F450631

General Info

Members Datasets Scaffolds Average Seq Length
471 187 470 315

Family's Representative Sequence

Representative Sequence 3300035691|Ga0373931_0000955|Ga0373931_0000955_6109_7149
Length 346
Sequence VGDPNGDLRFSHPRDPPDAVRPATEAQEVIDVHWLYVFAGAVFASFAVGSARNKANPKRWGNAAFWALVAVSFWLGDILGDIGNGVLVLALVALAGAQLLGRSAGHSTTDEERQRFSERFGNKLFLPALIIPFIAFVGTLLFTYTPLKDIGLIEPKSVTLVLLGLGVIVALVTCYMWLRSPALAGVDEGSRLADSIGWALVLPQMLASLGAVFAAAGVGDTIGAIAANIIPHGSIFLAVLLYGLGMVIFTMIMGNAFAAFPVMVTAIGVPILIHQDGGNPAVIGAVGMLTGFCGTLMTPMAANFNIVPAALLELKNQYGVIKMQVPTAIPLLIANLLILYVAGFHL

Samples

Sample ID Description Type Environment
1 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
178 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
181 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
186 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
187 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0
Rhizoplane 5.31
Rhizosphere 92.78
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1009066 3300001915 Bacteria 1845
2 JGI24739J22299_10002532 3300001989 Bacteria 7043
3 JGI24737J22298_10000339 3300001990 Bacteria 15701
4 JGI24737J22298_10001578 3300001990 Bacteria 8107
5 JGI24737J22298_10008391 3300001990 Bacteria 3460
6 JGI24735J21928_10028092 3300002067 Bacteria 1681
7 JGI24738J21930_10000740 3300002075 Bacteria 9386
8 Ga0065712_10088294 3300005290 Bacteria 2528
9 Ga0070658_10000477 3300005327 Bacteria 34731
10 Ga0070658_10008847 3300005327 Bacteria 8095
11 Ga0070658_10015309 3300005327 Bacteria 6138
12 Ga0070658_10032042 3300005327 Bacteria 4226
13 Ga0070658_10134570 3300005327 Bacteria 2061
14 Ga0070676_10025519 3300005328 Bacteria 3341
15 Ga0070683_100000747 3300005329 Bacteria 23810
16 Ga0070683_100062540 3300005329 Bacteria 3462
17 Ga0070670_100009359 3300005331 Bacteria 8361
18 Ga0070670_100027841 3300005331 Bacteria 4863
19 Ga0070670_100083704 3300005331 Bacteria 2741
20 Ga0070677_10066081 3300005333 Bacteria 1507
21 Ga0068869_100208253 3300005334 Bacteria 1545
22 Ga0068869_100340377 3300005334 Bacteria 1220
23 Ga0070666_10002691 3300005335 Bacteria 10721
24 Ga0070666_10013304 3300005335 Bacteria 5218
25 Ga0070666_10061765 3300005335 Bacteria 2537
26 Ga0070666_10105589 3300005335 Bacteria 1945
27 Ga0070680_100000244 3300005336 Bacteria 35934
28 Ga0070680_100004079 3300005336 Bacteria 10941
29 Ga0070680_100006274 3300005336 Bacteria 9022
30 Ga0070680_100042822 3300005336 Bacteria 3675
31 Ga0070680_100098935 3300005336 Bacteria 2420
32 Ga0070682_100025238 3300005337 Bacteria 3545
33 Ga0068868_100051721 3300005338 Bacteria 3233
34 Ga0068868_100253223 3300005338 Bacteria 1482
35 Ga0070660_100000425 3300005339 Bacteria 27941
36 Ga0070660_100061417 3300005339 Bacteria 2918
37 Ga0070660_100061697 3300005339 Bacteria 2911
38 Ga0070660_100104177 3300005339 Bacteria 2250
39 Ga0070660_100150412 3300005339 Bacteria 1871
40 Ga0070661_100000552 3300005344 Bacteria 28745
41 Ga0070661_100011526 3300005344 Bacteria 6158
42 Ga0070661_100154939 3300005344 Bacteria 1733
43 Ga0070661_100208971 3300005344 Bacteria 1493
44 Ga0070661_100229285 3300005344 Bacteria 1427
45 Ga0070692_10019687 3300005345 Bacteria 3261
46 Ga0070692_10075217 3300005345 Bacteria 1808
47 Ga0070669_100031871 3300005353 Bacteria 3808
48 Ga0070669_100215857 3300005353 Bacteria 1515
49 Ga0070675_100013308 3300005354 Bacteria 6464
50 Ga0070675_100329346 3300005354 Bacteria 1350
51 Ga0070671_100000133 3300005355 Bacteria 47555
52 Ga0070671_100012922 3300005355 Bacteria 6728
53 Ga0070671_100019260 3300005355 Bacteria 5553
54 Ga0070671_100029009 3300005355 Bacteria 4561
55 Ga0070671_100112375 3300005355 Bacteria 2288
56 Ga0070671_100128945 3300005355 Bacteria 2130
57 Ga0070674_100013663 3300005356 Bacteria 5025
58 Ga0070674_100090347 3300005356 Bacteria 2209
59 Ga0070674_100283633 3300005356 Bacteria 1314
60 Ga0070673_100004722 3300005364 Bacteria 8652
61 Ga0070673_100012282 3300005364 Bacteria 5876
62 Ga0070673_100150074 3300005364 Bacteria 1973
63 Ga0070673_100154640 3300005364 Bacteria 1945
64 Ga0070673_100162764 3300005364 Bacteria 1899
65 Ga0070673_100401271 3300005364 Bacteria 1226
66 Ga0070659_100000065 3300005366 Bacteria 82919
67 Ga0070659_100009817 3300005366 Bacteria 7037
68 Ga0070659_100117126 3300005366 Bacteria 2154
69 Ga0070659_100144412 3300005366 Bacteria 1938
70 Ga0070667_100006194 3300005367 Bacteria 9950
71 Ga0070667_100533044 3300005367 Bacteria 1078
72 Ga0070714_100082542 3300005435 Bacteria 2800
73 Ga0070694_100054187 3300005444 Bacteria 2716
74 Ga0070663_100031028 3300005455 Bacteria 3669
75 Ga0070663_100037599 3300005455 Bacteria 3371
76 Ga0070663_100062477 3300005455 Bacteria 2685
77 Ga0070678_100024098 3300005456 Bacteria 4067
78 Ga0070678_100032049 3300005456 Bacteria 3633
79 Ga0070678_100098454 3300005456 Bacteria 2261
80 Ga0070662_100000010 3300005457 Bacteria 142717
81 Ga0070662_100006303 3300005457 Bacteria 7644
82 Ga0070662_100028421 3300005457 Bacteria 3891
83 Ga0070662_100188330 3300005457 Bacteria 1630
84 Ga0070681_10007118 3300005458 Bacteria 10896
85 Ga0070679_100067409 3300005530 Bacteria 3569
86 Ga0070684_100120672 3300005535 Bacteria 2358
87 Ga0068853_100000067 3300005539 Bacteria 73891
88 Ga0068853_100020004 3300005539 Bacteria 5562
89 Ga0068853_100030077 3300005539 Bacteria 4585
90 Ga0068853_100220866 3300005539 Bacteria 1730
91 Ga0070672_100028917 3300005543 Bacteria 4150
92 Ga0070672_100166200 3300005543 Bacteria 1833
93 Ga0070672_100244158 3300005543 Bacteria 1511
94 Ga0070693_100036742 3300005547 Bacteria 2726
95 Ga0070693_100077622 3300005547 Bacteria 1971
96 Ga0070665_100036042 3300005548 Bacteria 4977
97 Ga0070665_100052886 3300005548 Bacteria 4073
98 Ga0070665_100054021 3300005548 Bacteria 4029
99 Ga0070665_100165669 3300005548 Bacteria 2212
100 Ga0068855_100014637 3300005563 Bacteria 9447
101 Ga0068855_100066565 3300005563 Bacteria 4200
102 Ga0068855_100301704 3300005563 Bacteria 1773
103 Ga0070664_100000228 3300005564 Bacteria 40132
104 Ga0070664_100003480 3300005564 Bacteria 12710
105 Ga0070664_100017146 3300005564 Bacteria 5945
106 Ga0070664_100029951 3300005564 Bacteria 4538
107 Ga0070664_100061124 3300005564 Bacteria 3210
108 Ga0070664_100145275 3300005564 Bacteria 2091
109 Ga0068857_100039511 3300005577 Bacteria 4180
110 Ga0068857_100060844 3300005577 Bacteria 3354
111 Ga0068857_100200302 3300005577 Bacteria 1820
112 Ga0068854_100004225 3300005578 Bacteria 9040
113 Ga0068854_100055520 3300005578 Bacteria 2851
114 Ga0068854_100061254 3300005578 Bacteria 2725
115 Ga0068854_100172923 3300005578 Bacteria 1682
116 Ga0068856_100000101 3300005614 Bacteria 82391
117 Ga0068856_100005840 3300005614 Bacteria 12131
118 Ga0068856_100025809 3300005614 Bacteria 5729
119 Ga0068852_100014908 3300005616 Bacteria 6007
120 Ga0068852_100019281 3300005616 Bacteria 5394
121 Ga0068852_100128915 3300005616 Bacteria 2327
122 Ga0068852_100150035 3300005616 Bacteria 2167
123 Ga0068852_100176146 3300005616 Bacteria 2008
124 Ga0068852_100224083 3300005616 Bacteria 1789
125 Ga0068852_100454160 3300005616 Bacteria 1269
126 Ga0068859_100064476 3300005617 Bacteria 3696
127 Ga0068859_100090370 3300005617 Bacteria 3113
128 Ga0068859_100174219 3300005617 Bacteria 2233
129 Ga0068864_100001115 3300005618 Bacteria 22458
130 Ga0068864_100002833 3300005618 Bacteria 14316
131 Ga0068864_100017032 3300005618 Bacteria 6057
132 Ga0068864_100088628 3300005618 Bacteria 2726
133 Ga0068851_10009336 3300005834 Bacteria 4556
134 Ga0068863_100013196 3300005841 Bacteria 7969
135 Ga0068863_100029536 3300005841 Bacteria 5232
136 Ga0068863_100091161 3300005841 Bacteria 2890
137 Ga0068863_100397095 3300005841 Bacteria 1348
138 Ga0068858_100004018 3300005842 Bacteria 14514
139 Ga0068858_100022535 3300005842 Bacteria 5877
140 Ga0068858_100035994 3300005842 Bacteria 4590
141 Ga0068858_100042791 3300005842 Bacteria 4199
142 Ga0068858_100083730 3300005842 Bacteria 2966
