F450606

General Info

Members Datasets Scaffolds Average Seq Length
471 219 942 113

Family's Representative Sequence

Representative Sequence 3300025907|Ga0207645_11042027|Ga0207645_110420272
Length 135
Sequence VNALRTQIGLTLDKTLIQPYGCTVQIAPPDFDRMFGALADHTRRDIVRRAIAAEEGVVELASHYPMSFAAVQKHVAVLERAGLVTKQRDGRRKVVRTNMEALRLARGLLDQYEALWRGRIDRMTDLITRTKEARA

Samples

Sample ID Description Type Environment
1 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
89 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
90 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
91 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
94 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
104 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
105 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
106 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
114 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
115 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
116 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
117 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
118 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
119 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
120 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
121 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
122 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
125 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
126 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
127 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
128 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
131 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
156 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.86
Rhizosphere 88.96
Stem 0
Stem Tuber 0
Unclassified 2.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207645_11042027 3300025907 Bacteria 553
2 Ga0070676_11430225 3300005328 Bacteria 531
3 Ga0070677_10495901 3300005333 Bacteria 661
4 Ga0070682_100137820 3300005337 Bacteria 1659
5 Ga0068868_100264384 3300005338 Bacteria 1452
6 Ga0070689_100689735 3300005340 Bacteria 891
7 Ga0070669_100997781 3300005353 Bacteria 718
8 Ga0070674_100011638 3300005356 Bacteria 5361
9 Ga0070674_100028718 3300005356 Bacteria 3654
10 Ga0070711_101655320 3300005439 Bacteria 560
11 Ga0070700_100003737 3300005441 Bacteria 7872
12 Ga0070694_100813431 3300005444 Bacteria 767
13 Ga0070708_100204933 3300005445 Bacteria 1847
14 Ga0070708_100218171 3300005445 Bacteria 1788
15 Ga0070708_100617886 3300005445 Bacteria 1022
16 Ga0070678_100088410 3300005456 Bacteria 2369
17 Ga0070685_10958150 3300005466 Bacteria 640
18 Ga0070706_100007907 3300005467 Bacteria 9930
19 Ga0070706_100028161 3300005467 Bacteria 5171
20 Ga0070706_100181097 3300005467 Bacteria 1967
21 Ga0070706_100372917 3300005467 Unclassified 1329
22 Ga0070706_101715777 3300005467 Bacteria 572
23 Ga0070706_101716660 3300005467 Bacteria 572
24 Ga0070707_100162451 3300005468 Bacteria 2176
25 Ga0070707_100182447 3300005468 Bacteria 2046
26 Ga0070707_100556623 3300005468 Bacteria 1109
27 Ga0070707_100868150 3300005468 Bacteria 866
28 Ga0070698_100014232 3300005471 Bacteria 8410
