F450607

General Info

Members Datasets Scaffolds Average Seq Length
471 212 942 324

Family's Representative Sequence

Representative Sequence 3300025925|Ga0207650_10039375|Ga0207650_100393753
Length 365
Sequence VSLERPCVFPTSSADRIEEGSRTAPTRWRAAGYVDRILKGEKPGDLPVQAPTWPIGARAQQAGPMRRIGVLMSFAADDREGHTLSAAFAQGLQELGWSIGRNIRIDIRSTGGDVERIRKSAAELLTLAPDVILAASSPTVGALQQATRTAPIVFVQVTDPVGGGFVESLARPGGNATGFMLFEYSIGGKWLELLKEIAPGVTRAAVIRNPALAVGAGQLGAIQSVAPSFGVELSPIGVRAADEIERAITAFVRGPNGGLIVTGSPLARVHRALIIMLAARHRLPTVYTDRIFISDGGLISYGPDRVDQYRRAAGYVDRILKGEKPADLPDQAPTKYQLAINLKTAKVLGLTVPPTLLARADEVIE

Samples

Sample ID Description Type Environment
1 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
112 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
113 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
114 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
115 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
117 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
119 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
142 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
145 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
146 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
152 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
153 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
210 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.21
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 17.41
Rhizosphere 82.38
Stem 0
Stem Tuber 0
Unclassified 11.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207650_10039375 3300025925 Bacteria 3455
2 2214761874 2209111006 Bacteria 2962
3 ARcpr5oldR_c000126 3300000041 Bacteria 13295
4 ARcpr5yngRDRAFT_c000109 3300000043 Bacteria 12947
5 ARSoilOldRDRAFT_c000130 3300000044 Bacteria 13319
6 ARCol0yngRDRAFT_1000134 3300000652 Bacteria 13193
7 ARCol0yngRDRAFT_1001505 3300000652 Bacteria 1894
8 ARCol0yngRDRAFT_1001549 3300000652 Bacteria 1856
9 Ga0065707_10008560 3300005295 Bacteria 3024
10 Ga0070676_10052112 3300005328 Bacteria 2405
11 Ga0070670_100031069 3300005331 Bacteria 4600
12 Ga0070670_100189513 3300005331 Bacteria 1786
13 Ga0068869_100070001 3300005334 Bacteria 2595
14 Ga0068869_100247939 3300005334 Bacteria 1421
15 Ga0068868_100144800 3300005338 Unclassified 1953
16 Ga0070689_100008631 3300005340 Bacteria 7187
17 Ga0070689_100446295 3300005340 Unclassified 1100
18 Ga0070687_100054599 3300005343 Bacteria 2082
19 Ga0070661_100036009 3300005344 Bacteria 3597
20 Ga0070661_100142493 3300005344 Bacteria 1807
21 Ga0070675_100034222 3300005354 Bacteria 4122
22 Ga0070671_100081919 3300005355 Bacteria 2698
23 Ga0070659_100067758 3300005366 Bacteria 2830
24 Ga0070667_100109717 3300005367 Bacteria 2392
25 Ga0070709_10013833 3300005434 Unclassified 4548
26 Ga0070713_100047964 3300005436 Bacteria 3514
27 Ga0070713_100060713 3300005436 Unclassified 3161
28 Ga0070710_10060981 3300005437 Bacteria 2147
29 Ga0070711_100119750 3300005439 Bacteria 1945
30 Ga0070711_100310710 3300005439 Bacteria 1256
31 Ga0070700_100019269 3300005441 Bacteria 3935
32 Ga0070694_100004886 3300005444 Bacteria 8076
33 Ga0070663_100073854 3300005455 Bacteria 2488
34 Ga0070663_100119918 3300005455 Bacteria 1986
35 Ga0070678_100006452 3300005456 Bacteria 6887
36 Ga0070678_100444210 3300005456 Unclassified 1135
37 Ga0070662_100001015 3300005457 Bacteria 17167
38 Ga0070685_10017533 3300005466 Bacteria 3834
39 Ga0070698_100206676 3300005471 Bacteria 1898
40 Ga0070698_100285503 3300005471 Unclassified 1581
41 Ga0070699_100184856 3300005518 Bacteria 1850
42 Ga0070679_100296115 3300005530 Unclassified 1569
43 Ga0070686_100313713 3300005544 Bacteria 1167
44 Ga0070696_100101610 3300005546 Bacteria 2061
45 Ga0070665_100038897 3300005548 Bacteria 4783
46 Ga0070664_100185422 3300005564 Bacteria 1851
47 Ga0068857_100229367 3300005577 Bacteria 1698
48 Ga0068854_100018095 3300005578 Bacteria 4725
49 Ga0070702_100000304 3300005615 Bacteria 16912
50 Ga0068859_100555707 3300005617 Unclassified 1242
51 Ga0068866_10123313 3300005718 Bacteria 1463
52 Ga0068870_10010709 3300005840 Bacteria 4221
53 Ga0068863_100068890 3300005841 Bacteria 3346
54 Ga0068863_100350023 3300005841 Bacteria 1438
55 Ga0068860_100058068 3300005843 Bacteria 3678
56 Ga0081455_10000051 3300005937 Bacteria 123542
57 Ga0081455_10049330 3300005937 Bacteria 3629
58 Ga0081455_10312540 3300005937 Bacteria 1122
59 Ga0081540_1040823 3300005983 Unclassified 2413
60 Ga0070717_10155021 3300006028 Bacteria 1983
61 Ga0070717_10462448 3300006028 Bacteria 1144
