F450709

General Info

Members Datasets Scaffolds Average Seq Length
472 326 944 261

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10000173|JGI25153J46596_1000017340
Length 249
Sequence MNRRTFSAGLAATRGVAAIPAPTKARNVVLVHGLFADGSCWSEVIARLQAAGLNATSVQNPLTTLPEAVASAQRVLDRQDGPTVLVGHSFSGMIVTEAGVHPNVSALVYVAARAPDAGEDYTALAKTFPAPPASAGIVYDGDEGRLSETAFLRDFAGDLPKEKARILFAVQQPFQKALLTGKTTHAAWRSKPSFYAVSMEDRTINPDLERFMAKRMGAKTIELKASHLSLISHPGEITQLILEAAGQRR

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
131 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
137 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
138 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
157 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
169 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
170 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
171 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
177 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
178 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
179 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
189 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
190 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
191 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
205 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
212 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
238 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
239 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
250 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
251 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
252 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
253 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
255 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
256 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
257 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
258 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
259 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
260 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
261 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
262 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
263 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
264 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
265 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
266 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
267 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
268 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
269 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
270 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
271 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
272 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
273 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
274 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
275 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
276 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
277 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
278 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
279 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
280 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
281 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
282 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
283 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
284 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
285 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
286 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
287 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
288 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
289 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
290 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
291 2519899620 Rhizobium sp. Pop5 Isolate Nodule
292 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
293 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
294 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
295 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
296 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
297 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
298 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
299 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
300 2791355260 Rhizobium sp. L9 Isolate Nodule
301 2791355261 Rhizobium sp. J15 Isolate Nodule
302 2791355265 Rhizobium sp. H4 Isolate Nodule
303 2791355266 Rhizobium sp. L43 Isolate Nodule
304 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
305 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
306 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
307 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
308 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
309 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
310 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
311 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
312 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