29 Ga0070698_100038335 3300005471 Bacteria 4938
30 Ga0070698_100058353 3300005471 Bacteria 3902
31 Ga0070698_100087390 3300005471 Bacteria 3103
32 Ga0070698_100162557 3300005471 Bacteria 2176
33 Ga0070698_100346693 3300005471 Bacteria 1416
34 Ga0070698_100515946 3300005471 Bacteria 1133
35 Ga0070699_100153225 3300005518 Bacteria 2039
36 Ga0070699_100249194 3300005518 Bacteria 1586
37 Ga0070699_100427427 3300005518 Bacteria 1199
38 Ga0070699_101611172 3300005518 Bacteria 595
39 Ga0070679_100142464 3300005530 Bacteria 2376
40 Ga0070684_100198891 3300005535 Bacteria 1825
41 Ga0070697_100000030 3300005536 Bacteria 111048
42 Ga0070697_100025886 3300005536 Bacteria 4679
43 Ga0070697_100027860 3300005536 Bacteria 4522
44 Ga0070697_100089939 3300005536 Bacteria 2537
45 Ga0070697_100182179 3300005536 Bacteria 1780
46 Ga0070697_100491446 3300005536 Bacteria 1072
47 Ga0070672_100986932 3300005543 Bacteria 746
48 Ga0070672_101206731 3300005543 Bacteria 674
49 Ga0070686_100010743 3300005544 Bacteria 5175
50 Ga0070686_100011732 3300005544 Bacteria 4978
51 Ga0070686_101943491 3300005544 Bacteria 503
52 Ga0070695_100095177 3300005545 Bacteria 1995
53 Ga0070696_100060190 3300005546 Bacteria 2655
54 Ga0070665_100169897 3300005548 Bacteria 2182
55 Ga0070704_100544131 3300005549 Bacteria 1014
56 Ga0068856_101884749 3300005614 Bacteria 609
57 Ga0068859_101999068 3300005617 Bacteria 640
58 Ga0068864_100316252 3300005618 Bacteria 1465
59 Ga0068864_100379004 3300005618 Bacteria 1340
60 Ga0068863_100998304 3300005841 Bacteria 840
61 Ga0068858_100513124 3300005842 Bacteria 1159
62 Ga0097621_101950194 3300006237 Bacteria 561
63 Ga0068871_100262795 3300006358 Bacteria 1506
64 Ga0068871_100340142 3300006358 Bacteria 1325
65 Ga0068871_102328674 3300006358 Bacteria 511
66 Ga0075428_100085799 3300006844 Bacteria 3434
67 Ga0075433_10107829 3300006852 Bacteria 2470
68 Ga0075433_10227728 3300006852 Bacteria 1655
69 Ga0075434_100204665 3300006871 Bacteria 1994
70 Ga0075434_100724762 3300006871 Bacteria 1011
71 Ga0075429_100796140 3300006880 Bacteria 828
72 Ga0068865_101577292 3300006881 Bacteria 590
73 Ga0075436_100380677 3300006914 Bacteria 1020
74 Ga0097620_101998873 3300006931 Bacteria 640
75 Ga0075435_100264780 3300007076 Bacteria 1465
76 Ga0075435_100357930 3300007076 Bacteria 1251
77 Ga0075435_100372807 3300007076 Bacteria 1225
78 Ga0111539_10118938 3300009094 Bacteria 3096
79 Ga0105245_11267917 3300009098 Bacteria 786
80 Ga0105245_12305561 3300009098 Bacteria 592
81 Ga0105245_12535162 3300009098 Bacteria 566
82 Ga0105245_13003802 3300009098 Bacteria 523
83 Ga0105247_10393851 3300009101 Bacteria 985
84 Ga0114129_10032132 3300009147 Bacteria 7419
85 Ga0114129_10066846 3300009147 Bacteria 5013
86 Ga0114129_10112467 3300009147 Bacteria 3755
87 Ga0114129_11644092 3300009147 Bacteria 785
88 Ga0114129_12058523 3300009147 Bacteria 689
89 Ga0105243_10003169 3300009148 Bacteria 13489
90 Ga0105243_10360172 3300009148 Bacteria 1338
91 Ga0105243_10528601 3300009148 Bacteria 1123
92 Ga0105248_10242177 3300009177 Bacteria 2030
93 Ga0105248_12535144 3300009177 Bacteria 584
94 Ga0105237_10156522 3300009545 Bacteria 2276
95 Ga0105238_11658108 3300009551 Bacteria 670