62 Ga0070715_10079283 3300006163 Bacteria 1486
63 Ga0070712_100005668 3300006175 Bacteria 7722
64 Ga0075427_10001738 3300006194 Unclassified 2838
65 Ga0068871_100066699 3300006358 Bacteria 2951
66 Ga0068871_100251067 3300006358 Bacteria 1541
67 Ga0075428_100130103 3300006844 Bacteria 2738
68 Ga0075428_100148497 3300006844 Bacteria 2547
69 Ga0075428_100742325 3300006844 Bacteria 1045
70 Ga0075430_100057744 3300006846 Plasmid 3263
71 Ga0075431_100075421 3300006847 Plasmid 3480
72 Ga0075433_10170226 3300006852 Bacteria 1938
73 Ga0075434_100013903 3300006871 Bacteria 7678
74 Ga0075434_100215637 3300006871 Bacteria 1939
75 Ga0075429_100036975 3300006880 Plasmid 4249
76 Ga0097620_100555700 3300006931 Unclassified 1242
77 Ga0075435_100048625 3300007076 Unclassified 3407
78 Ga0075435_100273637 3300007076 Bacteria 1441
79 Ga0075435_100284279 3300007076 Unclassified 1412
80 Ga0111539_10001814 3300009094 Bacteria 28447
81 Ga0111539_10731337 3300009094 Bacteria 1152
82 Ga0105247_10003448 3300009101 Bacteria 10307
83 Ga0105247_10291067 3300009101 Bacteria 1130
84 Ga0114129_10195330 3300009147 Bacteria 2744
85 Ga0105242_10015191 3300009176 Bacteria 5978
86 Ga0105248_10025285 3300009177 Bacteria 6602
87 Ga0105249_10076293 3300009553 Bacteria 3106
88 Ga0105239_10019558 3300010375 Bacteria 7475
89 Ga0105239_10045317 3300010375 Bacteria 4820
90 Ga0105246_10027441 3300011119 Bacteria 3730
91 Ga0105246_10035846 3300011119 Bacteria 3319
92 Ga0157374_10019171 3300013296 Bacteria 6052
93 Ga0157378_10001571 3300013297 Bacteria 20630
94 Ga0163162_10239851 3300013306 Bacteria 1944
95 Ga0157375_10085182 3300013308 Bacteria 3210
96 Ga0163163_10040154 3300014325 Bacteria 4568
97 Ga0163163_10056029 3300014325 Bacteria 3896
98 Ga0163163_10181634 3300014325 Bacteria 2151
99 Ga0157377_10064027 3300014745 Unclassified 2108
100 Ga0157379_10051106 3300014968 Bacteria 3692
101 Ga0157379_10065617 3300014968 Bacteria 3245
102 Ga0157376_10069563 3300014969 Bacteria 2984
103 Ga0157376_10097414 3300014969 Bacteria 2562
104 Ga0157376_10283397 3300014969 Bacteria 1561
105 Ga0157376_10427676 3300014969 Bacteria 1286
106 Ga0157376_10448852 3300014969 Bacteria 1257
107 Ga0163161_10245532 3300017792 Bacteria 1394
108 Ga0207697_10004552 3300025315 Bacteria 6604
109 Ga0207692_10207084 3300025898 Bacteria 1156
110 Ga0207685_10009551 3300025905 Bacteria 2823
111 Ga0207699_10298883 3300025906 Bacteria 1124
112 Ga0207645_10061188 3300025907 Bacteria 2405
113 Ga0207643_10033774 3300025908 Bacteria 2863
114 Ga0207684_10522192 3300025910 Bacteria 1017
115 Ga0207693_10035897 3300025915 Bacteria 3907
116 Ga0207693_10250227 3300025915 Unclassified 1391
117 Ga0207662_10103045 3300025918 Bacteria 1770
118 Ga0207650_10152378 3300025925 Bacteria 1825
119 Ga0207659_10038707 3300025926 Bacteria 3319
120 Ga0207687_10033875 3300025927 Bacteria 3466
121 Ga0207700_10202033 3300025928 Bacteria 1675
122 Ga0207664_10109858 3300025929 Bacteria 2292
123 Ga0207644_10005309 3300025931 Bacteria 8408
124 Ga0207644_10022530 3300025931 Bacteria 4304
125 Ga0207644_10222973 3300025931 Bacteria 1495
126 Ga0207644_10398021 3300025931 Unclassified 1125
127 Ga0207706_10002761 3300025933 Bacteria 17071
128 Ga0207686_10374642 3300025934 Unclassified 1078
129 Ga0207670_10007403 3300025936 Bacteria 6125
130 Ga0207669_10017406 3300025937 Bacteria 3685
131 Ga0207665_10000983 3300025939 Bacteria 19278
132 Ga0207711_10011795 3300025941 Bacteria 7261
133 Ga0207661_10171679 3300025944 Bacteria 1888
134 Ga0207679_10022462 3300025945 Bacteria 4297
135 Ga0207712_10063186 3300025961 Bacteria 2635
136 Ga0207668_10259679 3300025972 Bacteria 1415
137 Ga0207640_10033659 3300025981 Bacteria 3191
138 Ga0207677_10136175 3300026023 Bacteria 1873
139 Ga0207703_10197926 3300026035 Bacteria 1784
140 Ga0207678_10002382 3300026067 Bacteria 17071
141 Ga0207708_10118040 3300026075 Bacteria 2065
142 Ga0207641_10102388 3300026088 Bacteria 2525
143 Ga0207674_10247951 3300026116 Bacteria 1728
144 Ga0207683_10010370 3300026121 Bacteria 7949
145 Ga0207428_10013962 3300027907 Bacteria 6995
146 Ga0207428_10053824 3300027907 Unclassified 3208
147 Ga0268264_10042926 3300028381 Bacteria 3745
148 Ga0265763_1000100 3300030763 Bacteria 3936
149 Ga0373958_0011934 3300034819 Unclassified 1479
150 Ga0373938_0001317 3300034957 Unclassified 3988
151 Ga0373926_0006680 3300035083 Bacteria 3830
152 Ga0373926_0057550 3300035083 Bacteria 1412
153 Ga0373951_0000904 3300035091 Bacteria 7981
154 Ga0373923_0186693 3300035111 Bacteria 954
155 Ga0373932_0029889 3300035112 Unclassified 1507