313 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
314 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
315 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
316 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
317 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
318 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
319 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
320 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
321 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
322 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
323 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
324 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
325 8056382006 Rhizobium croatiense 13T Isolate Nodule
326 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.83
Metatranscriptomes 0.64
Isolates 9.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.41
Nodule 7.84
Rhizoplane 2.33
Rhizosphere 70.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000173 3300003215 Bacteria 64195
2 JGI24740J21852_10011702 3300001979 Bacteria 3333
3 JGI24739J22299_10004115 3300001989 Bacteria 5563
4 JGI24739J22299_10016714 3300001989 Bacteria 2652
5 JGI24735J21928_10012812 3300002067 Bacteria 2648
6 JGI24738J21930_10002318 3300002075 Bacteria 5026
7 JGI25159J45721_1000338 3300002987 Bacteria 21677
8 JGI25151J46595_10000880 3300003187 Bacteria 23701
9 JGI25165J46597_1000046 3300003214 Bacteria 255996
10 rootL2_10280879 3300003322 Bacteria 1429
11 JGI25160J50197_1000012 3300003354 Bacteria 267582
12 JGI25161J50226_1000002 3300003374 Bacteria 420324
13 JGI25404J52841_10017390 3300003659 Bacteria 1559
14 Ga0055526_1008295 3300003771 Bacteria 5211
15 Ga0055528_1000269 3300003790 Bacteria 44061
16 Ga0055531_10008002 3300003794 Bacteria 5653
17 Ga0055543_1000011 3300004625 Bacteria 196089
18 Ga0065165_1000082 3300005262 Bacteria 158536
19 Ga0070658_10118316 3300005327 Bacteria 2200
20 Ga0070676_10030120 3300005328 Bacteria 3093
21 Ga0070670_100401024 3300005331 Bacteria 1211
22 Ga0070670_100802219 3300005331 Bacteria 850
23 Ga0070677_10175807 3300005333 Bacteria 1016
24 Ga0070666_10085119 3300005335 Bacteria 2165
25 Ga0070666_10266171 3300005335 Bacteria 1216
26 Ga0070661_100001191 3300005344 Bacteria 18351
27 Ga0070675_100291576 3300005354 Bacteria 1436
28 Ga0070671_100579021 3300005355 Bacteria 969
29 Ga0070659_100074822 3300005366 Bacteria 2699
30 Ga0070659_100333298 3300005366 Bacteria 1270
31 Ga0070667_100155176 3300005367 Bacteria 2013
32 Ga0070709_10001690 3300005434 Bacteria 11983
33 Ga0070709_10470755 3300005434 Bacteria 950
34 Ga0070714_100002040 3300005435 Bacteria 14795
35 Ga0070714_100037653 3300005435 Bacteria 4065
36 Ga0070713_100032335 3300005436 Bacteria 4177
37 Ga0070713_100203840 3300005436 Bacteria 1787
38 Ga0070710_10000650 3300005437 Bacteria 16572
39 Ga0070710_10012043 3300005437 Bacteria 4288
40 Ga0070710_10029437 3300005437 Bacteria 2947
41 Ga0070710_10031576 3300005437 Bacteria 2861
42 Ga0070710_10306766 3300005437 Bacteria 1037
43 Ga0070711_100004087 3300005439 Bacteria 8580
44 Ga0070711_100029903 3300005439 Bacteria 3600
45 Ga0070711_100039362 3300005439 Bacteria 3184
46 Ga0070711_100120714 3300005439 Bacteria 1938
47 Ga0070708_100114387 3300005445 Bacteria 2483
48 Ga0070663_100292563 3300005455 Bacteria 1301
49 Ga0070662_100058529 3300005457 Bacteria 2805
50 Ga0070706_100011716 3300005467 Bacteria 8137
51 Ga0070706_100334033 3300005467 Bacteria 1413
52 Ga0070707_100090821 3300005468 Bacteria 2956
53 Ga0070699_100000609 3300005518 Bacteria 33774
54 Ga0070697_100335696 3300005536 Bacteria 1304
55 Ga0068853_100136544 3300005539 Bacteria 2199
56 Ga0068853_100193371 3300005539 Bacteria 1849
57 Ga0070665_100000176 3300005548 Bacteria 113398
58 Ga0070665_100012745 3300005548 Bacteria 8469
59 Ga0070665_100060846 3300005548 Bacteria 3785
60 Ga0068855_100136097 3300005563 Bacteria 2803
61 Ga0068852_100113235 3300005616 Bacteria 2470
62 Ga0068859_100441762 3300005617 Bacteria 1397
63 Ga0068851_10035115 3300005834 Bacteria 2505
64 Ga0068858_100019108 3300005842 Bacteria 6410
65 Ga0081455_10033011 3300005937 Bacteria 4655
66 Ga0081538_10017106 3300005981 Bacteria 5521
67 Ga0081540_1002909 3300005983 Bacteria 13805
68 Ga0081540_1060887 3300005983 Bacteria 1803
69 Ga0081540_1077599 3300005983 Bacteria 1509
70 Ga0070717_10068367 3300006028 Bacteria 2957
71 Ga0070717_10102177 3300006028 Bacteria 2435
72 Ga0070715_10053998 3300006163 Bacteria 1738
73 Ga0070716_100003391 3300006173 Bacteria 7493
74 Ga0070712_100072387 3300006175 Bacteria 2469
75 Ga0070712_100082944 3300006175 Bacteria 2326
76 Ga0070712_100223259 3300006175 Bacteria 1492
77 Ga0070712_100329820 3300006175 Bacteria 1243
78 Ga0070712_100514899 3300006175 Bacteria 1004
79 Ga0075366_10148833 3300006195 Bacteria 1417
80 Ga0068871_100440232 3300006358 Bacteria 1167
81 Ga0075431_100563318 3300006847 Bacteria 1126
82 Ga0075433_10006651 3300006852 Bacteria 9154
83 Ga0075434_100050413 3300006871 Bacteria 4135
84 Ga0075434_100096672 3300006871 Bacteria 2958