96 Ga0105249_10726386 3300009553 Bacteria 1054
97 Ga0105249_11275290 3300009553 Bacteria 806
98 Ga0105246_10162584 3300011119 Bacteria 1702
99 Ga0105246_11099544 3300011119 Bacteria 726
100 Ga0105246_11742228 3300011119 Bacteria 593
101 Ga0157371_11507171 3300013102 Bacteria 525
102 Ga0157374_10617531 3300013296 Bacteria 1095
103 Ga0157378_12507857 3300013297 Bacteria 568
104 Ga0163162_12033280 3300013306 Bacteria 659
105 Ga0163162_12127935 3300013306 Bacteria 644
106 Ga0163162_13187520 3300013306 Bacteria 526
107 Ga0157375_10058622 3300013308 Bacteria 3810
108 Ga0157375_10236514 3300013308 Bacteria 1986
109 Ga0163163_10042187 3300014325 Bacteria 4467
110 Ga0163163_10085085 3300014325 Bacteria 3170
111 Ga0163163_10175409 3300014325 Bacteria 2190
112 Ga0163163_10845380 3300014325 Bacteria 979
113 Ga0157380_10369320 3300014326 Bacteria 1349
114 Ga0157380_11617693 3300014326 Bacteria 704
115 Ga0157380_12839182 3300014326 Bacteria 551
116 Ga0157377_10139064 3300014745 Bacteria 1490
117 Ga0157377_10637537 3300014745 Bacteria 765
118 Ga0157379_10108847 3300014968 Bacteria 2489
119 Ga0157379_12163892 3300014968 Bacteria 552
120 Ga0157376_10326354 3300014969 Bacteria 1461
121 Ga0157376_12452563 3300014969 Bacteria 561
122 Ga0163161_10032910 3300017792 Bacteria 3703
123 Ga0163161_10469686 3300017792 Bacteria 1020
124 Ga0213876_10004830 3300021384 Bacteria 7477
125 Ga0207653_10004407 3300025885 Bacteria 4412
126 Ga0207684_10000154 3300025910 Bacteria 119373
127 Ga0207684_10001246 3300025910 Bacteria 28272
128 Ga0207684_10006151 3300025910 Bacteria 10976
129 Ga0207684_10026138 3300025910 Bacteria 4975
130 Ga0207684_10069705 3300025910 Bacteria 2988
131 Ga0207684_10626776 3300025910 Bacteria 917
132 Ga0207684_10861382 3300025910 Bacteria 763
133 Ga0207684_10933687 3300025910 Bacteria 728
134 Ga0207684_10971205 3300025910 Bacteria 712
135 Ga0207660_10289742 3300025917 Bacteria 1301
136 Ga0207660_10484814 3300025917 Bacteria 1002
137 Ga0207662_10058699 3300025918 Bacteria 2304
138 Ga0207652_10400145 3300025921 Bacteria 1239
139 Ga0207646_10004504 3300025922 Bacteria 15099
140 Ga0207646_10006122 3300025922 Bacteria 12525
141 Ga0207646_10011920 3300025922 Bacteria 8384
142 Ga0207646_10014546 3300025922 Bacteria 7468
143 Ga0207646_10021737 3300025922 Bacteria 5923
144 Ga0207646_10064351 3300025922 Bacteria 3273
145 Ga0207646_10642068 3300025922 Unclassified 951
146 Ga0207681_10335867 3300025923 Bacteria 1206
147 Ga0207687_11095388 3300025927 Bacteria 684
148 Ga0207700_11290222 3300025928 Bacteria 651
149 Ga0207664_10396481 3300025929 Bacteria 1227
150 Ga0207709_10224637 3300025935 Bacteria 1356
151 Ga0207709_10305317 3300025935 Bacteria 1185
152 Ga0207669_10057015 3300025937 Bacteria 2376
153 Ga0207669_10340411 3300025937 Bacteria 1155
154 Ga0207669_10470876 3300025937 Bacteria 999
155 Ga0207704_10481611 3300025938 Bacteria 996
156 Ga0207704_10850973 3300025938 Bacteria 764
157 Ga0207704_11767122 3300025938 Bacteria 532
158 Ga0207665_10050616 3300025939 Bacteria 2794
159 Ga0207689_11380715 3300025942 Bacteria 591
160 Ga0207661_11847758 3300025944 Bacteria 550
161 Ga0207712_10765490 3300025961 Bacteria 847
162 Ga0207712_11524376 3300025961 Bacteria 599