143 Ga0068860_100054328 3300005843 Bacteria 3807
144 Ga0068860_100071833 3300005843 Bacteria 3288
145 Ga0068860_100334435 3300005843 Bacteria 1488
146 Ga0068862_100108006 3300005844 Bacteria 2440
147 Ga0068862_100332788 3300005844 Bacteria 1405
148 Ga0070712_100000953 3300006175 Bacteria 17400
149 Ga0097621_100023999 3300006237 Bacteria 4756
150 Ga0097621_100063715 3300006237 Bacteria 3030
151 Ga0068871_100063839 3300006358 Bacteria 3013
152 Ga0068871_100106758 3300006358 Bacteria 2351
153 Ga0068871_100116223 3300006358 Bacteria 2255
154 Ga0075433_10071925 3300006852 Bacteria 3040
155 Ga0097620_100064476 3300006931 Bacteria 3696
156 Ga0097620_100090362 3300006931 Bacteria 3113
157 Ga0097620_100174211 3300006931 Bacteria 2233
158 Ga0105240_10214248 3300009093 Bacteria 2248
159 Ga0105240_10282963 3300009093 Bacteria 1904
160 Ga0105241_10051358 3300009174 Bacteria 3144
161 Ga0105241_10155674 3300009174 Bacteria 1874
162 Ga0105248_10000334 3300009177 Bacteria 55634
163 Ga0105248_10020592 3300009177 Bacteria 7310
164 Ga0105248_10047354 3300009177 Bacteria 4821
165 Ga0105248_10059638 3300009177 Bacteria 4286
166 Ga0105248_10071031 3300009177 Bacteria 3910
167 Ga0105248_10087938 3300009177 Bacteria 3497
168 Ga0105248_10232850 3300009177 Bacteria 2074
169 Ga0105248_10477329 3300009177 Bacteria 1405
170 Ga0105237_10083183 3300009545 Bacteria 3192
171 Ga0105238_10031614 3300009551 Bacteria 5389
172 Ga0105249_10018131 3300009553 Bacteria 6258
173 Ga0105239_10033737 3300010375 Bacteria 5620
174 Ga0105246_10035184 3300011119 Bacteria 3346
175 Ga0157373_10016990 3300013100 Bacteria 5300
176 Ga0157373_10022570 3300013100 Bacteria 4565
177 Ga0157373_10063731 3300013100 Bacteria 2609
178 Ga0157373_10155717 3300013100 Bacteria 1607
179 Ga0157373_10172120 3300013100 Bacteria 1524
180 Ga0157371_10066350 3300013102 Bacteria 2555
181 Ga0157371_10352227 3300013102 Bacteria 1072
182 Ga0157370_10063504 3300013104 Bacteria 3498
183 Ga0157369_10003181 3300013105 Bacteria 19593
184 Ga0157369_10044804 3300013105 Bacteria 4814
185 Ga0157369_10055817 3300013105 Bacteria 4263
186 Ga0157369_10273308 3300013105 Bacteria 1761
187 Ga0157369_10407423 3300013105 Bacteria 1410
188 Ga0157374_10009442 3300013296 Bacteria 8374
189 Ga0157374_10056032 3300013296 Bacteria 3680
190 Ga0157378_10128612 3300013297 Bacteria 2342
191 Ga0163162_10016029 3300013306 Bacteria 7325
192 Ga0163162_10071319 3300013306 Bacteria 3527
193 Ga0157375_10274164 3300013308 Bacteria 1849
194 Ga0163163_10000313 3300014325 Bacteria 47673
195 Ga0163163_10003326 3300014325 Bacteria 13638
196 Ga0157377_10003619 3300014745 Bacteria 6999
197 Ga0157379_10046075 3300014968 Bacteria 3892
198 Ga0207697_10010550 3300025315 Bacteria 3945
199 Ga0207656_10005048 3300025321 Bacteria 4639
200 Ga0207642_10109911 3300025899 Bacteria 1401
201 Ga0207680_10003325 3300025903 Bacteria 7574
202 Ga0207680_10022711 3300025903 Bacteria 3416
203 Ga0207680_10152830 3300025903 Bacteria 1540
204 Ga0207647_10000114 3300025904 Bacteria 62368
205 Ga0207647_10001347 3300025904 Bacteria 18861
206 Ga0207647_10021030 3300025904 Bacteria 4363
207 Ga0207647_10026915 3300025904 Bacteria 3755
208 Ga0207647_10027591 3300025904 Bacteria 3700
209 Ga0207647_10054800 3300025904 Bacteria 2452
210 Ga0207647_10067272 3300025904 Bacteria 2172
211 Ga0207645_10026838 3300025907 Bacteria 3721
212 Ga0207645_10057140 3300025907 Bacteria 2491
213 Ga0207645_10103871 3300025907 Bacteria 1835
214 Ga0207705_10000113 3300025909 Bacteria 90567
215 Ga0207705_10011733 3300025909 Bacteria 6329
216 Ga0207705_10017894 3300025909 Bacteria 5069
217 Ga0207705_10045058 3300025909 Bacteria 3170
218 Ga0207705_10054747 3300025909 Bacteria 2875
219 Ga0207705_10192171 3300025909 Bacteria 1544
220 Ga0207705_10204768 3300025909 Bacteria 1495
221 Ga0207654_10050706 3300025911 Bacteria 2386
222 Ga0207654_10107777 3300025911 Bacteria 1727
223 Ga0207695_10241009 3300025913 Bacteria 1710
224 Ga0207693_10044681 3300025915 Bacteria 3481
225 Ga0207660_10000012 3300025917 Bacteria 84167
226 Ga0207660_10028529 3300025917 Bacteria 3818
227 Ga0207657_10000026 3300025919 Bacteria 143118
228 Ga0207657_10003765 3300025919 Bacteria 16118
229 Ga0207657_10020948 3300025919 Bacteria 6169
230 Ga0207657_10024925 3300025919 Bacteria 5526
231 Ga0207657_10028862 3300025919 Bacteria 5055
232 Ga0207657_10046576 3300025919 Bacteria 3798
233 Ga0207657_10049144 3300025919 Bacteria 3678
234 Ga0207657_10072443 3300025919 Bacteria 2914
235 Ga0207657_10213287 3300025919 Bacteria 1549
236 Ga0207649_10009730 3300025920 Bacteria 5265
237 Ga0207649_10025867 3300025920 Bacteria 3427
238 Ga0207649_10059691 3300025920 Bacteria 2394
239 Ga0207652_10092505 3300025921 Bacteria 2660
240 Ga0207652_10120272 3300025921 Bacteria 2336
241 Ga0207681_10018170 3300025923 Bacteria 4428
242 Ga0207681_10120473 3300025923 Bacteria 1923
243 Ga0207681_10323637 3300025923 Bacteria 1227
244 Ga0207694_10026504 3300025924 Bacteria 4410
245 Ga0207650_10014501 3300025925 Bacteria 5476
246 Ga0207650_10053332 3300025925 Bacteria 2997
247 Ga0207650_10058011 3300025925 Bacteria 2881
248 Ga0207650_10064418 3300025925 Bacteria 2744
249 Ga0207650_10223297 3300025925 Bacteria 1517
250 Ga0207650_10245092 3300025925 Bacteria 1449
251 Ga0207687_10084668 3300025927 Bacteria 2299
252 Ga0207687_10141866 3300025927 Bacteria 1823
253 Ga0207664_10036717 3300025929 Bacteria 3787
254 Ga0207644_10005034 3300025931 Bacteria 8629
255 Ga0207644_10005478 3300025931 Bacteria 8266
256 Ga0207644_10020170 3300025931 Bacteria 4529
257 Ga0207644_10022703 3300025931 Bacteria 4289
258 Ga0207644_10112042 3300025931 Bacteria 2064
259 Ga0207644_10143973 3300025931 Bacteria 1838
260 Ga0207690_10036139 3300025932 Bacteria 3196
261 Ga0207706_10000031 3300025933 Bacteria 143109
262 Ga0207706_10003216 3300025933 Bacteria 15682
263 Ga0207706_10007840 3300025933 Bacteria 9854
264 Ga0207706_10023176 3300025933 Bacteria 5576
265 Ga0207706_10069058 3300025933 Bacteria 3108
266 Ga0207706_10081376 3300025933 Bacteria 2846
267 Ga0207706_10090687 3300025933 Bacteria 2687
268 Ga0207706_10123623 3300025933 Bacteria 2276
269 Ga0207706_10200669 3300025933 Bacteria 1749
270 Ga0207706_10209043 3300025933 Bacteria 1711
271 Ga0207709_10235499 3300025935 Bacteria 1329
272 Ga0207709_10387546 3300025935 Bacteria 1065
273 Ga0207669_10045694 3300025937 Bacteria 2582
274 Ga0207669_10054625 3300025937 Bacteria 2414
275 Ga0207704_10010202 3300025938 Bacteria 4569
276 Ga0207691_10006678 3300025940 Bacteria 11132
277 Ga0207691_10173044 3300025940 Bacteria 1890
278 Ga0207691_10291396 3300025940 Bacteria 1403
279 Ga0207711_10005313 3300025941 Bacteria 10922
280 Ga0207711_10009449 3300025941 Bacteria 8135
281 Ga0207711_10011971 3300025941 Bacteria 7211
282 Ga0207711_10028507 3300025941 Bacteria 4698
283 Ga0207711_10089443 3300025941 Bacteria 2705
284 Ga0207711_10293580 3300025941 Bacteria 1499
285 Ga0207711_10344025 3300025941 Bacteria 1381
286 Ga0207689_10006882 3300025942 Bacteria 9997
287 Ga0207661_10000778 3300025944 Bacteria 20743
288 Ga0207661_10265961 3300025944 Bacteria 1529
289 Ga0207679_10000236 3300025945 Bacteria 42583
290 Ga0207679_10010013 3300025945 Bacteria 6092
291 Ga0207679_10035373 3300025945 Bacteria 3533
292 Ga0207679_10044218 3300025945 Bacteria 3212
293 Ga0207679_10066887 3300025945 Bacteria 2694
294 Ga0207679_10072848 3300025945 Bacteria 2596
295 Ga0207679_10243740 3300025945 Bacteria 1524
296 Ga0207679_10647996 3300025945 Bacteria 955
297 Ga0207667_10026672 3300025949 Bacteria 6306
298 Ga0207667_10086173 3300025949 Bacteria 3251
299 Ga0207667_10154282 3300025949 Bacteria 2363
300 Ga0207667_10259024 3300025949 Bacteria 1779
301 Ga0207651_10001111 3300025960 Bacteria 11967
302 Ga0207651_10095907 3300025960 Bacteria 2186
303 Ga0207651_10177806 3300025960 Bacteria 1685
304 Ga0207651_10334496 3300025960 Bacteria 1270
305 Ga0207712_10017784 3300025961 Bacteria 4623