85 Ga0075434_100382665 3300006871 Bacteria 1428
86 Ga0075434_100392609 3300006871 Bacteria 1408
87 Ga0075436_100001740 3300006914 Bacteria 14907
88 Ga0097620_100441779 3300006931 Bacteria 1397
89 Ga0075435_100024367 3300007076 Bacteria 4695
90 Ga0075435_100669217 3300007076 Bacteria 901
91 Ga0099794_10006414 3300007265 Bacteria 4762
92 Ga0099794_10046373 3300007265 Bacteria 2082
93 Ga0105240_10009696 3300009093 Bacteria 13600
94 Ga0105240_10040627 3300009093 Bacteria 5947
95 Ga0105240_10062680 3300009093 Bacteria 4628
96 Ga0105240_10165771 3300009093 Bacteria 2621
97 Ga0105240_10696361 3300009093 Bacteria 1109
98 Ga0105245_10056131 3300009098 Bacteria 3539
99 Ga0114129_10044972 3300009147 Bacteria 6209
100 Ga0114129_10207755 3300009147 Bacteria 2649
101 Ga0114129_10818027 3300009147 Bacteria 1187
102 Ga0105241_10026011 3300009174 Bacteria 4353
103 Ga0105241_10026773 3300009174 Bacteria 4292
104 Ga0105248_10020353 3300009177 Bacteria 7351
105 Ga0105248_10036415 3300009177 Bacteria 5503
106 Ga0105237_10034219 3300009545 Bacteria 5146
107 Ga0105237_10389005 3300009545 Bacteria 1399
108 Ga0105237_10389325 3300009545 Bacteria 1399
109 Ga0105249_10060708 3300009553 Bacteria 3469
110 Ga0105239_10003053 3300010375 Bacteria 20805
111 Ga0105239_10004670 3300010375 Bacteria 16282
112 Ga0105239_10252696 3300010375 Bacteria 1980
113 Ga0157373_10081786 3300013100 Bacteria 2277
114 Ga0157371_10000059 3300013102 Bacteria 170541
115 Ga0157371_10199033 3300013102 Bacteria 1436
116 Ga0157369_10023977 3300013105 Bacteria 6789
117 Ga0157378_10008187 3300013297 Bacteria 9119
118 Ga0163162_10060629 3300013306 Bacteria 3819
119 Ga0163162_10752372 3300013306 Bacteria 1094
120 Ga0157372_10390098 3300013307 Bacteria 1623
121 Ga0157375_10306167 3300013308 Bacteria 1753
122 Ga0157376_10304815 3300014969 Bacteria 1509
123 Ga0157376_10525005 3300014969 Bacteria 1168
124 Ga0213875_10000009 3300021388 Bacteria 451129
125 Ga0209233_1000013 3300025261 Bacteria 1013785
126 Ga0209455_1003116 3300025272 Bacteria 6038
127 Ga0209673_1000013 3300025273 Bacteria 571633
128 Ga0209673_1012168 3300025273 Bacteria 3489
129 Ga0209676_1027523 3300025292 Bacteria 1788
130 Ga0209025_1000957 3300025294 Bacteria 43532
131 Ga0209564_1000264 3300025295 Bacteria 111404
132 Ga0209758_1000001 3300025297 Bacteria 1981790
133 Ga0209758_1004780 3300025297 Bacteria 10959
134 Ga0209050_1002783 3300025298 Bacteria 14009
135 Ga0209256_1000937 3300025299 Bacteria 35428
136 Ga0209051_1017066 3300025303 Bacteria 3256
137 Ga0209257_1000328 3300025304 Bacteria 99542
138 Ga0207656_10006258 3300025321 Bacteria 4264
139 Ga0207692_10002847 3300025898 Bacteria 6687
140 Ga0207692_10012271 3300025898 Bacteria 3675
141 Ga0207680_10267912 3300025903 Bacteria 1184
142 Ga0207647_10003691 3300025904 Bacteria 11443
143 Ga0207647_10054916 3300025904 Bacteria 2449
144 Ga0207647_10067541 3300025904 Bacteria 2166
145 Ga0207685_10057356 3300025905 Bacteria 1527
146 Ga0207685_10080024 3300025905 Bacteria 1350
147 Ga0207685_10114066 3300025905 Bacteria 1176
148 Ga0207699_10001824 3300025906 Bacteria 10018
149 Ga0207699_10003052 3300025906 Bacteria 7948
150 Ga0207645_10019355 3300025907 Bacteria 4464
151 Ga0207705_10001581 3300025909 Bacteria 18087
152 Ga0207684_10078138 3300025910 Bacteria 2815
153 Ga0207695_10041470 3300025913 Bacteria 4927
154 Ga0207695_10080596 3300025913 Bacteria 3296
155 Ga0207695_10097429 3300025913 Bacteria 2942
156 Ga0207695_10376476 3300025913 Bacteria 1306
157 Ga0207671_10013057 3300025914 Bacteria 6640
158 Ga0207671_10198428 3300025914 Bacteria 1567
159 Ga0207671_10312945 3300025914 Bacteria 1241
160 Ga0207693_10030571 3300025915 Bacteria 4255
161 Ga0207693_10116282 3300025915 Bacteria 2100
162 Ga0207693_10162535 3300025915 Bacteria 1757
163 Ga0207663_10001572 3300025916 Bacteria 10720
164 Ga0207663_10011288 3300025916 Bacteria 4793
165 Ga0207663_10084719 3300025916 Bacteria 2085
166 Ga0207657_10071065 3300025919 Bacteria 2948
167 Ga0207649_10001119 3300025920 Bacteria 16255
168 Ga0207646_10052778 3300025922 Bacteria 3638
169 Ga0207646_10323382 3300025922 Bacteria 1394
170 Ga0207694_10041250 3300025924 Bacteria 3556
171 Ga0207700_10040499 3300025928 Bacteria 3402
172 Ga0207700_10216296 3300025928 Bacteria 1622
173 Ga0207700_10288308 3300025928 Bacteria 1414
174 Ga0207664_10015309 3300025929 Bacteria 5560
175 Ga0207664_10076368 3300025929 Bacteria 2711
176 Ga0207690_10014750 3300025932 Bacteria 4725
177 Ga0207690_10060068 3300025932 Bacteria 2578
178 Ga0207706_10013851 3300025933 Bacteria 7315
179 Ga0207706_10063967 3300025933 Bacteria 3239
180 Ga0207665_10001449 3300025939 Bacteria 15963
181 Ga0207711_10000002 3300025941 Bacteria 1228676
182 Ga0207711_10004765 3300025941 Bacteria 11515
183 Ga0207711_10236851 3300025941 Bacteria 1673
184 Ga0207667_10000002 3300025949 Bacteria 895662
185 Ga0207712_10060403 3300025961 Bacteria 2687
186 Ga0207712_10077047 3300025961 Bacteria 2415
187 Ga0207668_10134289 3300025972 Bacteria 1894
188 Ga0207668_10168709 3300025972 Bacteria 1714
189 Ga0207658_10031408 3300025986 Bacteria 3771
