 Bacteria 4530
336 Ga0207711_10035299 3300025941 Bacteria 4238
337 Ga0207711_10095993 3300025941 Bacteria 2616
338 Ga0207689_10025128 3300025942 Bacteria 4993
339 Ga0207689_10703481 3300025942 Bacteria 852
340 Ga0207679_10159169 3300025945 Bacteria 1847
341 Ga0207679_10335838 3300025945 Bacteria 1313
342 Ga0207667_10003680 3300025949 Bacteria 18901
343 Ga0207667_10020778 3300025949 Bacteria 7293
344 Ga0207667_10028534 3300025949 Bacteria 6061
345 Ga0207712_10051495 3300025961 Bacteria 2880
346 Ga0207640_10018350 3300025981 Bacteria 4110
347 Ga0207640_10391384 3300025981 Bacteria 1129
348 Ga0207658_10021723 3300025986 Bacteria 4459
349 Ga0207677_10000782 3300026023 Bacteria 18219
350 Ga0207703_10003901 3300026035 Bacteria 12382
351 Ga0207639_10000098 3300026041 Bacteria 73865
352 Ga0207678_10297511 3300026067 Bacteria 1387
353 Ga0207702_10003868 3300026078 Bacteria 13498
354 Ga0207702_10004419 3300026078 Bacteria 12499
355 Ga0207702_10104551 3300026078 Bacteria 2506
356 Ga0207641_10003181 3300026088 Bacteria 14697
357 Ga0207676_10005538 3300026095 Bacteria 8938
358 Ga0207676_10941002 3300026095 Bacteria 849
359 Ga0207676_11509892 3300026095 Unclassified 669
360 Ga0207674_10001977 3300026116 Bacteria 25960
361 Ga0207674_10003452 3300026116 Bacteria 19332
362 Ga0207674_10839456 3300026116 Bacteria 886
363 Ga0207675_100222696 3300026118 Bacteria 1818
364 Ga0207675_101189314 3300026118 Bacteria 783
365 Ga0207698_10000031 3300026142 Bacteria 113280
366 Ga0207698_10000241 3300026142 Bacteria 33787
367 Ga0207698_10134745 3300026142 Bacteria 2117
368 Ga0207698_10255710 3300026142 Bacteria 1606
369 Ga0207698_10902135 3300026142 Bacteria 891
370 Ga0207698_10905284 3300026142 Bacteria 889
371 Ga0209813_10192801 3300027866 Bacteria 751
372 Ga0207428_10081579 3300027907 Bacteria 2525
373 Ga0268266_10013494 3300028379 Bacteria 7033
374 Ga0268265_10901251 3300028380 Bacteria 868
375 Ga0268264_10002705 3300028381 Bacteria 15468
376 Ga0265319_1008416 3300028563 Bacteria 4521
377 Ga0265334_10171414 3300028573 Bacteria 760
378 Ga0265318_10000563 3300028577 Bacteria 26166
379 Ga0265338_10061471 3300028800 Bacteria 3292
380 Ga0265338_10230759 3300028800 Bacteria 1377
381 Ga0265330_10065382 3300031235 Bacteria 1579
382 Ga0265330_10067886 3300031235 Bacteria 1545
383 Ga0265330_10285832 3300031235 Unclassified 695
384 Ga0265332_10061018 3300031238 Bacteria 1612
385 Ga0265332_10116918 3300031238 Bacteria 1121
386 Ga0265328_10026108 3300031239 Unclassified 2198
387 Ga0265320_10000328 3300031240 Bacteria 38910
388 Ga0265320_10557485 3300031240 Unclassified 507
389 Ga0265325_10003694 3300031241 Bacteria 9902
390 Ga0265329_10000518 3300031242 Bacteria 19897
391 Ga0265340_10011233 3300031247 Bacteria 4768
392 Ga0265339_10002679 3300031249 Bacteria 12656
393 Ga0265339_10021726 3300031249 Bacteria 3727
394 Ga0265331_10000021 3300031250 Bacteria 242632
395 Ga0265327_10151398 3300031251 Bacteria 1077
396 Ga0265316_10000779 3300031344 Bacteria 35184
397 Ga0265316_10003604 3300031344 Bacteria 15612
398 Ga0265316_10077838 3300031344 Bacteria 2546
399 Ga0265313_10000730 3300031595 Bacteria 33796