306 Ga0207668_10107317 3300025972 Bacteria 2088
307 Ga0207668_10137958 3300025972 Bacteria 1871
308 Ga0207640_10026684 3300025981 Bacteria 3510
309 Ga0207640_10048857 3300025981 Bacteria 2737
310 Ga0207658_10037581 3300025986 Bacteria 3480
311 Ga0207677_10012824 3300026023 Bacteria 4836
312 Ga0207677_10055471 3300026023 Bacteria 2710
313 Ga0207703_10011692 3300026035 Bacteria 6828
314 Ga0207639_10071196 3300026041 Bacteria 2719
315 Ga0207639_10140482 3300026041 Bacteria 2011
316 Ga0207678_10003132 3300026067 Bacteria 14968
317 Ga0207678_10009334 3300026067 Bacteria 8636
318 Ga0207678_10043798 3300026067 Bacteria 3872
319 Ga0207678_10082962 3300026067 Bacteria 2742
320 Ga0207678_10106004 3300026067 Bacteria 2398
321 Ga0207702_10002108 3300026078 Bacteria 19155
322 Ga0207702_10073937 3300026078 Bacteria 2940
323 Ga0207702_10214365 3300026078 Bacteria 1791
324 Ga0207702_10291359 3300026078 Bacteria 1546
325 Ga0207702_10300856 3300026078 Bacteria 1522
326 Ga0207702_10565424 3300026078 Bacteria 1113
327 Ga0207641_10046495 3300026088 Bacteria 3659
328 Ga0207641_10121833 3300026088 Bacteria 2328
329 Ga0207648_10125071 3300026089 Bacteria 2262
330 Ga0207676_10021708 3300026095 Bacteria 4712
331 Ga0207676_10122383 3300026095 Bacteria 2196
332 Ga0207674_10000057 3300026116 Bacteria 113117
333 Ga0207674_10002544 3300026116 Bacteria 22969
334 Ga0207674_10025126 3300026116 Bacteria 6356
335 Ga0207674_10032630 3300026116 Bacteria 5459
336 Ga0207674_10080441 3300026116 Bacteria 3262
337 Ga0207683_10001328 3300026121 Bacteria 22311
338 Ga0207683_10003300 3300026121 Bacteria 14064
339 Ga0207683_10121160 3300026121 Bacteria 2348
340 Ga0207698_10006901 3300026142 Bacteria 7105
341 Ga0207698_10103957 3300026142 Bacteria 2362
342 Ga0207698_10116019 3300026142 Bacteria 2256
343 Ga0207698_10140608 3300026142 Bacteria 2079
344 Ga0268266_10008512 3300028379 Bacteria 9115
345 Ga0268264_10004881 3300028381 Bacteria 11363
346 Ga0265338_10082584 3300028800 Bacteria 2690
347 Ga0265340_10009601 3300031247 Bacteria 5187
348 Ga0307513_10144266 3300031456 Bacteria 2302
349 Ga0307408_100087821 3300031548 Bacteria 2340
350 Ga0265314_10020391 3300031711 Bacteria 5117
351 Ga0307405_10065761 3300031731 Bacteria 2309
352 Ga0307413_10007316 3300031824 Bacteria 5117
353 Ga0307406_10087195 3300031901 Bacteria 2091
354 Ga0307412_10032284 3300031911 Bacteria 3316
355 Ga0307409_100240530 3300031995 Bacteria 1647
356 Ga0307416_100106951 3300032002 Bacteria 2453
357 Ga0307414_10039459 3300032004 Bacteria 3180
358 Ga0307411_10171258 3300032005 Bacteria 1637
359 Ga0307415_100008047 3300032126 Bacteria 5818
360 Ga0373931_0000955 3300035691 Bacteria 12172
361 Ga0395899_0000154 3300037312 Bacteria 104239
362 Ga0395899_0001024 3300037312 Bacteria 25503
363 Ga0395899_0002657 3300037312 Bacteria 14408
364 Ga0395899_0051952 3300037312 Bacteria 3040
365 Ga0395899_0080510 3300037312 Bacteria 2370
366 Ga0395899_0198555 3300037312 Bacteria 1400
367 Ga0395900_0000293 3300037418 Bacteria 75318
368 Ga0395900_0005937 3300037418 Bacteria 12745
369 Ga0395900_0010879 3300037418 Bacteria 9305
370 Ga0395900_0013682 3300037418 Bacteria 8284
371 Ga0395900_0017221 3300037418 Bacteria 7374
372 Ga0395900_0043203 3300037418 Bacteria 4645
373 Ga0395900_0060649 3300037418 Bacteria 3892
374 Ga0395900_0304400 3300037418 Bacteria 1579
375 Ga0395900_0352717 3300037418 Bacteria 1444
376 Ga0395900_0355993 3300037418 Bacteria 1436
377 Ga0395900_0550021 3300037418 Bacteria 1099
378 Ga0395898_0000219 3300037466 Bacteria 146838
379 Ga0395898_0001769 3300037466 Bacteria 28214
380 Ga0395898_0005638 3300037466 Bacteria 13494
381 Ga0395898_0087121 3300037466 Bacteria 3008
382 Ga0395898_0162780 3300037466 Bacteria 2134
383 Ga0395898_0173376 3300037466 Bacteria 2062
384 Ga0395898_0206436 3300037466 Bacteria 1875
385 Ga0395898_0509633 3300037466 Bacteria 1144
386 Ga0395905_0000094 3300037471 Bacteria 147776
387 Ga0395905_0019273 3300037471 Bacteria 6468
388 Ga0395905_0020744 3300037471 Bacteria 6221
389 Ga0395905_0027867 3300037471 Bacteria 5327
390 Ga0395905_0035724 3300037471 Bacteria 4667
391 Ga0395905_0041734 3300037471 Bacteria 4306
392 Ga0395905_0043899 3300037471 Bacteria 4195
393 Ga0395905_0061015 3300037471 Bacteria 3526
394 Ga0395905_0061512 3300037471 Bacteria 3513
395 Ga0395905_0062562 3300037471 Bacteria 3481
396 Ga0395905_0070891 3300037471 Bacteria 3266
397 Ga0395905_0159695 3300037471 Bacteria 2119
398 Ga0395905_0352654 3300037471 Bacteria 1363
399 Ga0395905_0425929 3300037471 Bacteria 1224
400 Ga0395905_0502972 3300037471 Bacteria 1112
401 Ga0395901_0000228 3300038443 Bacteria 70677
402 Ga0395901_0019852 3300038443 Bacteria 6874
403 Ga0395901_0027901 3300038443 Bacteria 5805
404 Ga0395901_0043580 3300038443 Bacteria 4653
405 Ga0395901_0051368 3300038443 Bacteria 4286
406 Ga0395901_0091458 3300038443 Bacteria 3185
407 Ga0395901_0344801 3300038443 Bacteria 1538
408 Ga0237816_00220 3300039145 Bacteria 4746
409 Ga0436365_0053725 3300039437 Bacteria 1266
410 Ga0439458_0000465 3300042157 Bacteria 10315
411 Ga0466969_0043869 3300044656 Bacteria 2227
412 Ga0466969_0087976 3300044656 Bacteria 1475
413 Ga0466966_0012588 3300044684 Bacteria 5606
414 Ga0466971_0016325 3300044719 Bacteria 3275
415 Ga0466957_0018152 3300044842 Bacteria 4127
416 Ga0466957_0137853 3300044842 Bacteria 1569
417 Ga0466959_0064564 3300045049 Bacteria 2658
418 Ga0466959_0072365 3300045049 Bacteria 2495
419 Ga0466959_0161791 3300045049 Bacteria 1573
420 Ga0466959_0324706 3300045049 Bacteria 1052
421 Ga0466958_0213758 3300045836 Bacteria 1229
422 Ga0466967_0155815 3300045976 Bacteria 2139
423 Ga0495638_0013895 3300046460 Bacteria 5462
424 Ga0495583_0000010 3300046506 Bacteria 353523
425 Ga0495663_0005247 3300046525 Bacteria 3607
426 Ga0495621_0006592 3300046539 Bacteria 3398
427 Ga0495625_0000263 3300046660 Bacteria 81813
428 Ga0495669_0001789 3300046684 Bacteria 8773
429 Ga0495669_0019878 3300046684 Bacteria 2901
430 Ga0495669_0086640 3300046684 Bacteria 1442
431 Ga0495670_0011467 3300046691 Bacteria 4360
432 Ga0495677_0004889 3300047445 Bacteria 5110
433 Ga0495686_0000173 3300047472 Bacteria 122787
434 Ga0495686_0001422 3300047472 Bacteria 26179
435 Ga0496100_0158862 3300048903 Bacteria 1619
436 Ga0496104_0061111 3300048907 Bacteria 3571
437 Ga0496106_0031962 3300048909 Bacteria 3922
438 Ga0496107_0006559 3300048910 Bacteria 8007
439 Ga0496107_0297528 3300048910 Bacteria 1201
440 Ga0496108_0026674 3300048911 Bacteria 4767
441 Ga0496108_0059820 3300048911 Bacteria 3204
442 Ga0496109_0005203 3300048912 Bacteria 10866
443 Ga0496109_0022619 3300048912 Bacteria 5568
444 Ga0496110_0018429 3300048913 Bacteria 5854
445 Ga0496110_0018731 3300048913 Bacteria 5808
446 Ga0496110_0044450 3300048913 Bacteria 3879
447 Ga0496111_0007457 3300048914 Bacteria 7173
448 Ga0496111_0015792 3300048914 Bacteria 5193
449 Ga0496111_0043506 3300048914 Bacteria 3228
450 Ga0496112_0026570 3300048915 Bacteria 5573
451 Ga0496112_0040356 3300048915 Bacteria 4563
452 Ga0496112_0072819 3300048915 Bacteria 3396
453 Ga0496112_0076418 3300048915 Bacteria 3312
454 Ga0496113_0000364 3300048916 Bacteria 21780
455 Ga0496113_0047758 3300048916 Bacteria 3182
456 Ga0496113_0056747 3300048916 Bacteria 2941
457 Ga0496113_0109918 3300048916 Bacteria 2144
458 Ga0496114_0155857 3300048917 Bacteria 1983
459 Ga0496115_0000471 3300048918 Bacteria 32135
460 Ga0496122_0220156 3300048925 Bacteria 1090
461 Ga0496123_0082637 3300048926 Bacteria 1946
462 Ga0496124_0081430 3300048927 Bacteria 2661
463 Ga0495682_0006452 3300049460 Bacteria 4740
464 Ga0501235_017001 3300049669 Bacteria 1608
465 Ga0501080_0047441 3300049742 Bacteria 3998
466 Ga0501273_001392 3300049770 Bacteria 2291
467 nmdc:mga0a205_8694_c2 3300050515 Bacteria 5387
468 Ga0500555_000140 3300053103 Bacteria 34342
469 Ga0500658_0000072 3300053134 Bacteria 46284
470 Ga0500616_0022620 3300053153 Bacteria 3508