156 Ga0373936_0006948 3300035113 Bacteria 4260
157 Ga0373936_0037167 3300035113 Bacteria 1944
158 Ga0373939_0050621 3300035114 Bacteria 1289
159 Ga0373941_0004910 3300035115 Bacteria 3117
160 Ga0373953_0133290 3300035117 Bacteria 1060
161 Ga0373960_0004461 3300035121 Bacteria 3209
162 Ga0373943_0015175 3300035170 Unclassified 3497
163 Ga0373943_0024490 3300035170 Bacteria 2814
164 Ga0373943_0029490 3300035170 Bacteria 2592
165 Ga0373943_0050378 3300035170 Bacteria 2046
166 Ga0373946_0018287 3300035171 Bacteria 2690
167 Ga0373946_0043272 3300035171 Bacteria 1855
168 Ga0373946_0062651 3300035171 Unclassified 1586
169 Ga0373946_0066137 3300035171 Bacteria 1549
170 Ga0373955_0045152 3300035172 Bacteria 2377
171 Ga0373924_0062241 3300035410 Bacteria 1563
172 Ga0373931_0021517 3300035691 Bacteria 3237
173 Ga0373931_0027426 3300035691 Bacteria 2907
174 Ga0373935_0012182 3300035692 Bacteria 5171
175 Ga0373935_0017011 3300035692 Bacteria 4405
176 Ga0373935_0036032 3300035692 Bacteria 3091
177 Ga0373935_0048174 3300035692 Bacteria 2698
178 Ga0373935_0124057 3300035692 Bacteria 1728
179 Ga0373927_0006630 3300035695 Bacteria 7885
180 Ga0373927_0008367 3300035695 Bacteria 6965
181 Ga0373927_0015710 3300035695 Bacteria 4998
182 Ga0373927_0057844 3300035695 Unclassified 2507
183 Ga0373927_0280306 3300035695 Bacteria 1096
184 Ga0373933_0124878 3300035724 Unclassified 1614
185 Ga0373947_0001350 3300035725 Bacteria 15076
186 Ga0373947_0011946 3300035725 Bacteria 4975
187 Ga0373947_0099855 3300035725 Bacteria 1822
188 Ga0373947_0193997 3300035725 Bacteria 1326
189 Ga0373937_0010797 3300036401 Bacteria 7994
190 Ga0373937_0017507 3300036401 Bacteria 6386
191 Ga0373937_0397136 3300036401 Bacteria 1308
192 Ga0373937_0461036 3300036401 Bacteria 1207
193 Ga0373925_0014999 3300037068 Bacteria 5602
194 Ga0373925_0088461 3300037068 Bacteria 2365
195 Ga0373925_0097364 3300037068 Bacteria 2256
196 Ga0373925_0098424 3300037068 Bacteria 2245
197 Ga0373925_0194761 3300037068 Bacteria 1609
198 Ga0373925_0385224 3300037068 Bacteria 1142
199 Ga0495592_0191595 3300046454 Unclassified 1385
200 Ga0495603_0014537 3300046455 Bacteria 4761
201 Ga0495603_0032047 3300046455 Bacteria 3163
202 Ga0495603_0071611 3300046455 Bacteria 2037
203 Ga0495629_0005305 3300046459 Bacteria 9637
204 Ga0495629_0005882 3300046459 Bacteria 9141
205 Ga0495629_0031610 3300046459 Bacteria 3747
206 Ga0495629_0043771 3300046459 Unclassified 3143
207 Ga0495629_0048797 3300046459 Bacteria 2968
208 Ga0495629_0075465 3300046459 Bacteria 2354
209 Ga0495641_0013000 3300046461 Bacteria 4609
210 Ga0495641_0021068 3300046461 Bacteria 3288
211 Ga0495641_0061779 3300046461 Bacteria 1690
212 Ga0495651_0026190 3300046462 Bacteria 4542
213 Ga0495653_0007716 3300046463 Bacteria 8804
214 Ga0495580_0015880 3300046472 Bacteria 5667
215 Ga0495580_0107495 3300046472 Bacteria 1937
216 Ga0495582_0060826 3300046473 Bacteria 2084
217 Ga0495582_0062260 3300046473 Bacteria 2061
218 Ga0495639_0029271 3300046475 Bacteria 2444
219 Ga0495639_0100583 3300046475 Bacteria 1364
220 Ga0495639_0138432 3300046475 Bacteria 1169
221 Ga0495662_0009059 3300046476 Bacteria 4888
222 Ga0495662_0021454 3300046476 Bacteria 3121
223 Ga0495662_0059082 3300046476 Bacteria 1852
224 Ga0495662_0073749 3300046476 Bacteria 1655
225 Ga0495662_0089995 3300046476 Bacteria 1496
226 Ga0495664_0047084 3300046477 Unclassified 2558
227 Ga0495664_0050200 3300046477 Bacteria 2477
228 Ga0495664_0082463 3300046477 Bacteria 1928
229 Ga0495664_0095195 3300046477 Bacteria 1793
230 Ga0495585_0002400 3300046492 Bacteria 13432
231 Ga0495585_0195041 3300046492 Bacteria 1034
232 Ga0495594_0025553 3300046499 Bacteria 3174
233 Ga0495594_0028066 3300046499 Bacteria 3035
234 Ga0495594_0054346 3300046499 Bacteria 2207
235 Ga0495594_0094678 3300046499 Bacteria 1676
236 Ga0495594_0207752 3300046499 Bacteria 1116
237 Ga0495607_0046613 3300046501 Bacteria 2544
238 Ga0495608_0040282 3300046511 Bacteria 3130
239 Ga0495618_0009290 3300046514 Bacteria 5933
240 Ga0495618_0022382 3300046514 Bacteria 3903
241 Ga0495618_0034563 3300046514 Bacteria 3170
242 Ga0495618_0094692 3300046514 Bacteria 1909
243 Ga0495628_0052953 3300046516 Bacteria 3205
244 Ga0495630_0015035 3300046517 Bacteria 5648
245 Ga0495630_0036160 3300046517 Bacteria 3692
246 Ga0495630_0055178 3300046517 Bacteria 2977
247 Ga0495630_0331178 3300046517 Unclassified 1164
248 Ga0495637_0087521 3300046520 Bacteria 1233
249 Ga0495644_0005257 3300046523 Bacteria 5059
250 Ga0495666_0024965 3300046526 Bacteria 2953