400 Ga0265313_10025245 3300031595 Bacteria 3155
401 Ga0265314_10012056 3300031711 Bacteria 7086
402 Ga0265342_10000032 3300031712 Bacteria 150633
403 Ga0265342_10001096 3300031712 Bacteria 26037
404 Ga0265342_10457739 3300031712 Bacteria 654
405 Ga0307413_10785578 3300031824 Bacteria 799
406 Ga0307407_11205795 3300031903 Bacteria 591
407 Ga0307411_10356352 3300032005 Bacteria 1195
408 Ga0373956_0441635 3300035119 Bacteria 621
409 Ga0373927_0014954 3300035695 Bacteria 5135
410 Ga0373933_0896158 3300035724 Bacteria 584
411 Ga0373925_1286443 3300037068 Bacteria 600
412 Ga0436361_0552241 3300039447 Bacteria 1327
413 Ga0466963_1180336 3300044694 Bacteria 538
414 Ga0466970_0235832 3300044765 Bacteria 1023
415 Ga0466957_0178300 3300044842 Bacteria 1387
416 Ga0466959_0127456 3300045049 Unclassified 1806
417 Ga0466959_0247119 3300045049 Bacteria 1231
418 Ga0466959_0253329 3300045049 Unclassified 1214
419 Ga0466959_0571018 3300045049 Bacteria 762
420 Ga0451576_0481702 3300045051 Bacteria 1303
421 Ga0466958_0160229 3300045836 Bacteria 1421
422 Ga0466967_0003508 3300045976 Bacteria 10250
423 Ga0466967_0213697 3300045976 Bacteria 1830
424 Ga0495603_0793537 3300046455 Bacteria 540
425 Ga0495586_0726746 3300046535 Bacteria 573
426 Ga0495645_0571603 3300046543 Bacteria 698
427 Ga0495599_0128220 3300046678 Bacteria 1576
428 Ga0495658_0181181 3300046683 Bacteria 1307
429 Ga0496100_0046213 3300048903 Bacteria 2798
430 Ga0496101_0014201 3300048904 Bacteria 5350
431 Ga0496102_0144225 3300048905 Bacteria 2234
432 Ga0496104_0007687 3300048907 Bacteria 9543
433 Ga0496105_0087624 3300048908 Bacteria 2572
434 Ga0496107_0031116 3300048910 Bacteria 3806
435 Ga0496114_0009291 3300048917 Bacteria 7802
436 Ga0501031_0016623 3300049568 Bacteria 4777
437 Ga0501032_0211664 3300049569 Bacteria 1263
438 Ga0501033_0001552 3300049570 Bacteria 20297
439 Ga0501034_0011943 3300049571 Bacteria 8976
440 Ga0501034_0044404 3300049571 Bacteria 4495
441 Ga0501036_0003777 3300049572 Bacteria 12139
442 Ga0501037_0025670 3300049573 Bacteria 4352
443 Ga0501038_0021002 3300049574 Bacteria 5866
444 Ga0501039_0481511 3300049575 Unclassified 974
445 Ga0501042_0319686 3300049578 Bacteria 1121
446 Ga0501043_0030448 3300049579 Bacteria 4241
447 Ga0501046_0020894 3300049580 Bacteria 5406
448 Ga0501047_0135523 3300049581 Bacteria 2342
449 Ga0501048_0108405 3300049582 Bacteria 1960
450 Ga0501067_0023446 3300049583 Bacteria 3420
451 Ga0501068_0015278 3300049584 Bacteria 4406
452 Ga0501069_0295420 3300049585 Bacteria 949
453 Ga0501070_0002988 3300049586 Bacteria 14711
454 Ga0501070_0649599 3300049586 Bacteria 838
455 Ga0501074_0017824 3300049590 Bacteria 5160
456 Ga0501079_0201966 3300049741 Bacteria 1553
457 Ga0501080_0058394 3300049742 Bacteria 3591
458 Ga0501083_0014829 3300049744 Bacteria 5450
459 Ga0501035_0610944 3300049822 Bacteria 887
460 Ga0501044_0263693 3300049823 Bacteria 1660
461 Ga0501045_0176870 3300049824 Bacteria 1589
462 nmdc:mga00v17_67871_c1 3300050491 Bacteria 2204
463 nmdc:mga0k408_177803_c1 3300050493 Bacteria 1269
464 nmdc:mga06z11_166270_c1 3300050494 Bacteria 1264
465 nmdc:mga07m45_87946_c1 3300050496 Bacteria 1778