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031247 Ga0265340_10009601 Ga0265340_100096013 253
2 3300031711 Ga0265314_10020391 Ga0265314_100203912 262
3 3300048915 Ga0496112_0072819 Ga0496112_0072819_1279_2142 270
4 3300048916 Ga0496113_0000364 Ga0496113_0000364_15449_16312 270
5 3300025945 Ga0207679_10647996 Ga0207679_106479961 271
6 3300005356 Ga0070674_100283633 Ga0070674_1002836332 286
7 3300013306 Ga0163162_10071319 Ga0163162_100713193 286
8 3300025899 Ga0207642_10109911 Ga0207642_101099112 286
9 3300025933 Ga0207706_10007840 Ga0207706_100078403 286
10 3300025937 Ga0207669_10054625 Ga0207669_100546252 286
11 3300025938 Ga0207704_10010202 Ga0207704_100102023 286
12 3300046539 Ga0495621_0006592 Ga0495621_0006592_51_1007 286
13 3300005336 Ga0070680_100006274 Ga0070680_1000062745 287
14 3300005578 Ga0068854_100004225 Ga0068854_1000042255 287
15 3300037312 Ga0395899_0002657 Ga0395899_0002657_2433_3389 288
16 3300037418 Ga0395900_0005937 Ga0395900_0005937_2432_3388 288
17 3300037466 Ga0395898_0005638 Ga0395898_0005638_8210_9166 288
18 3300037471 Ga0395905_0019273 Ga0395905_0019273_2615_3571 288
19 3300038443 Ga0395901_0043580 Ga0395901_0043580_3114_4070 288
20 3300005327 Ga0070658_10032042 Ga0070658_100320423 289
21 3300005344 Ga0070661_100229285 Ga0070661_1002292852 289
22 3300005539 Ga0068853_100020004 Ga0068853_1000200045 289
23 3300005563 Ga0068855_100301704 Ga0068855_1003017042 289
24 3300005578 Ga0068854_100172923 Ga0068854_1001729232 289
25 3300005616 Ga0068852_100019281 Ga0068852_1000192813 289
26 3300009551 Ga0105238_10031614 Ga0105238_100316143 289
27 3300013105 Ga0157369_10003181 Ga0157369_100031815 289
28 3300025924 Ga0207694_10026504 Ga0207694_100265044 289
29 3300025949 Ga0207667_10259024 Ga0207667_102590242 289
30 3300026041 Ga0207639_10071196 Ga0207639_100711963 289
31 3300026142 Ga0207698_10006901 Ga0207698_100069013 289
32 3300037312 Ga0395899_0198555 Ga0395899_0198555_241_1197 289
33 3300037471 Ga0395905_0035724 Ga0395905_0035724_1424_2380 289
34 3300038443 Ga0395901_0091458 Ga0395901_0091458_511_1467 289
35 iso_pu_bacteria 2946787523 2946789106 292
36 3300002067 JGI24735J21928_10028092 JGI24735J21928_100280922 293
37 3300046460 Ga0495638_0013895 Ga0495638_0013895_2570_3508 295
38 3300046506 Ga0495583_0000010 Ga0495583_0000010_317792_318730 295
39 3300047472 Ga0495686_0000173 Ga0495686_0000173_65228_66166 295
40 3300047472 Ga0495686_0001422 Ga0495686_0001422_18951_19889 295
41 3300048925 Ga0496122_0220156 Ga0496122_0220156_20_958 295
42 3300048926 Ga0496123_0082637 Ga0496123_0082637_159_1097 295
43 3300048927 Ga0496124_0081430 Ga0496124_0081430_1450_2388 295
44 3300049460 Ga0495682_0006452 Ga0495682_0006452_1236_2174 295
45 3300053103 Ga0500555_000140 Ga0500555_000140_14435_15373 295
46 3300053153 Ga0500616_0022620 Ga0500616_0022620_1016_1954 295
47 3300046660 Ga0495625_0000263 Ga0495625_0000263_8049_8990 296
48 3300013105 Ga0157369_10273308 Ga0157369_102733082 297
49 3300026078 Ga0207702_10565424 Ga0207702_105654242 297
50 3300037418 Ga0395900_0352717 Ga0395900_0352717_344_1300 297
51 3300005364 Ga0070673_100154640 Ga0070673_1001546403 298
52 3300005367 Ga0070667_100533044 Ga0070667_1005330441 298
53 3300005548 Ga0070665_100165669 Ga0070665_1001656692 298
54 3300005617 Ga0068859_100064476 Ga0068859_1000644763 298
55 3300006931 Ga0097620_100064476 Ga0097620_1000644763 298
56 3300009177 Ga0105248_10047354 Ga0105248_100473544 298
57 3300013308 Ga0157375_10274164 Ga0157375_102741641 298
58 3300025909 Ga0207705_10204768 Ga0207705_102047682 298
59 3300025935 Ga0207709_10235499 Ga0207709_102354992 298
60 3300025941 Ga0207711_10009449 Ga0207711_100094495 298
61 3300025960 Ga0207651_10334496 Ga0207651_103344962 298
62 3300037471 Ga0395905_0159695 Ga0395905_0159695_288_1244 298
63 3300037471 Ga0395905_0425929 Ga0395905_0425929_153_1109 298
64 3300048910 Ga0496107_0297528 Ga0496107_0297528_161_1114 298
65 3300048915 Ga0496112_0076418 Ga0496112_0076418_564_1517 298
66 3300048917 Ga0496114_0155857 Ga0496114_0155857_653_1606 298
67 3300048918 Ga0496115_0000471 Ga0496115_0000471_14114_15067 298
68 3300001990 JGI24737J22298_10000339 JGI24737J22298_100003399 299
69 3300005327 Ga0070658_10008847 Ga0070658_100088473 299
70 3300005336 Ga0070680_100000244 Ga0070680_10000024428 299
71 3300005339 Ga0070660_100061697 Ga0070660_1000616972 299
72 3300005355 Ga0070671_100012922 Ga0070671_1000129224 299
73 3300005364 Ga0070673_100012282 Ga0070673_1000122823 299
74 3300005530 Ga0070679_100067409 Ga0070679_1000674092 299
75 3300005563 Ga0068855_100066565 Ga0068855_1000665653 299
76 3300005577 Ga0068857_100060844 Ga0068857_1000608442 299
77 3300005614 Ga0068856_100025809 Ga0068856_1000258093 299
78 3300005616 Ga0068852_100128915 Ga0068852_1001289152 299
79 3300005616 Ga0068852_100454160 Ga0068852_1004541602 299
80 3300005618 Ga0068864_100088628 Ga0068864_1000886282 299
81 3300005841 Ga0068863_100091161 Ga0068863_1000911612 299
82 3300005844 Ga0068862_100108006 Ga0068862_1001080062 299
83 3300009177 Ga0105248_10020592 Ga0105248_100205924 299
84 3300025907 Ga0207645_10103871 Ga0207645_101038712 299
85 3300025909 Ga0207705_10011733 Ga0207705_100117333 299
86 3300025917 Ga0207660_10000012 Ga0207660_1000001222 299
87 3300025921 Ga0207652_10092505 Ga0207652_100925053 299
88 3300025925 Ga0207650_10014501 Ga0207650_100145012 299
89 3300025925 Ga0207650_10223297 Ga0207650_102232972 299
90 3300025927 Ga0207687_10141866 Ga0207687_101418662 299
91 3300025960 Ga0207651_10095907 Ga0207651_100959072 299
92 3300026078 Ga0207702_10214365 Ga0207702_102143652 299
93 3300026088 Ga0207641_10121833 Ga0207641_101218332 299
94 3300026095 Ga0207676_10021708 Ga0207676_100217083 299
95 3300026116 Ga0207674_10000057 Ga0207674_1000005738 299
96 3300026142 Ga0207698_10103957 Ga0207698_101039572 299
97 3300037418 Ga0395900_0010879 Ga0395900_0010879_2651_3607 299
98 3300037466 Ga0395898_0162780 Ga0395898_0162780_626_1582 299
99 3300037471 Ga0395905_0061512 Ga0395905_0061512_785_1738 299
100 3300037471 Ga0395905_0070891 Ga0395905_0070891_1643_2599 299
101 3300038443 Ga0395901_0027901 Ga0395901_0027901_4537_5493 299
102 3300039145 Ga0237816_00220 Ga0237816_00220_3204_4154 299
103 3300044656 Ga0466969_0043869 Ga0466969_0043869_43_999 299
104 3300044719 Ga0466971_0016325 Ga0466971_0016325_2277_3233 299
105 3300044842 Ga0466957_0018152 Ga0466957_0018152_172_1128 299
106 3300045049 Ga0466959_0161791 Ga0466959_0161791_583_1539 299
107 3300048907 Ga0496104_0061111 Ga0496104_0061111_2451_3404 299
108 3300048911 Ga0496108_0026674 Ga0496108_0026674_2542_3495 299
109 3300048913 Ga0496110_0018429 Ga0496110_0018429_2024_2977 299
110 3300048914 Ga0496111_0007457 Ga0496111_0007457_2222_3175 299
111 3300048915 Ga0496112_0026570 Ga0496112_0026570_1265_2218 299
112 3300048916 Ga0496113_0109918 Ga0496113_0109918_1178_2131 299
113 3300005327 Ga0070658_10015309 Ga0070658_100153093 300
114 3300005335 Ga0070666_10105589 Ga0070666_101055892 300
115 3300005366 Ga0070659_100117126 Ga0070659_1001171262 300
116 3300005366 Ga0070659_100144412 Ga0070659_1001444122 300
117 3300005455 Ga0070663_100037599 Ga0070663_1000375992 300