251 Ga0495666_0033987 3300046526 Unclassified 2489
252 Ga0495666_0063744 3300046526 Bacteria 1759
253 Ga0495666_0149176 3300046526 Bacteria 1088
254 Ga0495652_0050036 3300046529 Bacteria 3575
255 Ga0495652_0075402 3300046529 Bacteria 2801
256 Ga0495652_0107756 3300046529 Bacteria 2247
257 Ga0495652_0152735 3300046529 Bacteria 1802
258 Ga0495665_0031372 3300046531 Bacteria 2844
259 Ga0495665_0065108 3300046531 Bacteria 1924
260 Ga0495640_0007921 3300046533 Bacteria 8355
261 Ga0495640_0011043 3300046533 Bacteria 6955
262 Ga0495640_0032164 3300046533 Bacteria 3738
263 Ga0495640_0057885 3300046533 Bacteria 2644
264 Ga0495640_0069004 3300046533 Bacteria 2378
265 Ga0495640_0236529 3300046533 Unclassified 1147
266 Ga0495640_0292476 3300046533 Unclassified 1013
267 Ga0495586_0096298 3300046535 Bacteria 1639
268 Ga0495598_0036449 3300046537 Bacteria 1413
269 Ga0495633_0006307 3300046558 Bacteria 7064
270 Ga0495667_0007192 3300046559 Bacteria 7552
271 Ga0495656_0001063 3300046615 Bacteria 8886
272 Ga0495668_0040142 3300046616 Bacteria 2611
273 Ga0495634_0010649 3300046642 Bacteria 6731
274 Ga0495634_0011896 3300046642 Bacteria 6321
275 Ga0495634_0023842 3300046642 Bacteria 4298
276 Ga0495634_0028927 3300046642 Bacteria 3841
277 Ga0495634_0063994 3300046642 Bacteria 2439
278 Ga0495634_0161006 3300046642 Unclassified 1415
279 Ga0495635_0003087 3300046663 Bacteria 11460
280 Ga0495635_0004934 3300046663 Bacteria 9286
281 Ga0495635_0063266 3300046663 Bacteria 2541
282 Ga0495635_0202901 3300046663 Bacteria 1344
283 Ga0495659_0003245 3300046664 Bacteria 5213
284 Ga0495588_0075358 3300046674 Bacteria 1757
285 Ga0495599_0101089 3300046678 Bacteria 1797
286 Ga0495599_0172196 3300046678 Bacteria 1335
287 Ga0495647_0009497 3300046681 Unclassified 3297
288 Ga0495647_0019889 3300046681 Bacteria 2405
289 Ga0495647_0034182 3300046681 Bacteria 1903
290 Ga0495647_0090603 3300046681 Bacteria 1253
291 Ga0495647_0091151 3300046681 Bacteria 1250
292 Ga0495658_0006140 3300046683 Bacteria 5894
293 Ga0495658_0006973 3300046683 Bacteria 5573
294 Ga0495658_0022905 3300046683 Bacteria 3309
295 Ga0495658_0029346 3300046683 Bacteria 2977
296 Ga0495658_0051460 3300046683 Bacteria 2333
297 Ga0495658_0071737 3300046683 Unclassified 2013
298 Ga0495613_0024971 3300046689 Bacteria 4454
299 Ga0495613_0026269 3300046689 Bacteria 4339
300 Ga0495613_0045346 3300046689 Bacteria 3252
301 Ga0495613_0055757 3300046689 Bacteria 2903
302 Ga0495613_0063488 3300046689 Bacteria 2702
303 Ga0495613_0123887 3300046689 Archaea 1854
304 Ga0495624_0005296 3300046690 Bacteria 9318
305 Ga0495624_0012490 3300046690 Bacteria 5801
306 Ga0495624_0014425 3300046690 Bacteria 5362
307 Ga0495624_0058605 3300046690 Bacteria 2418
308 Ga0495670_0011573 3300046691 Bacteria 4340
309 Ga0495600_0008477 3300046809 Bacteria 6316
310 Ga0495600_0064640 3300046809 Bacteria 2392
311 Ga0495581_0028155 3300047315 Bacteria 3257
312 Ga0495581_0125245 3300047315 Bacteria 1496
313 Ga0495581_0181950 3300047315 Bacteria 1229
314 Ga0495604_0249541 3300047317 Unclassified 1210
315 Ga0495674_0001565 3300047319 Bacteria 22422
316 Ga0495674_0013177 3300047319 Bacteria 7773
317 Ga0495674_0020141 3300047319 Bacteria 6181
318 Ga0495674_0263202 3300047319 Unclassified 1416
319 Ga0495674_0392549 3300047319 Unclassified 1121
320 Ga0495672_0175306 3300047320 Bacteria 1090
321 Ga0495676_0034960 3300047321 Bacteria 4209
322 Ga0495676_0035422 3300047321 Bacteria 4174
323 Ga0495676_0065837 3300047321 Bacteria 2811
324 Ga0495676_0116654 3300047321 Bacteria 1949
325 Ga0495676_0121263 3300047321 Bacteria 1901
326 Ga0495676_0139442 3300047321 Unclassified 1739
327 Ga0495680_0002556 3300047322 Bacteria 18572
328 Ga0495680_0017977 3300047322 Bacteria 6015
329 Ga0495680_0049596 3300047322 Unclassified 3288
330 Ga0495680_0069790 3300047322 Bacteria 2680
331 Ga0495680_0195498 3300047322 Unclassified 1453
332 Ga0495684_0000745 3300047471 Bacteria 26228
333 Ga0495684_0002858 3300047471 Bacteria 13590
334 Ga0495684_0006291 3300047471 Bacteria 9228
335 Ga0495684_0033860 3300047471 Bacteria 3919
336 Ga0495684_0152960 3300047471 Bacteria 1724
337 Ga0495684_0253835 3300047471 Unclassified 1278
338 Ga0495593_0027230 3300047673 Bacteria 3148
339 Ga0495593_0040101 3300047673 Bacteria 2522
340 Ga0495614_0027654 3300048089 Unclassified 2445
341 Ga0496100_0008106 3300048903 Bacteria 5845
342 Ga0496100_0137516 3300048903 Bacteria 1728
343 Ga0496100_0186767 3300048903 Bacteria 1502
344 Ga0496101_0000827 3300048904 Bacteria 18233
345 Ga0496101_0024369 3300048904 Bacteria 4187