466 Ga0501084_0800820 3300054114 Bacteria 793
467 Ga0587093_109338 3300059478 Bacteria 507
468 Ga0587086_059289 3300059507 Bacteria 635
469 Ga0587088_139826 3300059508 Bacteria 577
470 Ga0587106_125862 3300059605 Bacteria 548
471 Ga0501082_0000448 3300060353 Bacteria 36479
472 Ga0501082_0042558 3300060353 Bacteria 3915
473 Ga0068869_100800299
474 JGI24034J26672_10002694
475 Ga0065707_10099766
476 Ga0070658_10000510
477 Ga0070658_10191226
478 Ga0070676_10514487
479 Ga0070683_100203880
480 Ga0070683_100339155
481 Ga0070690_100242299
482 Ga0070690_101166651
483 Ga0068869_100014654
484 Ga0070666_10984254
485 Ga0070680_100000189
486 Ga0070680_100056506
487 Ga0070682_100140820
488 Ga0070682_100265257
489 Ga0070682_101040813
490 Ga0068868_100000178
491 Ga0070660_100174837
492 Ga0070689_100031982
493 Ga0070689_101386453
494 Ga0070691_10227641
495 Ga0070691_10530635
496 Ga0070687_101315750
497 Ga0070661_100002573
498 Ga0070661_100027267
499 Ga0070661_100188093
500 Ga0070661_100697135
501 Ga0070661_100918530
502 Ga0070668_100196095
503 Ga0070668_100924177
504 Ga0070669_100981604
505 Ga0070669_101160920
506 Ga0070675_100041499
507 Ga0070675_100471467
508 Ga0070671_100001359
509 Ga0070671_100027814
510 Ga0070674_100523189
511 Ga0070688_100128573
512 Ga0070688_100359582
513 Ga0070667_100025250
514 Ga0070667_101387892
515 Ga0070709_10523010
516 Ga0070714_100420677
517 Ga0070714_100514111
518 Ga0070713_100001436
519 Ga0070713_100942945
520 Ga0070711_100006753
521 Ga0070705_100071844
522 Ga0070700_100549329
523 Ga0070694_100167912
524 Ga0070694_100621553
525 Ga0070694_100675973
526 Ga0070694_101593598
527 Ga0070708_100216288
528 Ga0070663_100351051
529 Ga0070678_100145026
530 Ga0070662_101318992
531 Ga0070681_10000937
532 Ga0070681_10274849
533 Ga0070681_10579654
534 Ga0070681_10999405
535 Ga0068867_101118104
536 Ga0070706_100415187
537 Ga0070707_100335337
538 Ga0070707_101174983
539 Ga0070698_100009744
540 Ga0070698_100105083
541 Ga0070698_100293378
542 Ga0070698_100630919
543 Ga0070699_101455072
544 Ga0070699_101793529
545 Ga0070679_100008583
546 Ga0070679_100220306
547 Ga0070679_100415489
548 Ga0070684_100008389
549 Ga0070684_100067730
550 Ga0070684_100099411
551 Ga0070684_100107399
552 Ga0070684_100180576
553 Ga0070697_100007718
554 Ga0070697_100045968
555 Ga0070697_100110767
556 Ga0070697_100430867
557 Ga0068853_100000048
558 Ga0068853_100340180
559 Ga0068853_100606064
560 Ga0068853_101200130
561 Ga0070672_100707937
562 Ga0070695_100006076
563 Ga0070695_101384644
564 Ga0070696_100851093
565 Ga0070696_101037698
566 Ga0070693_100798938
567 Ga0070665_100000225
568 Ga0070665_100022857
569 Ga0070665_100841517
570 Ga0070665_101109004
571 Ga0068855_100003334
572 Ga0068855_100013025
573 Ga0068855_100022704
574 Ga0068855_100663533
575 Ga0068855_100757348
576 Ga0070664_100137038
577 Ga0070664_101590269
578 Ga0068857_100015300
579 Ga0068857_100052095
580 Ga0068857_100161237
581 Ga0068857_100857696
582 Ga0068854_100039895
583 Ga0068854_100098439
584 Ga0068856_100001672
585 Ga0068856_100024476
586 Ga0068856_100049147
587 Ga0068856_100105400
588 Ga0068856_100202476
589 Ga0068856_100256138