190 Ga0207703_10561211 3300026035 Bacteria 1077
191 Ga0207639_10005213 3300026041 Bacteria 8767
192 Ga0207639_10018363 3300026041 Bacteria 4969
193 Ga0207678_10029923 3300026067 Bacteria 4754
194 Ga0207702_10002218 3300026078 Bacteria 18612
195 Ga0207702_10563022 3300026078 Bacteria 1116
196 Ga0207674_10201038 3300026116 Bacteria 1942
197 Ga0207674_10447097 3300026116 Bacteria 1249
198 Ga0207683_10014585 3300026121 Bacteria 6692
199 Ga0207698_10061331 3300026142 Bacteria 2930
200 Ga0209179_1000728 3300027512 Bacteria 3565
201 Ga0209588_1005444 3300027671 Bacteria 3651
202 Ga0268266_10000005 3300028379 Bacteria 1448194
203 Ga0268266_10204238 3300028379 Bacteria 1809
204 Ga0268264_10045476 3300028381 Bacteria 3644
205 Ga0307515_10017559 3300028794 Bacteria 13018
206 Ga0307515_10357724 3300028794 Bacteria 1103
207 Ga0307511_10006547 3300030521 Bacteria 11728
208 Ga0265763_1000054 3300030763 Bacteria 4559
209 Ga0265760_10004754 3300031090 Bacteria 3892
210 Ga0265760_10006688 3300031090 Bacteria 3301
211 Ga0265339_10019275 3300031249 Bacteria 4009
212 Ga0307513_10011512 3300031456 Bacteria 10990
213 Ga0265314_10041448 3300031711 Bacteria 3295
214 Ga0265342_10049635 3300031712 Bacteria 2510
215 Ga0373926_0065233 3300035083 Bacteria 1331
216 Ga0373936_0007384 3300035113 Bacteria 4136
217 Ga0373945_0010540 3300035116 Bacteria 3046
218 Ga0373954_0024790 3300035118 Bacteria 2737
219 Ga0373943_0012321 3300035170 Bacteria 3847
220 Ga0373946_0054150 3300035171 Bacteria 1687
221 Ga0373955_0002234 3300035172 Bacteria 8406
222 Ga0373955_0124557 3300035172 Bacteria 1500
223 Ga0373924_0013304 3300035410 Bacteria 3090
224 Ga0373924_0017703 3300035410 Bacteria 2737
225 Ga0373935_0004556 3300035692 Bacteria 8149
226 Ga0373935_0040276 3300035692 Bacteria 2932
227 Ga0373927_0007834 3300035695 Bacteria 7223
228 Ga0373927_0052661 3300035695 Bacteria 2632
229 Ga0373933_0000861 3300035724 Bacteria 18623
230 Ga0373947_0017547 3300035725 Bacteria 4116
231 Ga0373947_0108022 3300035725 Bacteria 1755
232 Ga0373937_0002555 3300036401 Bacteria 15123
233 Ga0373937_0013919 3300036401 Bacteria 7093
234 Ga0373925_0003141 3300037068 Bacteria 12962
235 Ga0395900_0303856 3300037418 Bacteria 1581
236 Ga0395905_0444113 3300037471 Bacteria 1195
237 Ga0436364_0519440 3300037853 Bacteria 1618
238 Ga0436364_1345244 3300037853 Bacteria 104196
239 Ga0395901_0567488 3300038443 Bacteria 1148
240 Ga0436363_0837932 3300039450 Bacteria 1317
241 Ga0436362_0181900 3300039453 Bacteria 1128
242 Ga0451841_0262451 3300041498 Bacteria 2641
243 Ga0466958_0192724 3300045836 Bacteria 1296
244 Ga0495592_0008187 3300046454 Bacteria 7853
245 Ga0495592_0085572 3300046454 Bacteria 2273
246 Ga0495603_0000298 3300046455 Bacteria 26417
247 Ga0495590_0065677 3300046457 Bacteria 1270
248 Ga0495629_0000336 3300046459 Bacteria 40110
249 Ga0495629_0001678 3300046459 Bacteria 17382
250 Ga0495641_0001543 3300046461 Bacteria 19560
251 Ga0495651_0000610 3300046462 Bacteria 27759
252 Ga0495651_0148293 3300046462 Bacteria 1694
253 Ga0495653_0002770 3300046463 Bacteria 13982
254 Ga0495653_0300269 3300046463 Bacteria 1048
255 Ga0495580_0003367 3300046472 Bacteria 13663
256 Ga0495580_0028980 3300046472 Bacteria 4021
257 Ga0495582_0000134 3300046473 Bacteria 39810
258 Ga0495605_0042220 3300046474 Bacteria 2268
259 Ga0495662_0000247 3300046476 Bacteria 22850
260 Ga0495664_0003928 3300046477 Bacteria 8111
261 Ga0495584_0115053 3300046491 Bacteria 1361
262 Ga0495585_0079625 3300046492 Bacteria 1777
263 Ga0495583_0002273 3300046506 Bacteria 16846
264 Ga0495583_0011368 3300046506 Bacteria 5115
265 Ga0495583_0048034 3300046506 Bacteria 1960
266 Ga0495606_0000671 3300046507 Bacteria 53502
267 Ga0495608_0002503 3300046511 Bacteria 13175
268 Ga0495610_0050853 3300046512 Bacteria 2021
269 Ga0495616_0025551 3300046513 Bacteria 3154
270 Ga0495616_0058600 3300046513 Bacteria 1896
271 Ga0495618_0001234 3300046514 Bacteria 17321
272 Ga0495620_0022901 3300046515 Bacteria 2997
273 Ga0495620_0029355 3300046515 Bacteria 2546
274 Ga0495628_0008865 3300046516 Bacteria 8608
275 Ga0495628_0062880 3300046516 Bacteria 2909
276 Ga0495630_0004111 3300046517 Bacteria 10187
277 Ga0495631_0032064 3300046518 Bacteria 2370
278 Ga0495631_0143956 3300046518 Bacteria 1023
279 Ga0495632_0179861 3300046519 Bacteria 969
280 Ga0495643_0001063 3300046522 Bacteria 27418
281 Ga0495643_0011308 3300046522 Bacteria 5442
282 Ga0495643_0026099 3300046522 Bacteria 3300
283 Ga0495652_0002838 3300046529 Bacteria 17453
284 Ga0495652_0073176 3300046529 Bacteria 2855
285 Ga0495665_0041074 3300046531 Bacteria 2462
286 Ga0495640_0002140 3300046533 Bacteria 15784
287 Ga0495640_0020839 3300046533 Bacteria 4818
288 Ga0495586_0125809 3300046535 Bacteria 1433
289 Ga0495587_0017340 3300046536 Bacteria 4473
290 Ga0495587_0106359 3300046536 Bacteria 1614
291 Ga0495597_0001654 3300046542 Bacteria 15564
292 Ga0495622_0005344 3300046557 Bacteria 5961
293 Ga0495622_0005356 3300046557 Bacteria 5958
294 Ga0495622_0013637 3300046557 Bacteria 3769
295 Ga0495622_0067957 3300046557 Bacteria 1646