346 Ga0496101_0082573 3300048904 Bacteria 2378
347 Ga0496101_0161122 3300048904 Bacteria 1720
348 Ga0496102_0076980 3300048905 Bacteria 3070
349 Ga0496102_0105086 3300048905 Bacteria 2627
350 Ga0496102_0127666 3300048905 Bacteria 2378
351 Ga0496102_0325770 3300048905 Bacteria 1447
352 Ga0496103_0010651 3300048906 Bacteria 5440
353 Ga0496103_0011042 3300048906 Bacteria 5347
354 Ga0496103_0104841 3300048906 Bacteria 1792
355 Ga0496104_0001871 3300048907 Bacteria 18216
356 Ga0496104_0002744 3300048907 Bacteria 15154
357 Ga0496104_0003903 3300048907 Bacteria 12908
358 Ga0496104_0016937 3300048907 Bacteria 6630
359 Ga0496104_0018121 3300048907 Bacteria 6420
360 Ga0496104_0032277 3300048907 Bacteria 4873
361 Ga0496104_0034384 3300048907 Bacteria 4726
362 Ga0496104_0036088 3300048907 Bacteria 4618
363 Ga0496104_0043374 3300048907 Bacteria 4225
364 Ga0496104_0051832 3300048907 Bacteria 3874
365 Ga0496105_0009814 3300048908 Bacteria 7500
366 Ga0496105_0018124 3300048908 Bacteria 5652
367 Ga0496105_0026957 3300048908 Bacteria 4690
368 Ga0496105_0031933 3300048908 Bacteria 4318
369 Ga0496105_0033524 3300048908 Bacteria 4217
370 Ga0496105_0046500 3300048908 Bacteria 3582
371 Ga0496105_0072579 3300048908 Bacteria 2844
372 Ga0496105_0078019 3300048908 Bacteria 2735
373 Ga0496105_0094242 3300048908 Bacteria 2473
374 Ga0496105_0211351 3300048908 Bacteria 1581
375 Ga0496105_0229321 3300048908 Bacteria 1509
376 Ga0496106_0000763 3300048909 Bacteria 23263
377 Ga0496106_0008098 3300048909 Bacteria 7764
378 Ga0496106_0018043 3300048909 Bacteria 5217
379 Ga0496106_0065209 3300048909 Bacteria 2773
380 Ga0496107_0025390 3300048910 Bacteria 4195
381 Ga0496107_0039757 3300048910 Bacteria 3374
382 Ga0496107_0119688 3300048910 Bacteria 1939
383 Ga0496107_0379762 3300048910 Bacteria 1051
384 Ga0496108_0003420 3300048911 Bacteria 12741
385 Ga0496108_0018879 3300048911 Bacteria 5653
386 Ga0496108_0030172 3300048911 Unclassified 4493
387 Ga0496108_0058780 3300048911 Bacteria 3232
388 Ga0496108_0149500 3300048911 Bacteria 2015
389 Ga0496108_0172623 3300048911 Bacteria 1871
390 Ga0496108_0248199 3300048911 Bacteria 1548
391 Ga0496108_0436025 3300048911 Bacteria 1144
392 Ga0496108_0515627 3300048911 Bacteria 1044
393 Ga0496109_0001731 3300048912 Bacteria 18218
394 Ga0496109_0008898 3300048912 Bacteria 8553
395 Ga0496109_0018595 3300048912 Bacteria 6105
396 Ga0496109_0119796 3300048912 Bacteria 2451
397 Ga0496110_0001745 3300048913 Bacteria 16025
398 Ga0496110_0017691 3300048913 Bacteria 5962
399 Ga0496110_0021070 3300048913 Bacteria 5511
400 Ga0496111_0005280 3300048914 Bacteria 8247
401 Ga0496111_0072102 3300048914 Bacteria 2514
402 Ga0496111_0113052 3300048914 Bacteria 2000
403 Ga0496112_0001208 3300048915 Bacteria 19395
404 Ga0496112_0006883 3300048915 Bacteria 10025
405 Ga0496112_0028699 3300048915 Bacteria 5374
406 Ga0496112_0038186 3300048915 Bacteria 4689
407 Ga0496112_0049899 3300048915 Bacteria 4102
408 Ga0496112_0062240 3300048915 Bacteria 3681
409 Ga0496112_0133461 3300048915 Bacteria 2453
410 Ga0496113_0001177 3300048916 Bacteria 14299
411 Ga0496113_0013676 3300048916 Bacteria 5510
412 Ga0496113_0056926 3300048916 Bacteria 2936
413 Ga0496114_0038351 3300048917 Bacteria 3964
414 Ga0496114_0356322 3300048917 Bacteria 1294
415 Ga0496114_0444599 3300048917 Unclassified 1148
416 Ga0496115_0006597 3300048918 Bacteria 8506
417 Ga0496115_0033140 3300048918 Bacteria 4077
418 Ga0496115_0054057 3300048918 Bacteria 3224
419 Ga0496115_0102186 3300048918 Bacteria 2351
420 Ga0496115_0108673 3300048918 Bacteria 2277
421 Ga0496115_0209690 3300048918 Bacteria 1609
422 Ga0496115_0256343 3300048918 Bacteria 1439
423 nmdc:mga05p37_162837_c1 3300050507 Bacteria 2724
424 nmdc:mga05p37_22983_c1 3300050507 Bacteria 7563
425 nmdc:mga05p37_62426_c1 3300050507 Plasmid 4586
426 nmdc:mga09592_44056_c1 3300050508 Unclassified 3755
427 nmdc:mga09592_60476_c1 3300050508 Unclassified 3203
428 nmdc:mga0qj67_30250_c1 3300050509 Unclassified 4213
429 nmdc:mga06r32_106000_c1 3300050510 Unclassified 2762
430 nmdc:mga06r32_85126_c1 3300050510 Unclassified 3083
431 nmdc:mga08y16_19964_c1 3300050511 Bacteria 7071
432 nmdc:mga08y16_5778_c1 3300050511 Bacteria 12957
433 nmdc:mga0n895_13698_c1 3300050512 Bacteria 7331
434 nmdc:mga0n895_193174_c1 3300050512 Bacteria 2067
435 nmdc:mga0n895_225157_c1 3300050512 Bacteria 1904
436 nmdc:mga0n895_307775_c1 3300050512 Bacteria 1606
437 nmdc:mga0n895_372401_c1 3300050512 Bacteria 1446
438 nmdc:mga0rr50_14457_c1 3300050513 Unclassified 3529