590 Ga0070702_100299495
591 Ga0068852_100000076
592 Ga0068852_100000105
593 Ga0068852_100179738
594 Ga0068852_100503771
595 Ga0068852_101015400
596 Ga0068852_102302405
597 Ga0068859_100013866
598 Ga0068859_100055512
599 Ga0068859_100103018
600 Ga0068859_100620489
601 Ga0068864_100004282
602 Ga0068864_100347716
603 Ga0068864_101694478
604 Ga0068866_11122098
605 Ga0068861_100124569
606 Ga0068861_100267758
607 Ga0068861_102334398
608 Ga0068851_10027451
609 Ga0068851_10069932
610 Ga0068851_10096340
611 Ga0068851_11013098
612 Ga0068863_100016745
613 Ga0068863_100395463
614 Ga0068858_100001937
615 Ga0068858_100020173
616 Ga0068858_100478143
617 Ga0068860_100000881
618 Ga0068860_100037368
619 Ga0068862_100064479
620 Ga0068862_100295050
621 Ga0068862_101125094
622 Ga0068862_101718169
623 Ga0068862_102160495
624 Ga0070717_10004374
625 Ga0070717_10804803
626 Ga0075364_10035047
627 Ga0070715_10156335
628 Ga0070712_100001546
629 Ga0075367_10027442
630 Ga0075366_10066576
631 Ga0097621_100000984
632 Ga0097621_100113675
633 Ga0068871_100023304
634 Ga0068871_100026825
635 Ga0068871_100667720
636 Ga0068871_100791674
637 Ga0075428_100002950
638 Ga0075428_100237595
639 Ga0075428_102751321
640 Ga0075430_100166509
641 Ga0075431_101210681
642 Ga0075433_10144376
643 Ga0075433_10254073
644 Ga0075434_100334938
645 Ga0075434_101191117
646 Ga0075429_100043852
647 Ga0075429_100528541
648 Ga0075436_100009826
649 Ga0075436_100177670
650 Ga0097620_100013866
651 Ga0097620_100055512
652 Ga0097620_100103016
653 Ga0097620_100620508
654 Ga0097620_101281058
655 Ga0075435_100160615
656 Ga0075435_100383708
657 Ga0105240_10001620
658 Ga0105240_10006110
659 Ga0105240_10006333
660 Ga0105240_10006426
661 Ga0105240_10007803
662 Ga0105240_10014714
663 Ga0105240_10095116
664 Ga0105240_11686033
665 Ga0105240_12440338
666 Ga0111539_10036972
667 Ga0111539_10045535
668 Ga0111539_10049852
669 Ga0111539_10057337
670 Ga0111539_11125732
671 Ga0111539_13165711
672 Ga0105245_10000274
673 Ga0105245_10009530
674 Ga0105245_10083880
675 Ga0105247_10001592
676 Ga0105247_10677957
677 Ga0105247_11213089
678 Ga0114129_10034866
679 Ga0114129_10154935
680 Ga0114129_10441059
681 Ga0114129_10890246
682 Ga0105243_12266686
683 Ga0105243_12758120
684 Ga0105241_10000150
685 Ga0105241_10002039
686 Ga0105241_10310876
687 Ga0105242_12439116
688 Ga0105248_10019971
689 Ga0105248_10150676
690 Ga0105237_10020861
691 Ga0105237_10317668
692 Ga0105237_10929731
693 Ga0105237_11046406
694 Ga0105237_11403481
695 Ga0105237_11929263
696 Ga0105237_12370521
697 Ga0105238_10000251
698 Ga0105238_10000626
699 Ga0105238_10003911
700 Ga0105238_10154354
701 Ga0105238_10228224
702 Ga0105238_10489767
703 Ga0105238_10494532
704 Ga0105249_10017760
705 Ga0105249_10850989
706 Ga0105249_11033377
707 Ga0105249_11459441
708 Ga0105239_10000725
709 Ga0105239_10005068
710 Ga0105239_10045106
711 Ga0105239_10197665
712 Ga0105246_10001271
713 Ga0105246_11657276
714 Ga0157370_10000128
715 Ga0157370_10560195
716 Ga0157370_10740003
717 Ga0157370_11879530
718 Ga0157370_12127384
719 Ga0157369_10000175
720 Ga0157369_10000369
721 Ga0157369_10004534
722 Ga0157369_10007975
723 Ga0157369_10009288