163 Ga0207640_10127106 3300025981 Bacteria 1837
164 Ga0207640_12137813 3300025981 Bacteria 508
165 Ga0207678_11361283 3300026067 Bacteria 628
166 Ga0207678_11390760 3300026067 Bacteria 620
167 Ga0207708_10002360 3300026075 Bacteria 13868
168 Ga0207641_10476720 3300026088 Bacteria 1209
169 Ga0209588_1011436 3300027671 Bacteria 2681
170 Ga0209998_10048782 3300027717 Unclassified 976
171 Ga0265326_10152871 3300028558 Bacteria 659
172 Ga0265326_10192989 3300028558 Bacteria 584
173 Ga0265334_10014284 3300028573 Bacteria 3311
174 Ga0265334_10048174 3300028573 Bacteria 1642
175 Ga0265334_10058673 3300028573 Bacteria 1455
176 Ga0265318_10077606 3300028577 Bacteria 1228
177 Ga0265336_10027359 3300028666 Bacteria 1787
178 Ga0265336_10029328 3300028666 Bacteria 1717
179 Ga0265338_10464704 3300028800 Bacteria 895
180 Ga0265338_10965098 3300028800 Bacteria 578
181 Ga0265324_10079229 3300029957 Bacteria 1118
182 Ga0265332_10049254 3300031238 Bacteria 1812
183 Ga0265320_10012141 3300031240 Bacteria 5029
184 Ga0265325_10036989 3300031241 Bacteria 2583
185 Ga0265325_10071675 3300031241 Bacteria 1738
186 Ga0265325_10252696 3300031241 Bacteria 798
187 Ga0265329_10034169 3300031242 Bacteria 1643
188 Ga0265339_10078035 3300031249 Bacteria 1754
189 Ga0265339_10116450 3300031249 Bacteria 1378
190 Ga0265314_10031678 3300031711 Bacteria 3899
191 Ga0265314_10047374 3300031711 Bacteria 3025
192 Ga0265314_10647947 3300031711 Bacteria 539
193 Ga0265342_10108695 3300031712 Bacteria 1572
194 Ga0307409_100152654 3300031995 Bacteria 2008
195 Ga0307411_11866701 3300032005 Bacteria 559
196 Ga0373958_0045676 3300034819 Bacteria 911
197 Ga0373928_0024041 3300035084 Unclassified 1304
198 Ga0373939_0085842 3300035114 Bacteria 1055
199 Ga0373941_0050583 3300035115 Bacteria 1320
200 Ga0373955_0574916 3300035172 Bacteria 690
201 Ga0373942_0097362 3300035207 Bacteria 895
202 Ga0373937_1553706 3300036401 Bacteria 609
203 Ga0395900_0175040 3300037418 Bacteria 2183
204 Ga0395900_1895408 3300037418 Bacteria 507
205 Ga0395905_0623229 3300037471 Bacteria 981
206 Ga0436365_0756978 3300039437 Bacteria 2989
207 Ga0436365_0786437 3300039437 Bacteria 769
208 Ga0436365_1147937 3300039437 Bacteria 8358
209 Ga0436365_1482977 3300039437 Bacteria 1271
210 Ga0436362_0091825 3300039453 Bacteria 945
211 Ga0451793_0719026 3300041452 Bacteria 662
212 Ga0451800_0119329 3300041459 Bacteria 616
213 Ga0451804_0449098 3300041463 Bacteria 638
214 Ga0451807_1932912 3300041486 Bacteria 637
215 Ga0451807_2734624 3300041486 Bacteria 614
216 Ga0451833_0531072 3300041491 Bacteria 1092
217 Ga0451841_0385688 3300041498 Bacteria 540
218 Ga0451845_0242542 3300041501 Bacteria 530
219 Ga0451845_0314345 3300041501 Bacteria 691
220 Ga0451849_0071100 3300041505 Bacteria 1747
221 Ga0451849_1045695 3300041505 Bacteria 502
222 Ga0451851_0258200 3300041507 Bacteria 728
223 Ga0451853_0273911 3300041512 Bacteria 1461
224 Ga0451853_1418260 3300041512 Bacteria 1231
225 Ga0451853_1896236 3300041512 Bacteria 648
226 Ga0450923_015442 3300042125 Bacteria 1428
227 Ga0439446_0365151 3300042156 Bacteria 516
228 Ga0439435_0249099 3300042436 Bacteria 598
229 Ga0450918_097308 3300042531 Bacteria 573