439 nmdc:mga0rr50_245642_c1 3300050513 Bacteria 1485
440 nmdc:mga0rr50_421861_c1 3300050513 Bacteria 1129
441 nmdc:mga08x19_102687_c1 3300050514 Bacteria 1899
442 nmdc:mga0a205_4531_c1 3300050515 Bacteria 12473
443 Ga0495601_0002378 3300053077 Bacteria 10668
444 Ga0495601_0022997 3300053077 Bacteria 3830
445 Ga0495601_0037601 3300053077 Unclassified 3027
446 Ga0495601_0043924 3300053077 Bacteria 2808
447 Ga0495601_0107732 3300053077 Bacteria 1803
448 Ga0495601_0161114 3300053077 Bacteria 1466
449 Ga0495601_0168962 3300053077 Bacteria 1429
450 Ga0495601_0196524 3300053077 Bacteria 1318
451 Ga0495612_0003725 3300053078 Bacteria 6333
452 Ga0495612_0142936 3300053078 Unclassified 1039
453 Ga0495595_0006233 3300053084 Bacteria 4854
454 Ga0495595_0027364 3300053084 Bacteria 2540
455 Ga0495595_0077206 3300053084 Bacteria 1582
456 Ga0495595_0086332 3300053084 Bacteria 1501
457 Ga0495619_0000985 3300053085 Bacteria 18668
458 Ga0495619_0001879 3300053085 Bacteria 13991
459 Ga0495619_0003302 3300053085 Bacteria 10425
460 Ga0495619_0004391 3300053085 Bacteria 8994
461 Ga0495619_0006861 3300053085 Bacteria 7200
462 Ga0495619_0008684 3300053085 Bacteria 6426
463 Ga0495619_0020534 3300053085 Archaea 4208
464 Ga0495619_0032445 3300053085 Bacteria 3389
465 Ga0495619_0051660 3300053085 Bacteria 2717
466 Ga0495619_0068845 3300053085 Bacteria 2365
467 Ga0495619_0092124 3300053085 Bacteria 2053
468 Ga0495619_0136104 3300053085 Bacteria 1690
469 Ga0495619_0193298 3300053085 Unclassified 1408
470 Ga0495619_0200570 3300053085 Bacteria 1381
471 2885383219 2885374607 Bacteria 8927485
472 Ga0207650_10039375
473 2214761874
474 ARcpr5oldR_c000126
475 ARcpr5yngRDRAFT_c000109
476 ARSoilOldRDRAFT_c000130
477 ARCol0yngRDRAFT_1000134
478 ARCol0yngRDRAFT_1001505
479 ARCol0yngRDRAFT_1001549
480 Ga0065707_10008560
481 Ga0070676_10052112
482 Ga0070670_100031069
483 Ga0070670_100189513
484 Ga0068869_100070001
485 Ga0068869_100247939
486 Ga0068868_100144800
487 Ga0070689_100008631
488 Ga0070689_100446295
489 Ga0070687_100054599
490 Ga0070661_100036009
491 Ga0070661_100142493
492 Ga0070675_100034222
493 Ga0070671_100081919
494 Ga0070659_100067758
495 Ga0070667_100109717
496 Ga0070709_10013833
497 Ga0070713_100047964
498 Ga0070713_100060713
499 Ga0070710_10060981
500 Ga0070711_100119750
501 Ga0070711_100310710
502 Ga0070700_100019269
503 Ga0070694_100004886
504 Ga0070663_100073854
505 Ga0070663_100119918
506 Ga0070678_100006452
507 Ga0070678_100444210
508 Ga0070662_100001015
509 Ga0070685_10017533
510 Ga0070698_100206676
511 Ga0070698_100285503
512 Ga0070699_100184856
513 Ga0070679_100296115
514 Ga0070686_100313713
515 Ga0070696_100101610
516 Ga0070665_100038897
517 Ga0070664_100185422
518 Ga0068857_100229367
519 Ga0068854_100018095
520 Ga0070702_100000304
521 Ga0068859_100555707
522 Ga0068866_10123313
523 Ga0068870_10010709
524 Ga0068863_100068890
525 Ga0068863_100350023
526 Ga0068860_100058068
527 Ga0081455_10000051
528 Ga0081455_10049330
529 Ga0081455_10312540
530 Ga0081540_1040823
531 Ga0070717_10155021
532 Ga0070717_10462448
533 Ga0070715_10079283
534 Ga0070712_100005668
535 Ga0075427_10001738
536 Ga0068871_100066699
537 Ga0068871_100251067
538 Ga0075428_100130103
539 Ga0075428_100148497
540 Ga0075428_100742325
541 Ga0075430_100057744
542 Ga0075431_100075421
543 Ga0075433_10170226
544 Ga0075434_100013903
545 Ga0075434_100215637
546 Ga0075429_100036975
547 Ga0097620_100555700
548 Ga0075435_100048625
549 Ga0075435_100273637
550 Ga0075435_100284279
551 Ga0111539_10001814
552 Ga0111539_10731337
553 Ga0105247_10003448
554 Ga0105247_10291067
555 Ga0114129_10195330
556 Ga0105242_10015191
557 Ga0105248_10025285
558 Ga0105249_10076293
559 Ga0105239_10019558
560 Ga0105239_10045317
561 Ga0105246_10027441
562 Ga0105246_10035846
563 Ga0157374_10019171
564 Ga0157378_10001571
565 Ga0163162_10239851
566 Ga0157375_10085182
567 Ga0163163_10040154
568 Ga0163163_10056029
569 Ga0163163_10181634
570 Ga0157377_10064027
571 Ga0157379_10051106
572 Ga0157379_10065617
573 Ga0157376_10069563
574 Ga0157376_10097414
575 Ga0157376_10283397
576 Ga0157376_10427676
577 Ga0157376_10448852
578 Ga0163161_10245532
579 Ga0207697_10004552
580 Ga0207692_10207084
581 Ga0207685_10009551
582 Ga0207699_10298883
583 Ga0207645_10061188
584 Ga0207643_10033774
585 Ga0207684_10522192
586 Ga0207693_10035897
587 Ga0207693_10250227
588 Ga0207662_10103045
589 Ga0207650_10152378
590 Ga0207659_10038707
591 Ga0207687_10033875
592 Ga0207700_10202033
593 Ga0207664_10109858
594 Ga0207644_10005309
595 Ga0207644_10022530