118 3300005548 Ga0070665_100054021 Ga0070665_1000540213 300
119 3300005564 Ga0070664_100003480 Ga0070664_1000034806 300
120 3300005842 Ga0068858_100035994 Ga0068858_1000359943 300
121 3300005844 Ga0068862_100332788 Ga0068862_1003327882 300
122 3300006175 Ga0070712_100000953 Ga0070712_1000009533 300
123 3300013100 Ga0157373_10172120 Ga0157373_101721202 300
124 3300025904 Ga0207647_10067272 Ga0207647_100672723 300
125 3300025909 Ga0207705_10045058 Ga0207705_100450583 300
126 3300025915 Ga0207693_10044681 Ga0207693_100446813 300
127 3300025919 Ga0207657_10049144 Ga0207657_100491442 300
128 3300025920 Ga0207649_10025867 Ga0207649_100258672 300
129 3300025925 Ga0207650_10245092 Ga0207650_102450922 300
130 3300025933 Ga0207706_10069058 Ga0207706_100690583 300
131 3300025933 Ga0207706_10090687 Ga0207706_100906873 300
132 3300025945 Ga0207679_10010013 Ga0207679_100100133 300
133 3300026067 Ga0207678_10043798 Ga0207678_100437983 300
134 3300026088 Ga0207641_10046495 Ga0207641_100464954 300
135 3300026116 Ga0207674_10032630 Ga0207674_100326304 300
136 3300031456 Ga0307513_10144266 Ga0307513_101442662 300
137 3300031911 Ga0307412_10032284 Ga0307412_100322842 300
138 3300032126 Ga0307415_100008047 Ga0307415_1000080475 300
139 3300037471 Ga0395905_0041734 Ga0395905_0041734_923_1876 300
140 3300042157 Ga0439458_0000465 Ga0439458_0000465_5161_6117 300
141 3300045049 Ga0466959_0072365 Ga0466959_0072365_187_1140 300
142 3300045836 Ga0466958_0213758 Ga0466958_0213758_239_1195 300
143 3300046684 Ga0495669_0086640 Ga0495669_0086640_376_1329 300
144 3300046691 Ga0495670_0011467 Ga0495670_0011467_2389_3342 300
145 3300001915 JGI24741J21665_1009066 JGI24741J21665_10090662 301
146 3300001989 JGI24739J22299_10002532 JGI24739J22299_100025323 301
147 3300001990 JGI24737J22298_10001578 JGI24737J22298_100015785 301
148 3300001990 JGI24737J22298_10008391 JGI24737J22298_100083912 301
149 3300002075 JGI24738J21930_10000740 JGI24738J21930_100007406 301
150 3300005290 Ga0065712_10088294 Ga0065712_100882943 301
151 3300005327 Ga0070658_10000477 Ga0070658_100004777 301
152 3300005327 Ga0070658_10134570 Ga0070658_101345702 301
153 3300005328 Ga0070676_10025519 Ga0070676_100255193 301
154 3300005329 Ga0070683_100000747 Ga0070683_1000007479 301
155 3300005329 Ga0070683_100062540 Ga0070683_1000625402 301
156 3300005331 Ga0070670_100009359 Ga0070670_1000093596 301
157 3300005331 Ga0070670_100027841 Ga0070670_1000278412 301
158 3300005331 Ga0070670_100083704 Ga0070670_1000837042 301
159 3300005333 Ga0070677_10066081 Ga0070677_100660812 301
160 3300005334 Ga0068869_100208253 Ga0068869_1002082532 301
161 3300005334 Ga0068869_100340377 Ga0068869_1003403772 301
162 3300005335 Ga0070666_10002691 Ga0070666_100026917 301
163 3300005335 Ga0070666_10013304 Ga0070666_100133043 301
164 3300005335 Ga0070666_10061765 Ga0070666_100617652 301
165 3300005336 Ga0070680_100004079 Ga0070680_1000040796 301
166 3300005336 Ga0070680_100042822 Ga0070680_1000428223 301
167 3300005336 Ga0070680_100098935 Ga0070680_1000989353 301
168 3300005337 Ga0070682_100025238 Ga0070682_1000252383 301
169 3300005338 Ga0068868_100051721 Ga0068868_1000517212 301
170 3300005338 Ga0068868_100253223 Ga0068868_1002532232 301
171 3300005339 Ga0070660_100000425 Ga0070660_10000042528 301
172 3300005339 Ga0070660_100061417 Ga0070660_1000614172 301
173 3300005339 Ga0070660_100104177 Ga0070660_1001041772 301
174 3300005339 Ga0070660_100150412 Ga0070660_1001504122 301
175 3300005344 Ga0070661_100000552 Ga0070661_10000055225 301
176 3300005344 Ga0070661_100011526 Ga0070661_1000115264 301
177 3300005344 Ga0070661_100154939 Ga0070661_1001549392 301
178 3300005344 Ga0070661_100208971 Ga0070661_1002089712 301
179 3300005345 Ga0070692_10019687 Ga0070692_100196872 301
180 3300005345 Ga0070692_10075217 Ga0070692_100752172 301
181 3300005353 Ga0070669_100031871 Ga0070669_1000318712 301
182 3300005353 Ga0070669_100215857 Ga0070669_1002158572 301
183 3300005354 Ga0070675_100013308 Ga0070675_1000133083 301
184 3300005354 Ga0070675_100329346 Ga0070675_1003293462 301
185 3300005355 Ga0070671_100000133 Ga0070671_1000001333 301
186 3300005355 Ga0070671_100019260 Ga0070671_1000192604 301
187 3300005355 Ga0070671_100029009 Ga0070671_1000290093 301
188 3300005355 Ga0070671_100112375 Ga0070671_1001123752 301
189 3300005355 Ga0070671_100128945 Ga0070671_1001289453 301
190 3300005356 Ga0070674_100013663 Ga0070674_1000136633 301
191 3300005356 Ga0070674_100090347 Ga0070674_1000903473 301
192 3300005364 Ga0070673_100004722 Ga0070673_1000047223 301
193 3300005364 Ga0070673_100150074 Ga0070673_1001500743 301
194 3300005364 Ga0070673_100162764 Ga0070673_1001627642 301
195 3300005364 Ga0070673_100401271 Ga0070673_1004012711 301
196 3300005366 Ga0070659_100000065 Ga0070659_10000006514 301
197 3300005366 Ga0070659_100009817 Ga0070659_1000098172 301
198 3300005367 Ga0070667_100006194 Ga0070667_1000061947 301
199 3300005435 Ga0070714_100082542 Ga0070714_1000825423 301
200 3300005444 Ga0070694_100054187 Ga0070694_1000541872 301
201 3300005455 Ga0070663_100031028 Ga0070663_1000310283 301
202 3300005455 Ga0070663_100062477 Ga0070663_1000624772 301
203 3300005456 Ga0070678_100024098 Ga0070678_1000240982 301
204 3300005456 Ga0070678_100032049 Ga0070678_1000320494 301
205 3300005456 Ga0070678_100098454 Ga0070678_1000984543 301
206 3300005457 Ga0070662_100000010 Ga0070662_10000001057 301
207 3300005457 Ga0070662_100006303 Ga0070662_1000063034 301
208 3300005457 Ga0070662_100028421 Ga0070662_1000284213 301
209 3300005457 Ga0070662_100188330 Ga0070662_1001883302 301
210 3300005458 Ga0070681_10007118 Ga0070681_100071183 301
211 3300005535 Ga0070684_100120672 Ga0070684_1001206722 301
212 3300005539 Ga0068853_100000067 Ga0068853_10000006726 301
213 3300005539 Ga0068853_100030077 Ga0068853_1000300773 301
214 3300005539 Ga0068853_100220866 Ga0068853_1002208661 301
215 3300005543 Ga0070672_100028917 Ga0070672_1000289172 301
216 3300005543 Ga0070672_100166200 Ga0070672_1001662002 301
217 3300005543 Ga0070672_100244158 Ga0070672_1002441582 301
218 3300005547 Ga0070693_100036742 Ga0070693_1000367422 301
219 3300005547 Ga0070693_100077622 Ga0070693_1000776222 301
220 3300005548 Ga0070665_100036042 Ga0070665_1000360423 301
221 3300005548 Ga0070665_100052886 Ga0070665_1000528863 301
222 3300005563 Ga0068855_100014637 Ga0068855_1000146376 301
223 3300005564 Ga0070664_100000228 Ga0070664_10000022825 301
224 3300005564 Ga0070664_100017146 Ga0070664_1000171463 301
225 3300005564 Ga0070664_100029951 Ga0070664_1000299513 301
226 3300005564 Ga0070664_100061124 Ga0070664_1000611243 301
227 3300005564 Ga0070664_100145275 Ga0070664_1001452752 301
228 3300005577 Ga0068857_100039511 Ga0068857_1000395113 301
229 3300005577 Ga0068857_100200302 Ga0068857_1002003022 301
230 3300005578 Ga0068854_100055520 Ga0068854_1000555203 301
231 3300005578 Ga0068854_100061254 Ga0068854_1000612542 301
232 3300005614 Ga0068856_100000101 Ga0068856_10000010180 301
233 3300005614 Ga0068856_100005840 Ga0068856_10000584013 301
234 3300005616 Ga0068852_100014908 Ga0068852_1000149083 301
235 3300005616 Ga0068852_100150035 Ga0068852_1001500352 301