724 Ga0157369_10337976
725 Ga0157369_10715925
726 Ga0157369_10807325
727 Ga0157369_11266024
728 Ga0157369_11372148
729 Ga0157374_10014614
730 Ga0157374_10124646
731 Ga0157378_10003951
732 Ga0157378_10005796
733 Ga0157378_10032477
734 Ga0157378_10066009
735 Ga0157378_10154126
736 Ga0157378_11509199
737 Ga0163162_10189956
738 Ga0163162_10513298
739 Ga0157372_10000098
740 Ga0157372_10000659
741 Ga0157372_10036378
742 Ga0157372_10073287
743 Ga0157372_10695319
744 Ga0157372_11065445
745 Ga0157372_11338167
746 Ga0157372_11746263
747 Ga0157375_10017534
748 Ga0157375_10602291
749 Ga0157375_10951427
750 Ga0157375_11097088
751 Ga0157375_11529008
752 Ga0157375_12618595
753 Ga0163163_10000308
754 Ga0163163_11100083
755 Ga0157380_11163865
756 Ga0157380_11178741
757 Ga0157380_12079418
758 Ga0157377_10010640
759 Ga0157377_10737440
760 Ga0157379_10107913
761 Ga0157376_10410269
762 Ga0197907_10572396
763 Ga0206356_10296919
764 Ga0206352_10254630
765 Ga0206354_10052765
766 Ga0207656_10220552
767 Ga0207710_10001603
768 Ga0207710_10366931
769 Ga0207699_10001136
770 Ga0207705_10217026
771 Ga0207705_10374132
772 Ga0207654_10000180
773 Ga0207654_10000548
774 Ga0207654_10001207
775 Ga0207654_10136042
776 Ga0207654_10590601
777 Ga0207695_10000047
778 Ga0207695_10000150
779 Ga0207695_10000162
780 Ga0207695_10001900
781 Ga0207695_10009043
782 Ga0207695_10125451
783 Ga0207695_10275581
784 Ga0207671_10000155
785 Ga0207671_10001417
786 Ga0207671_10191132
787 Ga0207671_10238251
788 Ga0207693_10000065
789 Ga0207663_10004470
790 Ga0207649_10001760
791 Ga0207649_10098958
792 Ga0207649_10173556
793 Ga0207649_10486240
794 Ga0207652_11112179
795 Ga0207694_10000142
796 Ga0207694_10000146
797 Ga0207694_10001885
798 Ga0207694_10009282
799 Ga0207694_11399037
800 Ga0207687_10005869
801 Ga0207687_11095246
802 Ga0207700_10887307
803 Ga0207664_10044194
804 Ga0207664_11624562
805 Ga0207644_10047216
806 Ga0207644_10064928
807 Ga0207665_10018887
808 Ga0207711_10035299
809 Ga0207711_10095993
810 Ga0207689_10025128
811 Ga0207689_10703481
812 Ga0207679_10159169
813 Ga0207679_10335838
814 Ga0207667_10003680
815 Ga0207667_10020778
816 Ga0207667_10028534
817 Ga0207712_10051495
818 Ga0207640_10018350
819 Ga0207640_10391384
820 Ga0207658_10021723
821 Ga0207677_10000782
822 Ga0207703_10003901
823 Ga0207639_10000098
824 Ga0207678_10297511
825 Ga0207702_10003868
826 Ga0207702_10004419
827 Ga0207702_10104551
828 Ga0207641_10003181
829 Ga0207676_10005538
830 Ga0207676_10941002
831 Ga0207676_11509892
832 Ga0207674_10001977
833 Ga0207674_10003452
834 Ga0207674_10839456
835 Ga0207675_100222696
836 Ga0207675_101189314
837 Ga0207698_10000031
838 Ga0207698_10000241
839 Ga0207698_10134745
840 Ga0207698_10255710
841 Ga0207698_10902135
842 Ga0207698_10905284
843 Ga0209813_10192801
844 Ga0207428_10081579
845 Ga0268266_10013494
846 Ga0268265_10901251
847 Ga0268264_10002705
848 Ga0265319_1008416
849 Ga0265334_10171414
850 Ga0265318_10000563
851 Ga0265338_10061471
852 Ga0265338_10230759
853 Ga0265330_10065382
854 Ga0265330_10067886
855 Ga0265330_10285832
856 Ga0265332_10061018
857 Ga0265332_10116918
858 Ga0265328_10026108
859 Ga0265320_10000328