296 Ga0495633_0001255 3300046558 Bacteria 20213
297 Ga0495633_0240182 3300046558 Bacteria 827
298 Ga0495667_0012727 3300046559 Bacteria 5702
299 Ga0495667_0105741 3300046559 Bacteria 1819
300 Ga0495656_0261985 3300046615 Bacteria 876
301 Ga0495668_0020747 3300046616 Bacteria 3776
302 Ga0495634_0002604 3300046642 Bacteria 14839
303 Ga0495634_0017058 3300046642 Bacteria 5187
304 Ga0495611_0010548 3300046648 Bacteria 3909
305 Ga0495611_0086360 3300046648 Bacteria 1447
306 Ga0495625_0085465 3300046660 Bacteria 2190
307 Ga0495625_0153370 3300046660 Bacteria 1547
308 Ga0495635_0002744 3300046663 Bacteria 12072
309 Ga0495659_0007909 3300046664 Bacteria 3374
310 Ga0495657_0089524 3300046675 Bacteria 1977
311 Ga0495599_0123942 3300046678 Bacteria 1606
312 Ga0495623_0127797 3300046679 Bacteria 1525
313 Ga0495623_0225956 3300046679 Bacteria 1064
314 Ga0495646_0050147 3300046680 Bacteria 2531
315 Ga0495646_0060256 3300046680 Bacteria 2264
316 Ga0495647_0015881 3300046681 Bacteria 2643
317 Ga0495658_0001512 3300046683 Bacteria 12191
318 Ga0495658_0012829 3300046683 Bacteria 4256
319 Ga0495669_0000052 3300046684 Bacteria 79328
320 Ga0495613_0002024 3300046689 Bacteria 15396
321 Ga0495624_0002097 3300046690 Bacteria 15207
322 Ga0495624_0002427 3300046690 Bacteria 14153
323 Ga0495624_0309581 3300046690 Bacteria 952
324 Ga0495670_0014328 3300046691 Bacteria 3899
325 Ga0495670_0064230 3300046691 Bacteria 1849
326 Ga0495671_0123456 3300046692 Bacteria 1263
327 Ga0495649_0139610 3300046694 Bacteria 1276
328 Ga0495600_0017609 3300046809 Bacteria 4547
329 Ga0495600_0208152 3300046809 Bacteria 1254
330 Ga0495660_0057707 3300046810 Bacteria 2094
331 Ga0495581_0000072 3300047315 Bacteria 39847
332 Ga0495604_0000493 3300047317 Bacteria 34632
333 Ga0495604_0346527 3300047317 Bacteria 988
334 Ga0495674_0004841 3300047319 Bacteria 12948
335 Ga0495674_0016698 3300047319 Bacteria 6849
336 Ga0495672_0117259 3300047320 Bacteria 1420
337 Ga0495676_0023163 3300047321 Bacteria 5393
338 Ga0495680_0003657 3300047322 Bacteria 15016
339 Ga0495687_000649 3300047443 Bacteria 39837
340 Ga0495675_0000723 3300047444 Bacteria 20653
341 Ga0495677_0003420 3300047445 Bacteria 6163
342 Ga0495677_0055599 3300047445 Bacteria 1461
343 Ga0495684_0034782 3300047471 Bacteria 3866
344 Ga0495593_0000094 3300047673 Bacteria 39807
345 Ga0495602_0016821 3300048088 Bacteria 7341
346 Ga0495614_0044905 3300048089 Bacteria 1895
347 Ga0496101_0090573 3300048904 Bacteria 2275
348 Ga0496101_0281520 3300048904 Bacteria 1300
349 Ga0496104_0053046 3300048907 Bacteria 3830
350 Ga0496105_0150144 3300048908 Bacteria 1915
351 Ga0496107_0209539 3300048910 Bacteria 1449
352 Ga0496107_0270738 3300048910 Bacteria 1264
353 Ga0496111_0147067 3300048914 Bacteria 1747
354 Ga0496113_0008567 3300048916 Bacteria 6671
355 Ga0496114_0036118 3300048917 Bacteria 4084
356 Ga0496115_0038158 3300048918 Bacteria 3810
357 Ga0496115_0123019 3300048918 Bacteria 2136
358 Ga0496118_0004764 3300048921 Bacteria 15870
359 Ga0496121_0002155 3300048924 Bacteria 30799
360 Ga0496121_0082069 3300048924 Bacteria 2550
361 Ga0496122_0006643 3300048925 Bacteria 13186
362 Ga0496123_0000536 3300048926 Bacteria 65382
363 Ga0496126_0039071 3300048929 Bacteria 4407
364 Ga0496126_0105219 3300048929 Bacteria 2464
365 Ga0496126_0206147 3300048929 Bacteria 1657
366 Ga0495682_0038758 3300049460 Bacteria 1751
367 nmdc:mga05p37_39546_c1 3300050507 Bacteria 5791
368 nmdc:mga0qj67_235406_c1 3300050509 Bacteria 1486
369 nmdc:mga06r32_127266_c1 3300050510 Bacteria 2517
370 nmdc:mga0n895_32549_c1 3300050512 Bacteria 5006
371 nmdc:mga0n895_525141_c1 3300050512 Bacteria 1191
372 nmdc:mga0n895_65561_c1 3300050512 Bacteria 3595
373 nmdc:mga0n895_70215_c2 3300050512 Bacteria 2080
374 nmdc:mga0rr50_1191_c1 3300050513 Bacteria 14123
375 nmdc:mga0rr50_187473_c1 3300050513 Bacteria 1694
376 nmdc:mga0rr50_2619_c1 3300050513 Bacteria 10194
377 nmdc:mga0rr50_553995_c1 3300050513 Bacteria 979
378 nmdc:mga08x19_14088_c1 3300050514 Bacteria 4846
379 nmdc:mga0a205_1509_c1 3300050515 Bacteria 19870
380 Ga0495601_0009669 3300053077 Bacteria 5707
381 Ga0495612_0029804 3300053078 Bacteria 2198
382 Ga0500610_0000024 3300053079 Bacteria 57534
383 Ga0500610_0109315 3300053079 Bacteria 1423
384 Ga0500635_0000166 3300053080 Bacteria 35327
385 Ga0495595_0000390 3300053084 Bacteria 16671
386 Ga0495619_0004400 3300053085 Bacteria 8985
387 Ga0495619_0100121 3300053085 Bacteria 1972
388 Ga0500578_0000244 3300053086 Bacteria 67335
389 Ga0500578_0096065 3300053086 Bacteria 1879
390 Ga0500583_0066043 3300053092 Bacteria 1720
391 Ga0500583_0173080 3300053092 Bacteria 1075
392 Ga0500651_0066008 3300053093 Bacteria 2254
393 Ga0500566_0002240 3300053094 Bacteria 11424
394 Ga0500641_0000207 3300053096 Bacteria 22336
395 Ga0500554_007323 3300053102 Bacteria 2531
396 Ga0500555_020253 3300053103 Bacteria 1916
397 Ga0500556_0081813 3300053104 Bacteria 1222
398 Ga0500557_007325 3300053105 Bacteria 2569
399 Ga0500569_000262 3300053109 Bacteria 8277
400 Ga0500569_026784 3300053109 Bacteria 1583