236 3300005616 Ga0068852_100176146 Ga0068852_1001761462 301
237 3300005616 Ga0068852_100224083 Ga0068852_1002240832 301
238 3300005617 Ga0068859_100090370 Ga0068859_1000903703 301
239 3300005617 Ga0068859_100174219 Ga0068859_1001742192 301
240 3300005618 Ga0068864_100001115 Ga0068864_1000011155 301
241 3300005618 Ga0068864_100002833 Ga0068864_10000283311 301
242 3300005618 Ga0068864_100017032 Ga0068864_1000170325 301
243 3300005834 Ga0068851_10009336 Ga0068851_100093363 301
244 3300005841 Ga0068863_100013196 Ga0068863_1000131962 301
245 3300005841 Ga0068863_100029536 Ga0068863_1000295363 301
246 3300005841 Ga0068863_100397095 Ga0068863_1003970952 301
247 3300005842 Ga0068858_100004018 Ga0068858_1000040183 301
248 3300005842 Ga0068858_100022535 Ga0068858_1000225355 301
249 3300005842 Ga0068858_100042791 Ga0068858_1000427913 301
250 3300005842 Ga0068858_100083730 Ga0068858_1000837303 301
251 3300005843 Ga0068860_100054328 Ga0068860_1000543283 301
252 3300005843 Ga0068860_100071833 Ga0068860_1000718333 301
253 3300005843 Ga0068860_100334435 Ga0068860_1003344352 301
254 3300006237 Ga0097621_100023999 Ga0097621_1000239993 301
255 3300006237 Ga0097621_100063715 Ga0097621_1000637152 301
256 3300006358 Ga0068871_100063839 Ga0068871_1000638392 301
257 3300006358 Ga0068871_100106758 Ga0068871_1001067582 301
258 3300006358 Ga0068871_100116223 Ga0068871_1001162232 301
259 3300006852 Ga0075433_10071925 Ga0075433_100719252 301
260 3300006931 Ga0097620_100090362 Ga0097620_1000903622 301
261 3300006931 Ga0097620_100174211 Ga0097620_1001742112 301
262 3300009093 Ga0105240_10214248 Ga0105240_102142482 301
263 3300009093 Ga0105240_10282963 Ga0105240_102829632 301
264 3300009174 Ga0105241_10051358 Ga0105241_100513582 301
265 3300009174 Ga0105241_10155674 Ga0105241_101556742 301
266 3300009177 Ga0105248_10000334 Ga0105248_1000033437 301
267 3300009177 Ga0105248_10059638 Ga0105248_100596383 301
268 3300009177 Ga0105248_10071031 Ga0105248_100710313 301
269 3300009177 Ga0105248_10087938 Ga0105248_100879383 301
270 3300009177 Ga0105248_10232850 Ga0105248_102328502 301
271 3300009177 Ga0105248_10477329 Ga0105248_104773292 301
272 3300009545 Ga0105237_10083183 Ga0105237_100831833 301
273 3300009553 Ga0105249_10018131 Ga0105249_100181311 301
274 3300010375 Ga0105239_10033737 Ga0105239_100337373 301
275 3300011119 Ga0105246_10035184 Ga0105246_100351843 301
276 3300013100 Ga0157373_10016990 Ga0157373_100169904 301
277 3300013100 Ga0157373_10022570 Ga0157373_100225703 301
278 3300013100 Ga0157373_10063731 Ga0157373_100637313 301
279 3300013100 Ga0157373_10155717 Ga0157373_101557172 301
280 3300013102 Ga0157371_10066350 Ga0157371_100663503 301
281 3300013102 Ga0157371_10352227 Ga0157371_103522271 301
282 3300013104 Ga0157370_10063504 Ga0157370_100635042 301
283 3300013105 Ga0157369_10044804 Ga0157369_100448042 301
284 3300013105 Ga0157369_10055817 Ga0157369_100558172 301
285 3300013105 Ga0157369_10407423 Ga0157369_104074232 301
286 3300013296 Ga0157374_10009442 Ga0157374_100094424 301
287 3300013296 Ga0157374_10056032 Ga0157374_100560322 301
288 3300013297 Ga0157378_10128612 Ga0157378_101286123 301
289 3300013306 Ga0163162_10016029 Ga0163162_100160293 301
290 3300014325 Ga0163163_10000313 Ga0163163_100003134 301
291 3300014325 Ga0163163_10003326 Ga0163163_100033268 301
292 3300014745 Ga0157377_10003619 Ga0157377_100036193 301
293 3300014968 Ga0157379_10046075 Ga0157379_100460753 301
294 3300025315 Ga0207697_10010550 Ga0207697_100105505 301
295 3300025321 Ga0207656_10005048 Ga0207656_100050484 301
296 3300025903 Ga0207680_10003325 Ga0207680_100033253 301
297 3300025903 Ga0207680_10022711 Ga0207680_100227113 301
298 3300025903 Ga0207680_10152830 Ga0207680_101528302 301
299 3300025904 Ga0207647_10000114 Ga0207647_1000011427 301
300 3300025904 Ga0207647_10001347 Ga0207647_100013472 301
301 3300025904 Ga0207647_10021030 Ga0207647_100210304 301
302 3300025904 Ga0207647_10026915 Ga0207647_100269153 301
303 3300025904 Ga0207647_10027591 Ga0207647_100275913 301
304 3300025904 Ga0207647_10054800 Ga0207647_100548002 301
305 3300025907 Ga0207645_10026838 Ga0207645_100268382 301
306 3300025907 Ga0207645_10057140 Ga0207645_100571403 301
307 3300025909 Ga0207705_10000113 Ga0207705_100001134 301
308 3300025909 Ga0207705_10017894 Ga0207705_100178942 301
309 3300025909 Ga0207705_10054747 Ga0207705_100547472 301
310 3300025909 Ga0207705_10192171 Ga0207705_101921712 301
311 3300025911 Ga0207654_10050706 Ga0207654_100507062 301
312 3300025911 Ga0207654_10107777 Ga0207654_101077772 301
313 3300025913 Ga0207695_10241009 Ga0207695_102410092 301
314 3300025917 Ga0207660_10028529 Ga0207660_100285293 301
315 3300025919 Ga0207657_10000026 Ga0207657_1000002680 301
316 3300025919 Ga0207657_10003765 Ga0207657_100037653 301
317 3300025919 Ga0207657_10020948 Ga0207657_100209482 301
318 3300025919 Ga0207657_10024925 Ga0207657_100249254 301
319 3300025919 Ga0207657_10028862 Ga0207657_100288623 301
320 3300025919 Ga0207657_10046576 Ga0207657_100465762 301
321 3300025919 Ga0207657_10072443 Ga0207657_100724433 301
322 3300025919 Ga0207657_10213287 Ga0207657_102132872 301
323 3300025920 Ga0207649_10009730 Ga0207649_100097303 301
324 3300025920 Ga0207649_10059691 Ga0207649_100596913 301
325 3300025921 Ga0207652_10120272 Ga0207652_101202722 301
326 3300025923 Ga0207681_10018170 Ga0207681_100181705 301
327 3300025923 Ga0207681_10120473 Ga0207681_101204731 301
328 3300025923 Ga0207681_10323637 Ga0207681_103236371 301
329 3300025925 Ga0207650_10053332 Ga0207650_100533322 301
330 3300025925 Ga0207650_10058011 Ga0207650_100580113 301
331 3300025925 Ga0207650_10064418 Ga0207650_100644183 301
332 3300025927 Ga0207687_10084668 Ga0207687_100846683 301
333 3300025929 Ga0207664_10036717 Ga0207664_100367172 301
334 3300025931 Ga0207644_10005034 Ga0207644_100050342 301
335 3300025931 Ga0207644_10005478 Ga0207644_100054783 301
336 3300025931 Ga0207644_10020170 Ga0207644_100201703 301
337 3300025931 Ga0207644_10022703 Ga0207644_100227032 301
338 3300025931 Ga0207644_10112042 Ga0207644_101120422 301
339 3300025931 Ga0207644_10143973 Ga0207644_101439732 301
340 3300025932 Ga0207690_10036139 Ga0207690_100361391 301
341 3300025933 Ga0207706_10000031 Ga0207706_1000003155 301
342 3300025933 Ga0207706_10003216 Ga0207706_100032169 301
343 3300025933 Ga0207706_10023176 Ga0207706_100231763 301
344 3300025933 Ga0207706_10081376 Ga0207706_100813762 301
345 3300025933 Ga0207706_10123623 Ga0207706_101236232 301
346 3300025933 Ga0207706_10200669 Ga0207706_102006692 301
347 3300025933 Ga0207706_10209043 Ga0207706_102090432 301
348 3300025935 Ga0207709_10387546 Ga0207709_103875461 301
349 3300025937 Ga0207669_10045694 Ga0207669_100456942 301
350 3300025940 Ga0207691_10006678 Ga0207691_100066783 301
351 3300025940 Ga0207691_10173044 Ga0207691_101730442 301
352 3300025940 Ga0207691_10291396 Ga0207691_102913962 301
353 3300025941 Ga0207711_10005313 Ga0207711_100053139 301
354 3300025941 Ga0207711_10011971 Ga0207711_100119714 301
355 3300025941 Ga0207711_10028507 Ga0207711_100285072 301
356 3300025941 Ga0207711_10089443 Ga0207711_100894432 301