860 Ga0265320_10557485
861 Ga0265325_10003694
862 Ga0265329_10000518
863 Ga0265340_10011233
864 Ga0265339_10002679
865 Ga0265339_10021726
866 Ga0265331_10000021
867 Ga0265327_10151398
868 Ga0265316_10000779
869 Ga0265316_10003604
870 Ga0265316_10077838
871 Ga0265313_10000730
872 Ga0265313_10025245
873 Ga0265314_10012056
874 Ga0265342_10000032
875 Ga0265342_10001096
876 Ga0265342_10457739
877 Ga0307413_10785578
878 Ga0307407_11205795
879 Ga0307411_10356352
880 Ga0373956_0441635
881 Ga0373927_0014954
882 Ga0373933_0896158
883 Ga0373925_1286443
884 Ga0436361_0552241
885 Ga0466963_1180336
886 Ga0466970_0235832
887 Ga0466957_0178300
888 Ga0466959_0127456
889 Ga0466959_0247119
890 Ga0466959_0253329
891 Ga0466959_0571018
892 Ga0451576_0481702
893 Ga0466958_0160229
894 Ga0466967_0003508
895 Ga0466967_0213697
896 Ga0495603_0793537
897 Ga0495586_0726746
898 Ga0495645_0571603
899 Ga0495599_0128220
900 Ga0495658_0181181
901 Ga0496100_0046213
902 Ga0496101_0014201
903 Ga0496102_0144225
904 Ga0496104_0007687
905 Ga0496105_0087624
906 Ga0496107_0031116
907 Ga0496114_0009291
908 Ga0501031_0016623
909 Ga0501032_0211664
910 Ga0501033_0001552
911 Ga0501034_0011943
912 Ga0501034_0044404
913 Ga0501036_0003777
914 Ga0501037_0025670
915 Ga0501038_0021002
916 Ga0501039_0481511
917 Ga0501042_0319686
918 Ga0501043_0030448
919 Ga0501046_0020894
920 Ga0501047_0135523
921 Ga0501048_0108405
922 Ga0501067_0023446
923 Ga0501068_0015278
924 Ga0501069_0295420
925 Ga0501070_0002988
926 Ga0501070_0649599
927 Ga0501074_0017824
928 Ga0501079_0201966
929 Ga0501080_0058394
930 Ga0501083_0014829
931 Ga0501035_0610944
932 Ga0501044_0263693
933 Ga0501045_0176870
934 nmdc:mga00v17_67871_c1
935 nmdc:mga0k408_177803_c1
936 nmdc:mga06z11_166270_c1
937 nmdc:mga07m45_87946_c1
938 Ga0501084_0800820
939 Ga0587093_109338
940 Ga0587086_059289
941 Ga0587088_139826
942 Ga0587106_125862
943 Ga0501082_0000448
944 Ga0501082_0042558

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8423 3 97
4hro-assembly1.cif.gz_A crystal structure of h. volcanii small archaeal modifier protein 1 0.8187 3 94
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8093 3 97
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.8016 1 94
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.7938 1 94
ID Description Score Start End Superfamily
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8187 3 94 3.10.20.30
af_Q54NM8_4_86_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.816 1 97 3.10.20.30
af_Q54NM8_4_86_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8076 1 97 3.10.20.30
5mpoA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7935 1 96 3.10.20.30
af_A0A0B4J391_26_106_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7905 3 97 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A535NE45-F1-model_v4 MoaD/ThiS family protein 1.003 1 46
AF-A0A517TT76-F1-model_v4 MoaD/ThiS family protein 0.9984 1 97
AF-A0A1F8SIJ2-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9957 1 93
AF-A0A7V6Z057-F1-model_v4 MoaD/ThiS family protein 0.9931 1 97
AF-A0A1G0SXB6-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.992 1 84

Map