596 Ga0207644_10222973
597 Ga0207644_10398021
598 Ga0207706_10002761
599 Ga0207686_10374642
600 Ga0207670_10007403
601 Ga0207669_10017406
602 Ga0207665_10000983
603 Ga0207711_10011795
604 Ga0207661_10171679
605 Ga0207679_10022462
606 Ga0207712_10063186
607 Ga0207668_10259679
608 Ga0207640_10033659
609 Ga0207677_10136175
610 Ga0207703_10197926
611 Ga0207678_10002382
612 Ga0207708_10118040
613 Ga0207641_10102388
614 Ga0207674_10247951
615 Ga0207683_10010370
616 Ga0207428_10013962
617 Ga0207428_10053824
618 Ga0268264_10042926
619 Ga0265763_1000100
620 Ga0373958_0011934
621 Ga0373938_0001317
622 Ga0373926_0006680
623 Ga0373926_0057550
624 Ga0373951_0000904
625 Ga0373923_0186693
626 Ga0373932_0029889
627 Ga0373936_0006948
628 Ga0373936_0037167
629 Ga0373939_0050621
630 Ga0373941_0004910
631 Ga0373953_0133290
632 Ga0373960_0004461
633 Ga0373943_0015175
634 Ga0373943_0024490
635 Ga0373943_0029490
636 Ga0373943_0050378
637 Ga0373946_0018287
638 Ga0373946_0043272
639 Ga0373946_0062651
640 Ga0373946_0066137
641 Ga0373955_0045152
642 Ga0373924_0062241
643 Ga0373931_0021517
644 Ga0373931_0027426
645 Ga0373935_0012182
646 Ga0373935_0017011
647 Ga0373935_0036032
648 Ga0373935_0048174
649 Ga0373935_0124057
650 Ga0373927_0006630
651 Ga0373927_0008367
652 Ga0373927_0015710
653 Ga0373927_0057844
654 Ga0373927_0280306
655 Ga0373933_0124878
656 Ga0373947_0001350
657 Ga0373947_0011946
658 Ga0373947_0099855
659 Ga0373947_0193997
660 Ga0373937_0010797
661 Ga0373937_0017507
662 Ga0373937_0397136
663 Ga0373937_0461036
664 Ga0373925_0014999
665 Ga0373925_0088461
666 Ga0373925_0097364
667 Ga0373925_0098424
668 Ga0373925_0194761
669 Ga0373925_0385224
670 Ga0495592_0191595
671 Ga0495603_0014537
672 Ga0495603_0032047
673 Ga0495603_0071611
674 Ga0495629_0005305
675 Ga0495629_0005882
676 Ga0495629_0031610
677 Ga0495629_0043771
678 Ga0495629_0048797
679 Ga0495629_0075465
680 Ga0495641_0013000
681 Ga0495641_0021068
682 Ga0495641_0061779
683 Ga0495651_0026190
684 Ga0495653_0007716
685 Ga0495580_0015880
686 Ga0495580_0107495
687 Ga0495582_0060826
688 Ga0495582_0062260
689 Ga0495639_0029271
690 Ga0495639_0100583
691 Ga0495639_0138432
692 Ga0495662_0009059
693 Ga0495662_0021454
694 Ga0495662_0059082
695 Ga0495662_0073749
696 Ga0495662_0089995
697 Ga0495664_0047084
698 Ga0495664_0050200
699 Ga0495664_0082463
700 Ga0495664_0095195
701 Ga0495585_0002400
702 Ga0495585_0195041
703 Ga0495594_0025553
704 Ga0495594_0028066
705 Ga0495594_0054346
706 Ga0495594_0094678
707 Ga0495594_0207752
708 Ga0495607_0046613
709 Ga0495608_0040282
710 Ga0495618_0009290
711 Ga0495618_0022382
712 Ga0495618_0034563
713 Ga0495618_0094692
714 Ga0495628_0052953
715 Ga0495630_0015035
716 Ga0495630_0036160
717 Ga0495630_0055178
718 Ga0495630_0331178
719 Ga0495637_0087521
720 Ga0495644_0005257
721 Ga0495666_0024965
722 Ga0495666_0033987
723 Ga0495666_0063744
724 Ga0495666_0149176
725 Ga0495652_0050036
726 Ga0495652_0075402
727 Ga0495652_0107756
728 Ga0495652_0152735
729 Ga0495665_0031372
730 Ga0495665_0065108
731 Ga0495640_0007921
732 Ga0495640_0011043
733 Ga0495640_0032164
734 Ga0495640_0057885
735 Ga0495640_0069004
736 Ga0495640_0236529
737 Ga0495640_0292476
738 Ga0495586_0096298
739 Ga0495598_0036449
740 Ga0495633_0006307
741 Ga0495667_0007192
742 Ga0495656_0001063
743 Ga0495668_0040142
744 Ga0495634_0010649
745 Ga0495634_0011896
746 Ga0495634_0023842
747 Ga0495634_0028927
748 Ga0495634_0063994
749 Ga0495634_0161006
750 Ga0495635_0003087
751 Ga0495635_0004934
752 Ga0495635_0063266
753 Ga0495635_0202901
754 Ga0495659_0003245
755 Ga0495588_0075358
756 Ga0495599_0101089
757 Ga0495599_0172196
758 Ga0495647_0009497
759 Ga0495647_0019889
760 Ga0495647_0034182
761 Ga0495647_0090603
762 Ga0495647_0091151
763 Ga0495658_0006140
764 Ga0495658_0006973
765 Ga0495658_0022905
766 Ga0495658_0029346
767 Ga0495658_0051460
768 Ga0495658_0071737
769 Ga0495613_0024971
770 Ga0495613_0026269
771 Ga0495613_0045346
772 Ga0495613_0055757
773 Ga0495613_0063488
774 Ga0495613_0123887
775 Ga0495624_0005296
776 Ga0495624_0012490
777 Ga0495624_0014425
778 Ga0495624_0058605
779 Ga0495670_0011573
780 Ga0495600_0008477
781 Ga0495600_0064640
782 Ga0495581_0028155
783 Ga0495581_0125245
784 Ga0495581_0181950
785 Ga0495604_0249541
786 Ga0495674_0001565
787 Ga0495674_0013177
788 Ga0495674_0020141
789 Ga0495674_0263202
790 Ga0495674_0392549
791 Ga0495672_0175306
792 Ga0495676_0034960
793 Ga0495676_0035422
794 Ga0495676_0065837
795 Ga0495676_0116654
796 Ga0495676_0121263
797 Ga0495676_0139442
798 Ga0495680_0002556
799 Ga0495680_0017977