357 3300025941 Ga0207711_10293580 Ga0207711_102935802 301
358 3300025941 Ga0207711_10344025 Ga0207711_103440252 301
359 3300025942 Ga0207689_10006882 Ga0207689_1000688210 301
360 3300025944 Ga0207661_10000778 Ga0207661_1000077814 301
361 3300025944 Ga0207661_10265961 Ga0207661_102659612 301
362 3300025945 Ga0207679_10000236 Ga0207679_1000023628 301
363 3300025945 Ga0207679_10035373 Ga0207679_100353733 301
364 3300025945 Ga0207679_10044218 Ga0207679_100442183 301
365 3300025945 Ga0207679_10066887 Ga0207679_100668873 301
366 3300025945 Ga0207679_10072848 Ga0207679_100728482 301
367 3300025945 Ga0207679_10243740 Ga0207679_102437402 301
368 3300025949 Ga0207667_10026672 Ga0207667_100266725 301
369 3300025949 Ga0207667_10086173 Ga0207667_100861732 301
370 3300025949 Ga0207667_10154282 Ga0207667_101542823 301
371 3300025960 Ga0207651_10001111 Ga0207651_100011117 301
372 3300025960 Ga0207651_10177806 Ga0207651_101778062 301
373 3300025961 Ga0207712_10017784 Ga0207712_100177843 301
374 3300025972 Ga0207668_10107317 Ga0207668_101073172 301
375 3300025972 Ga0207668_10137958 Ga0207668_101379582 301
376 3300025981 Ga0207640_10026684 Ga0207640_100266843 301
377 3300025981 Ga0207640_10048857 Ga0207640_100488573 301
378 3300025986 Ga0207658_10037581 Ga0207658_100375812 301
379 3300026023 Ga0207677_10012824 Ga0207677_100128242 301
380 3300026023 Ga0207677_10055471 Ga0207677_100554713 301
381 3300026035 Ga0207703_10011692 Ga0207703_100116924 301
382 3300026041 Ga0207639_10140482 Ga0207639_101404822 301
383 3300026067 Ga0207678_10003132 Ga0207678_100031329 301
384 3300026067 Ga0207678_10009334 Ga0207678_100093344 301
385 3300026067 Ga0207678_10082962 Ga0207678_100829623 301
386 3300026067 Ga0207678_10106004 Ga0207678_101060042 301
387 3300026078 Ga0207702_10002108 Ga0207702_100021083 301
388 3300026078 Ga0207702_10073937 Ga0207702_100739373 301
389 3300026078 Ga0207702_10291359 Ga0207702_102913591 301
390 3300026078 Ga0207702_10300856 Ga0207702_103008562 301
391 3300026089 Ga0207648_10125071 Ga0207648_101250713 301
392 3300026095 Ga0207676_10122383 Ga0207676_101223833 301
393 3300026116 Ga0207674_10002544 Ga0207674_100025443 301
394 3300026116 Ga0207674_10025126 Ga0207674_100251263 301
395 3300026116 Ga0207674_10080441 Ga0207674_100804412 301
396 3300026121 Ga0207683_10001328 Ga0207683_1000132817 301
397 3300026121 Ga0207683_10003300 Ga0207683_100033006 301
398 3300026121 Ga0207683_10121160 Ga0207683_101211602 301
399 3300026142 Ga0207698_10116019 Ga0207698_101160193 301
400 3300026142 Ga0207698_10140608 Ga0207698_101406082 301
401 3300028379 Ga0268266_10008512 Ga0268266_100085126 301
402 3300028381 Ga0268264_10004881 Ga0268264_100048817 301
403 3300028800 Ga0265338_10082584 Ga0265338_100825844 301
404 3300031548 Ga0307408_100087821 Ga0307408_1000878213 301
405 3300031731 Ga0307405_10065761 Ga0307405_100657613 301
406 3300031824 Ga0307413_10007316 Ga0307413_100073164 301
407 3300031901 Ga0307406_10087195 Ga0307406_100871951 301
408 3300031995 Ga0307409_100240530 Ga0307409_1002405302 301
409 3300032002 Ga0307416_100106951 Ga0307416_1001069512 301
410 3300032004 Ga0307414_10039459 Ga0307414_100394593 301
411 3300032005 Ga0307411_10171258 Ga0307411_101712582 301
412 3300035691 Ga0373931_0000955 Ga0373931_0000955_6109_7149 301
413 3300037312 Ga0395899_0000154 Ga0395899_0000154_34327_35283 301
414 3300037312 Ga0395899_0001024 Ga0395899_0001024_14203_15159 301
415 3300037312 Ga0395899_0051952 Ga0395899_0051952_239_1195 301
416 3300037312 Ga0395899_0080510 Ga0395899_0080510_102_1058 301
417 3300037418 Ga0395900_0000293 Ga0395900_0000293_24120_25076 301
418 3300037418 Ga0395900_0013682 Ga0395900_0013682_1283_2239 301
419 3300037418 Ga0395900_0017221 Ga0395900_0017221_3736_4692 301
420 3300037418 Ga0395900_0043203 Ga0395900_0043203_1330_2289 301
421 3300037418 Ga0395900_0060649 Ga0395900_0060649_1508_2464 301
422 3300037418 Ga0395900_0304400 Ga0395900_0304400_297_1253 301
423 3300037418 Ga0395900_0355993 Ga0395900_0355993_10_966 301
424 3300037418 Ga0395900_0550021 Ga0395900_0550021_59_1015 301
425 3300037466 Ga0395898_0000219 Ga0395898_0000219_94151_95107 301
426 3300037466 Ga0395898_0001769 Ga0395898_0001769_22677_23633 301
427 3300037466 Ga0395898_0087121 Ga0395898_0087121_1252_2208 301
428 3300037466 Ga0395898_0173376 Ga0395898_0173376_1053_2009 301
429 3300037466 Ga0395898_0206436 Ga0395898_0206436_175_1137 301
430 3300037466 Ga0395898_0509633 Ga0395898_0509633_130_1086 301
431 3300037471 Ga0395905_0000094 Ga0395905_0000094_95089_96045 301
432 3300037471 Ga0395905_0020744 Ga0395905_0020744_3966_4922 301
433 3300037471 Ga0395905_0027867 Ga0395905_0027867_38_997 301
434 3300037471 Ga0395905_0043899 Ga0395905_0043899_2381_3337 301
435 3300037471 Ga0395905_0061015 Ga0395905_0061015_16_972 301
436 3300037471 Ga0395905_0062562 Ga0395905_0062562_1123_2079 301
437 3300037471 Ga0395905_0352654 Ga0395905_0352654_294_1250 301
438 3300037471 Ga0395905_0502972 Ga0395905_0502972_82_1038 301
439 3300038443 Ga0395901_0000228 Ga0395901_0000228_24120_25076 301
440 3300038443 Ga0395901_0019852 Ga0395901_0019852_4040_4996 301
441 3300038443 Ga0395901_0051368 Ga0395901_0051368_2232_3188 301
442 3300038443 Ga0395901_0344801 Ga0395901_0344801_548_1504 301
443 3300039437 Ga0436365_0053725 Ga0436365_0053725_65_1021 301
444 3300044656 Ga0466969_0087976 Ga0466969_0087976_275_1231 301
445 3300044684 Ga0466966_0012588 Ga0466966_0012588_4411_5367 301
446 3300044842 Ga0466957_0137853 Ga0466957_0137853_318_1274 301
447 3300045049 Ga0466959_0064564 Ga0466959_0064564_981_1937 301
448 3300045049 Ga0466959_0324706 Ga0466959_0324706_68_1024 301
449 3300045976 Ga0466967_0155815 Ga0466967_0155815_433_1389 301
450 3300046525 Ga0495663_0005247 Ga0495663_0005247_2250_3206 301
451 3300046684 Ga0495669_0001789 Ga0495669_0001789_5543_6499 301
452 3300046684 Ga0495669_0019878 Ga0495669_0019878_152_1108 301
453 3300047445 Ga0495677_0004889 Ga0495677_0004889_1999_2955 301
454 3300048903 Ga0496100_0158862 Ga0496100_0158862_600_1556 301
455 3300048909 Ga0496106_0031962 Ga0496106_0031962_2616_3572 301
456 3300048910 Ga0496107_0006559 Ga0496107_0006559_1916_2872 301
457 3300048911 Ga0496108_0059820 Ga0496108_0059820_1361_2317 301
458 3300048912 Ga0496109_0005203 Ga0496109_0005203_1277_2233 301
459 3300048912 Ga0496109_0022619 Ga0496109_0022619_3223_4179 301
460 3300048913 Ga0496110_0018731 Ga0496110_0018731_1868_2824 301
461 3300048913 Ga0496110_0044450 Ga0496110_0044450_969_1925 301
462 3300048914 Ga0496111_0015792 Ga0496111_0015792_192_1148 301
463 3300048914 Ga0496111_0043506 Ga0496111_0043506_587_1543 301
464 3300048915 Ga0496112_0040356 Ga0496112_0040356_3223_4179 301
465 3300048916 Ga0496113_0047758 Ga0496113_0047758_355_1311 301
466 3300048916 Ga0496113_0056747 Ga0496113_0056747_1190_2146 301
467 3300049669 Ga0501235_017001 Ga0501235_017001_66_1022 301
468 3300049742 Ga0501080_0047441 Ga0501080_0047441_2946_3902 301
469 3300049770 Ga0501273_001392 Ga0501273_001392_520_1476 301
470 3300050515 nmdc:mga0a205_8694_c2 nmdc:mga0a205_8694_c2_1324_2280 301
471 3300053134 Ga0500658_0000072 Ga0500658_0000072_38411_39367 301