401 Ga0500572_000850 3300053111 Bacteria 9516
402 Ga0500594_0002319 3300053118 Bacteria 4128
403 Ga0500595_001390 3300053119 Bacteria 12967
404 Ga0500595_005270 3300053119 Bacteria 5666
405 Ga0500607_054259 3300053121 Bacteria 2123
406 Ga0500608_001845 3300053122 Bacteria 7549
407 Ga0500658_0220559 3300053134 Bacteria 869
408 Ga0500559_0000364 3300053136 Bacteria 33560
409 Ga0500573_0000002 3300053140 Bacteria 407088
410 Ga0500603_007778 3300053150 Bacteria 2359
411 Ga0500616_0009310 3300053153 Bacteria 5983
412 Ga0500616_0114260 3300053153 Bacteria 1299
413 Ga0500627_0108357 3300053158 Bacteria 1250
414 Ga0500638_005186 3300053162 Bacteria 5151
415 Ga0500638_012382 3300053162 Bacteria 3820
416 Ga0500638_052960 3300053162 Bacteria 1959
417 Ga0500639_003843 3300053163 Bacteria 7601
418 Ga0500639_138760 3300053163 Bacteria 1140
419 Ga0500639_143004 3300053163 Bacteria 1115
420 Ga0500637_0000329 3300053178 Bacteria 17808
421 Ga0500637_0000483 3300053178 Bacteria 15404
422 Ga0500576_016699 3300053725 Bacteria 3332
423 Ga0500625_028567 3300053729 Bacteria 2647
424 Ga0500645_000002 3300053730 Bacteria 388892
425 Ga0500596_002165 3300053735 Bacteria 3899
426 Ga0500596_003558 3300053735 Bacteria 2942
427 Ga0500661_000725 3300055283 Bacteria 6164
428 2503204119 2503198000 Bacteria 6884444
429 2509151444 2508501128 Bacteria 8613869
430 2509152486 2508501128 Bacteria 8613869
431 2509153902 2508501128 Bacteria 8613869
432 2513629829 2513237093 Bacteria 7545552
433 2513708463 2513237103 Bacteria 7647401
434 2513923584 2513237146 Bacteria 7166346
435 2514018596 2513237162 Bacteria 7468464
436 2517095413 2517093000 Bacteria 7412387
437 2520382120 2519899620 Bacteria 6499161
438 2535516422 2534681796 Bacteria 7146037
439 2563064851 2562617112 Bacteria 10918404
440 2599415609 2599185170 Bacteria 7295545
441 2713482160 2711768613 Bacteria 11048459
442 2719664254 2718217997 Bacteria 6740740
443 2720490673 2718218199 Bacteria 6740745
444 2724108983 2721755823 Bacteria 6752556
445 2793312471 2791355259 Bacteria 7254731
446 2793325005 2791355260 Bacteria 6598818
447 2793331841 2791355261 Bacteria 6661293
448 2793354806 2791355265 Bacteria 6539969
449 2793360713 2791355266 Bacteria 7116587
450 2838029641 2838029111 Bacteria 6603031
451 2838035726 2838035591 Bacteria 7166484
452 2838661785 2838661181 Bacteria 7385261
453 2839994057 2839993093 Bacteria 5512535
454 2842114154 2842110456 Bacteria 7656360
455 2842208016 2842205361 Bacteria 6340321
456 2842217508 2842217011 Bacteria 7497767
457 2842281189 2842278818 Bacteria 6340002
458 2842468800 2842462802 Bacteria 6588055
459 2842475929 2842475841 Bacteria 6603183
460 2842503169 2842502639 Bacteria 6604161
461 2889309093 2889306138 Bacteria 6358934
462 2933021326 2933016740 Bacteria 6355406
463 2933590250 2933586486 Bacteria 7667493
464 3005712186 3005710791 Bacteria 7622528
465 639648790 639633055 Bacteria 7751309
466 8005377094 8005376324 Bacteria 6590079
467 8005435511 8005430974 Bacteria 6689030
468 8005545070 8005542996 Bacteria 7077758
469 8005565185 8005563573 Bacteria 7153261
470 8005620171 8005619151 Bacteria 7030230
471 8056382371 8056382006 Bacteria 6408074
472 8056686241 8056681323 Bacteria 8472857
473 JGI25153J46596_10000173
474 JGI24740J21852_10011702
475 JGI24739J22299_10004115
476 JGI24739J22299_10016714
477 JGI24735J21928_10012812
478 JGI24738J21930_10002318
479 JGI25159J45721_1000338
480 JGI25151J46595_10000880
481 JGI25165J46597_1000046
482 rootL2_10280879
483 JGI25160J50197_1000012
484 JGI25161J50226_1000002
485 JGI25404J52841_10017390
486 Ga0055526_1008295
487 Ga0055528_1000269
488 Ga0055531_10008002
489 Ga0055543_1000011
490 Ga0065165_1000082
491 Ga0070658_10118316
492 Ga0070676_10030120
493 Ga0070670_100401024
494 Ga0070670_100802219
495 Ga0070677_10175807
496 Ga0070666_10085119
497 Ga0070666_10266171
498 Ga0070661_100001191
499 Ga0070675_100291576
500 Ga0070671_100579021
501 Ga0070659_100074822
502 Ga0070659_100333298
503 Ga0070667_100155176
504 Ga0070709_10001690
505 Ga0070709_10470755
506 Ga0070714_100002040
507 Ga0070714_100037653
508 Ga0070713_100032335
509 Ga0070713_100203840
510 Ga0070710_10000650
511 Ga0070710_10012043
512 Ga0070710_10029437
513 Ga0070710_10031576
514 Ga0070710_10306766
515 Ga0070711_100004087
516 Ga0070711_100029903
517 Ga0070711_100039362
518 Ga0070711_100120714
519 Ga0070708_100114387
520 Ga0070663_100292563
521 Ga0070662_100058529
522 Ga0070706_100011716
523 Ga0070706_100334033
524 Ga0070707_100090821
525 Ga0070699_100000609
526 Ga0070697_100335696
527 Ga0068853_100136544
528 Ga0068853_100193371
529 Ga0070665_100000176
530 Ga0070665_100012745
531 Ga0070665_100060846
532 Ga0068855_100136097
533 Ga0068852_100113235
534 Ga0068859_100441762
535 Ga0068851_10035115
536 Ga0068858_100019108
537 Ga0081455_10033011
538 Ga0081538_10017106
539 Ga0081540_1002909
540 Ga0081540_1060887
541 Ga0081540_1077599
542 Ga0070717_10068367
543 Ga0070717_10102177
544 Ga0070715_10053998
545 Ga0070716_100003391
546 Ga0070712_100072387
547 Ga0070712_100082944
548 Ga0070712_100223259
549 Ga0070712_100329820