800 Ga0495680_0049596
801 Ga0495680_0069790
802 Ga0495680_0195498
803 Ga0495684_0000745
804 Ga0495684_0002858
805 Ga0495684_0006291
806 Ga0495684_0033860
807 Ga0495684_0152960
808 Ga0495684_0253835
809 Ga0495593_0027230
810 Ga0495593_0040101
811 Ga0495614_0027654
812 Ga0496100_0008106
813 Ga0496100_0137516
814 Ga0496100_0186767
815 Ga0496101_0000827
816 Ga0496101_0024369
817 Ga0496101_0082573
818 Ga0496101_0161122
819 Ga0496102_0076980
820 Ga0496102_0105086
821 Ga0496102_0127666
822 Ga0496102_0325770
823 Ga0496103_0010651
824 Ga0496103_0011042
825 Ga0496103_0104841
826 Ga0496104_0001871
827 Ga0496104_0002744
828 Ga0496104_0003903
829 Ga0496104_0016937
830 Ga0496104_0018121
831 Ga0496104_0032277
832 Ga0496104_0034384
833 Ga0496104_0036088
834 Ga0496104_0043374
835 Ga0496104_0051832
836 Ga0496105_0009814
837 Ga0496105_0018124
838 Ga0496105_0026957
839 Ga0496105_0031933
840 Ga0496105_0033524
841 Ga0496105_0046500
842 Ga0496105_0072579
843 Ga0496105_0078019
844 Ga0496105_0094242
845 Ga0496105_0211351
846 Ga0496105_0229321
847 Ga0496106_0000763
848 Ga0496106_0008098
849 Ga0496106_0018043
850 Ga0496106_0065209
851 Ga0496107_0025390
852 Ga0496107_0039757
853 Ga0496107_0119688
854 Ga0496107_0379762
855 Ga0496108_0003420
856 Ga0496108_0018879
857 Ga0496108_0030172
858 Ga0496108_0058780
859 Ga0496108_0149500
860 Ga0496108_0172623
861 Ga0496108_0248199
862 Ga0496108_0436025
863 Ga0496108_0515627
864 Ga0496109_0001731
865 Ga0496109_0008898
866 Ga0496109_0018595
867 Ga0496109_0119796
868 Ga0496110_0001745
869 Ga0496110_0017691
870 Ga0496110_0021070
871 Ga0496111_0005280
872 Ga0496111_0072102
873 Ga0496111_0113052
874 Ga0496112_0001208
875 Ga0496112_0006883
876 Ga0496112_0028699
877 Ga0496112_0038186
878 Ga0496112_0049899
879 Ga0496112_0062240
880 Ga0496112_0133461
881 Ga0496113_0001177
882 Ga0496113_0013676
883 Ga0496113_0056926
884 Ga0496114_0038351
885 Ga0496114_0356322
886 Ga0496114_0444599
887 Ga0496115_0006597
888 Ga0496115_0033140
889 Ga0496115_0054057
890 Ga0496115_0102186
891 Ga0496115_0108673
892 Ga0496115_0209690
893 Ga0496115_0256343
894 nmdc:mga05p37_162837_c1
895 nmdc:mga05p37_22983_c1
896 nmdc:mga05p37_62426_c1
897 nmdc:mga09592_44056_c1
898 nmdc:mga09592_60476_c1
899 nmdc:mga0qj67_30250_c1
900 nmdc:mga06r32_106000_c1
901 nmdc:mga06r32_85126_c1
902 nmdc:mga08y16_19964_c1
903 nmdc:mga08y16_5778_c1
904 nmdc:mga0n895_13698_c1
905 nmdc:mga0n895_193174_c1
906 nmdc:mga0n895_225157_c1
907 nmdc:mga0n895_307775_c1
908 nmdc:mga0n895_372401_c1
909 nmdc:mga0rr50_14457_c1
910 nmdc:mga0rr50_245642_c1
911 nmdc:mga0rr50_421861_c1
912 nmdc:mga08x19_102687_c1
913 nmdc:mga0a205_4531_c1
914 Ga0495601_0002378
915 Ga0495601_0022997
916 Ga0495601_0037601
917 Ga0495601_0043924
918 Ga0495601_0107732
919 Ga0495601_0161114
920 Ga0495601_0168962
921 Ga0495601_0196524
922 Ga0495612_0003725
923 Ga0495612_0142936
924 Ga0495595_0006233
925 Ga0495595_0027364
926 Ga0495595_0077206
927 Ga0495595_0086332
928 Ga0495619_0000985
929 Ga0495619_0001879
930 Ga0495619_0003302
931 Ga0495619_0004391
932 Ga0495619_0006861
933 Ga0495619_0008684
934 Ga0495619_0020534
935 Ga0495619_0032445
936 Ga0495619_0051660
937 Ga0495619_0068845
938 Ga0495619_0092124
939 Ga0495619_0136104
940 Ga0495619_0193298
941 Ga0495619_0200570
942 2885383219

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

74

364

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9175 28 326
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9088 28 326
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9048 26 326
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9038 30 326
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9019 26 326
ID Description Score Start End Superfamily
3lftB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9258 30 142 3.40.50.2300
3lkvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9211 26 296 3.40.50.2300
3lkvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9093 26 296 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8865 149 326 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8694 149 326 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7V9HTZ8-F1-model_v4 ABC transporter substrate-binding protein 0.9782 221 326
AF-A0A537MMK8-F1-model_v4 ABC transporter substrate-binding protein 0.9768 148 326
AF-A0A537SGP9-F1-model_v4 ABC transporter substrate-binding protein 0.9668 220 326
AF-A0A537SF60-F1-model_v4 ABC transporter substrate-binding protein 0.9665 28 326
AF-A0A537H7S6-F1-model_v4 ABC transporter substrate-binding protein 0.966 220 326

Map