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06166

DUF979

Protein of unknown function (DUF979)

33

344

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zdh-assembly1.cif.gz_J complex i from ovis aries at ph7.4, closed state 0.4155 3 140
6qc8-assembly1.cif.gz_D6 ovine respiratory complex i frc open class 2 0.3975 9 138
8ugc-assembly2.cif.gz_B fd15: flat repeat helix-turn-helix-turn protein 0.3253 5 297
2zcx-assembly1.cif.gz_A-2 crystal structure of tetr family transcriptional regulator sco7815 0.3244 85 291
8h8m-assembly1.cif.gz_A crystal structure of apo-e53f/e57f/e60f/e64f-rhlfr 0.3217 4 167
ID Description Score Start End Superfamily
af_Q58713_17_261_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4082 158 299 1.20.1250.20
af_P17583_1_184_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.39 156 292 1.20.1250.20
af_Q2G199_259_457_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3675 83 297 1.20.1250.20
af_Q18712_543_735_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3592 85 295 1.20.1250.20
af_F1QFN0_289_478_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3578 83 301 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A6I3UR56-F1-model_v4 deleted 0.9771 4 71
AF-A0A0R2CE86-F1-model_v4 Uncharacterized protein 0.9607 4 75 GO:0016020
AF-A0A2X5B2N3-F1-model_v4 deleted 0.9589 4 71
AF-A0A269XEU9-F1-model_v4 Uncharacterized protein 0.9576 3 71 GO:0016020
AF-W1YTR9-F1-model_v4 Membrane protein 0.9457 1 72 GO:0016020

Feature Viewer

pLDDT pTM Quality
83.97 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map