550 Ga0070712_100514899
551 Ga0075366_10148833
552 Ga0068871_100440232
553 Ga0075431_100563318
554 Ga0075433_10006651
555 Ga0075434_100050413
556 Ga0075434_100096672
557 Ga0075434_100382665
558 Ga0075434_100392609
559 Ga0075436_100001740
560 Ga0097620_100441779
561 Ga0075435_100024367
562 Ga0075435_100669217
563 Ga0099794_10006414
564 Ga0099794_10046373
565 Ga0105240_10009696
566 Ga0105240_10040627
567 Ga0105240_10062680
568 Ga0105240_10165771
569 Ga0105240_10696361
570 Ga0105245_10056131
571 Ga0114129_10044972
572 Ga0114129_10207755
573 Ga0114129_10818027
574 Ga0105241_10026011
575 Ga0105241_10026773
576 Ga0105248_10020353
577 Ga0105248_10036415
578 Ga0105237_10034219
579 Ga0105237_10389005
580 Ga0105237_10389325
581 Ga0105249_10060708
582 Ga0105239_10003053
583 Ga0105239_10004670
584 Ga0105239_10252696
585 Ga0157373_10081786
586 Ga0157371_10000059
587 Ga0157371_10199033
588 Ga0157369_10023977
589 Ga0157378_10008187
590 Ga0163162_10060629
591 Ga0163162_10752372
592 Ga0157372_10390098
593 Ga0157375_10306167
594 Ga0157376_10304815
595 Ga0157376_10525005
596 Ga0213875_10000009
597 Ga0209233_1000013
598 Ga0209455_1003116
599 Ga0209673_1000013
600 Ga0209673_1012168
601 Ga0209676_1027523
602 Ga0209025_1000957
603 Ga0209564_1000264
604 Ga0209758_1000001
605 Ga0209758_1004780
606 Ga0209050_1002783
607 Ga0209256_1000937
608 Ga0209051_1017066
609 Ga0209257_1000328
610 Ga0207656_10006258
611 Ga0207692_10002847
612 Ga0207692_10012271
613 Ga0207680_10267912
614 Ga0207647_10003691
615 Ga0207647_10054916
616 Ga0207647_10067541
617 Ga0207685_10057356
618 Ga0207685_10080024
619 Ga0207685_10114066
620 Ga0207699_10001824
621 Ga0207699_10003052
622 Ga0207645_10019355
623 Ga0207705_10001581
624 Ga0207684_10078138
625 Ga0207695_10041470
626 Ga0207695_10080596
627 Ga0207695_10097429
628 Ga0207695_10376476
629 Ga0207671_10013057
630 Ga0207671_10198428
631 Ga0207671_10312945
632 Ga0207693_10030571
633 Ga0207693_10116282
634 Ga0207693_10162535
635 Ga0207663_10001572
636 Ga0207663_10011288
637 Ga0207663_10084719
638 Ga0207657_10071065
639 Ga0207649_10001119
640 Ga0207646_10052778
641 Ga0207646_10323382
642 Ga0207694_10041250
643 Ga0207700_10040499
644 Ga0207700_10216296
645 Ga0207700_10288308
646 Ga0207664_10015309
647 Ga0207664_10076368
648 Ga0207690_10014750
649 Ga0207690_10060068
650 Ga0207706_10013851
651 Ga0207706_10063967
652 Ga0207665_10001449
653 Ga0207711_10000002
654 Ga0207711_10004765
655 Ga0207711_10236851
656 Ga0207667_10000002
657 Ga0207712_10060403
658 Ga0207712_10077047
659 Ga0207668_10134289
660 Ga0207668_10168709
661 Ga0207658_10031408
662 Ga0207703_10561211
663 Ga0207639_10005213
664 Ga0207639_10018363
665 Ga0207678_10029923
666 Ga0207702_10002218
667 Ga0207702_10563022
668 Ga0207674_10201038
669 Ga0207674_10447097
670 Ga0207683_10014585
671 Ga0207698_10061331
672 Ga0209179_1000728
673 Ga0209588_1005444
674 Ga0268266_10000005
675 Ga0268266_10204238
676 Ga0268264_10045476
677 Ga0307515_10017559
678 Ga0307515_10357724
679 Ga0307511_10006547
680 Ga0265763_1000054
681 Ga0265760_10004754
682 Ga0265760_10006688
683 Ga0265339_10019275
684 Ga0307513_10011512
685 Ga0265314_10041448
686 Ga0265342_10049635
687 Ga0373926_0065233
688 Ga0373936_0007384
689 Ga0373945_0010540
690 Ga0373954_0024790
691 Ga0373943_0012321
692 Ga0373946_0054150
693 Ga0373955_0002234
694 Ga0373955_0124557
695 Ga0373924_0013304
696 Ga0373924_0017703
697 Ga0373935_0004556
698 Ga0373935_0040276
699 Ga0373927_0007834
700 Ga0373927_0052661
701 Ga0373933_0000861
702 Ga0373947_0017547
703 Ga0373947_0108022
704 Ga0373937_0002555
705 Ga0373937_0013919
706 Ga0373925_0003141
707 Ga0395900_0303856
708 Ga0395905_0444113
709 Ga0436364_0519440
710 Ga0436364_1345244
711 Ga0395901_0567488
712 Ga0436363_0837932
713 Ga0436362_0181900
714 Ga0451841_0262451
715 Ga0466958_0192724
716 Ga0495592_0008187
717 Ga0495592_0085572
718 Ga0495603_0000298
719 Ga0495590_0065677
720 Ga0495629_0000336
721 Ga0495629_0001678
722 Ga0495641_0001543
723 Ga0495651_0000610
724 Ga0495651_0148293
725 Ga0495653_0002770
726 Ga0495653_0300269
727 Ga0495580_0003367
728 Ga0495580_0028980
729 Ga0495582_0000134
730 Ga0495605_0042220
731 Ga0495662_0000247
732 Ga0495664_0003928
733 Ga0495584_0115053
734 Ga0495585_0079625
735 Ga0495583_0002273
736 Ga0495583_0011368
737 Ga0495583_0048034
738 Ga0495606_0000671
739 Ga0495608_0002503
740 Ga0495610_0050853
741 Ga0495616_0025551
742 Ga0495616_0058600
743 Ga0495618_0001234
744 Ga0495620_0022901
745 Ga0495620_0029355
746 Ga0495628_0008865
747 Ga0495628_0062880
748 Ga0495630_0004111
749 Ga0495631_0032064
750 Ga0495631_0143956
751 Ga0495632_0179861
752 Ga0495643_0001063
753 Ga0495643_0011308
754 Ga0495643_0026099
755 Ga0495652_0002838
756 Ga0495652_0073176
757 Ga0495665_0041074
758 Ga0495640_0002140
759 Ga0495640_0020839
760 Ga0495586_0125809
761 Ga0495587_0017340
762 Ga0495587_0106359
763 Ga0495597_0001654
764 Ga0495622_0005344
765 Ga0495622_0005356
766 Ga0495622_0013637
767 Ga0495622_0067957
768 Ga0495633_0001255
769 Ga0495633_0240182
770 Ga0495667_0012727
771 Ga0495667_0105741
772 Ga0495656_0261985
773 Ga0495668_0020747
774 Ga0495634_0002604
775 Ga0495634_0017058
776 Ga0495611_0010548
777 Ga0495611_0086360
778 Ga0495625_0085465
779 Ga0495625_0153370
780 Ga0495635_0002744
781 Ga0495659_0007909
782 Ga0495657_0089524
783 Ga0495599_0123942
784 Ga0495623_0127797
785 Ga0495623_0225956
786 Ga0495646_0050147
787 Ga0495646_0060256
788 Ga0495647_0015881
789 Ga0495658_0001512
790 Ga0495658_0012829
791 Ga0495669_0000052
792 Ga0495613_0002024
793 Ga0495624_0002097
794 Ga0495624_0002427
795 Ga0495624_0309581
796 Ga0495670_0014328
797 Ga0495670_0064230
798 Ga0495671_0123456
799 Ga0495649_0139610
800 Ga0495600_0017609
801 Ga0495600_0208152
802 Ga0495660_0057707
803 Ga0495581_0000072
804 Ga0495604_0000493
805 Ga0495604_0346527
806 Ga0495674_0004841
807 Ga0495674_0016698
808 Ga0495672_0117259
809 Ga0495676_0023163
810 Ga0495680_0003657
811 Ga0495687_000649
812 Ga0495675_0000723
813 Ga0495677_0003420
814 Ga0495677_0055599
815 Ga0495684_0034782
816 Ga0495593_0000094
817 Ga0495602_0016821
818 Ga0495614_0044905
819 Ga0496101_0090573
820 Ga0496101_0281520
821 Ga0496104_0053046
822 Ga0496105_0150144
823 Ga0496107_0209539
824 Ga0496107_0270738
825 Ga0496111_0147067
826 Ga0496113_0008567
827 Ga0496114_0036118
828 Ga0496115_0038158
829 Ga0496115_0123019
830 Ga0496118_0004764
831 Ga0496121_0002155
832 Ga0496121_0082069
833 Ga0496122_0006643
834 Ga0496123_0000536
835 Ga0496126_0039071
836 Ga0496126_0105219
837 Ga0496126_0206147
838 Ga0495682_0038758
839 nmdc:mga05p37_39546_c1
840 nmdc:mga0qj67_235406_c1
841 nmdc:mga06r32_127266_c1
842 nmdc:mga0n895_32549_c1
843 nmdc:mga0n895_525141_c1
844 nmdc:mga0n895_65561_c1
845 nmdc:mga0n895_70215_c2
846 nmdc:mga0rr50_1191_c1
847 nmdc:mga0rr50_187473_c1
848 nmdc:mga0rr50_2619_c1
849 nmdc:mga0rr50_553995_c1
850 nmdc:mga08x19_14088_c1
851 nmdc:mga0a205_1509_c1
852 Ga0495601_0009669
853 Ga0495612_0029804
854 Ga0500610_0000024
855 Ga0500610_0109315
856 Ga0500635_0000166
857 Ga0495595_0000390
858 Ga0495619_0004400
859 Ga0495619_0100121
860 Ga0500578_0000244
861 Ga0500578_0096065
862 Ga0500583_0066043
863 Ga0500583_0173080
864 Ga0500651_0066008
865 Ga0500566_0002240
866 Ga0500641_0000207
867 Ga0500554_007323
868 Ga0500555_020253
869 Ga0500556_0081813
870 Ga0500557_007325
871 Ga0500569_000262
872 Ga0500569_026784
873 Ga0500572_000850
874 Ga0500594_0002319
875 Ga0500595_001390
876 Ga0500595_005270
877 Ga0500607_054259
878 Ga0500608_001845
879 Ga0500658_0220559
880 Ga0500559_0000364
881 Ga0500573_0000002
882 Ga0500603_007778
883 Ga0500616_0009310
884 Ga0500616_0114260
885 Ga0500627_0108357
886 Ga0500638_005186
887 Ga0500638_012382
888 Ga0500638_052960
889 Ga0500639_003843
890 Ga0500639_138760
891 Ga0500639_143004
892 Ga0500637_0000329
893 Ga0500637_0000483
894 Ga0500576_016699
895 Ga0500625_028567
896 Ga0500645_000002
897 Ga0500596_002165
898 Ga0500596_003558
899 Ga0500661_000725
900 2503204119
901 2509151444
902 2509152486
903 2509153902
904 2513629829
905 2513708463
906 2513923584
907 2514018596
908 2517095413
909 2520382120
910 2535516422
911 2563064851
912 2599415609
913 2713482160
914 2719664254
915 2720490673
916 2724108983
917 2793312471
918 2793325005
919 2793331841
920 2793354806
921 2793360713
922 2838029641
923 2838035726
924 2838661785
925 2839994057
926 2842114154
927 2842208016
928 2842217508
929 2842281189
930 2842468800
931 2842475929
932 2842503169
933 2889309093
934 2933021326
935 2933590250
936 3005712186
937 639648790
938 8005377094
939 8005435511
940 8005545070
941 8005565185
942 8005620171
943 8056382371
944 8056686241

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

28

240

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hfw-assembly1.cif.gz_B the crystal structure of alpha/beta fold hydrolase 0.8855 37 255
8hfw-assembly2.cif.gz_C-2 the crystal structure of alpha/beta fold hydrolase 0.8722 37 255
1xkl-assembly1.cif.gz_D crystal structure of salicylic acid-binding protein 2 (sabp2) from nicotiana tabacum, nesg target ar2241 0.8719 35 256
8hfw-assembly1.cif.gz_A the crystal structure of alpha/beta fold hydrolase 0.8718 37 255
2wfm-assembly1.cif.gz_A crystal structure of polyneuridine aldehyde esterase mutant (h244a) 0.871 35 252
ID Description Score Start End Superfamily
af_Q54QE7_5_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9624 36 255 3.40.50.1820
af_Q54QE7_5_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9215 36 255 3.40.50.1820
af_F4JRA6_1_133_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9016 35 128 3.40.50.1820
af_F4IMK2_5_263_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8643 35 256 3.40.50.1820
1dwoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8633 35 254 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2X3L1U9-F1-model_v4 Predicted esterase of the alpha/beta hydrolase fold 0.9965 35 122 GO:0016787
AF-A0A829XW30-F1-model_v4 deleted 0.9952 33 255
AF-A0A1B5EVM5-F1-model_v4 deleted 0.9884 94 256
AF-A0A7X2RQG8-F1-model_v4 Alpha/beta fold hydrolase 0.9864 35 257 GO:0016787
AF-A0A4R3GY07-F1-model_v4 Alpha/beta hydrolase family protein 0.9845 65 260 GO:0016787

Map