230 Ga0450893_0022754 3300042532 Bacteria 1087
231 Ga0451577_0457557 3300042876 Bacteria 1159
232 Ga0453683_0858739 3300044673 Bacteria 599
233 Ga0466968_0154386 3300044735 Bacteria 1057
234 Ga0466968_0553032 3300044735 Bacteria 578
235 Ga0466960_0027059 3300044901 Bacteria 2612
236 Ga0466959_1091821 3300045049 Bacteria 531
237 Ga0451576_0049099 3300045051 Bacteria 4429
238 Ga0495592_0133860 3300046454 Bacteria 1731
239 Ga0495603_0318508 3300046455 Bacteria 893
240 Ga0495629_0201026 3300046459 Bacteria 1378
241 Ga0495641_0208174 3300046461 Bacteria 877
242 Ga0495641_0324154 3300046461 Bacteria 695
243 Ga0495641_0372327 3300046461 Bacteria 647
244 Ga0495641_0532907 3300046461 Bacteria 536
245 Ga0495651_0019022 3300046462 Bacteria 5322
246 Ga0495653_0115089 3300046463 Bacteria 1926
247 Ga0495582_0492249 3300046473 Bacteria 709
248 Ga0495582_0569069 3300046473 Bacteria 656
249 Ga0495584_0427968 3300046491 Bacteria 673
250 Ga0495608_0204785 3300046511 Bacteria 1242
251 Ga0495628_0280241 3300046516 Bacteria 1238
252 Ga0495630_0062514 3300046517 Bacteria 2797
253 Ga0495666_0335671 3300046526 Bacteria 682
254 Ga0495652_0459466 3300046529 Bacteria 890
255 Ga0495640_0653579 3300046533 Bacteria 633
256 Ga0495587_0449457 3300046536 Bacteria 714
257 Ga0495667_0386880 3300046559 Bacteria 882
258 Ga0495634_0774891 3300046642 Bacteria 548
259 Ga0495635_0076970 3300046663 Bacteria 2286
260 Ga0495599_0222325 3300046678 Bacteria 1155
261 Ga0495658_0431809 3300046683 Bacteria 841
262 Ga0495600_0451361 3300046809 Bacteria 795
263 Ga0495581_0431705 3300047315 Bacteria 768
264 Ga0495604_0105993 3300047317 Bacteria 2057
265 Ga0495604_0472235 3300047317 Bacteria 817
266 Ga0495674_0247281 3300047319 Bacteria 1468
267 Ga0495676_0222259 3300047321 Bacteria 1301
268 Ga0495676_0597492 3300047321 Bacteria 719
269 Ga0495676_0850848 3300047321 Bacteria 586
270 Ga0495680_0505579 3300047322 Bacteria 820
271 Ga0495593_0062620 3300047673 Bacteria 1944
272 Ga0495602_0185509 3300048088 Bacteria 1600
273 Ga0496100_0032212 3300048903 Bacteria 3266
274 Ga0496100_0778073 3300048903 Bacteria 749
275 Ga0496100_1171106 3300048903 Bacteria 606
276 Ga0496101_0009804 3300048904 Bacteria 6307
277 Ga0496101_0266017 3300048904 Bacteria 1338
278 Ga0496101_0968512 3300048904 Bacteria 669
279 Ga0496102_0438344 3300048905 Bacteria 1226
280 Ga0496104_0018759 3300048907 Bacteria 6317
281 Ga0496104_0047584 3300048907 Bacteria 4042
282 Ga0496105_0010056 3300048908 Bacteria 7423
283 Ga0496105_0041843 3300048908 Bacteria 3776
284 Ga0496105_0782604 3300048908 Bacteria 727
285 Ga0496106_0030427 3300048909 Bacteria 4026
286 Ga0496108_0025217 3300048911 Bacteria 4899
287 Ga0496108_0090827 3300048911 Bacteria 2596
288 Ga0496108_0152929 3300048911 Bacteria 1992
289 Ga0496108_0252893 3300048911 Bacteria 1533
290 Ga0496109_0003216 3300048912 Bacteria 13598
291 Ga0496109_0025666 3300048912 Bacteria 5252
292 Ga0496109_0104122 3300048912 Bacteria 2635
293 Ga0496109_1024406 3300048912 Bacteria 763
294 Ga0496110_0434773 3300048913 Bacteria 1196
295 Ga0496111_0076484 3300048914 Bacteria 2440
296 Ga0496111_0124766 3300048914 Bacteria 1903
297 Ga0496112_0192148 3300048915 Bacteria 2003
298 Ga0496112_0271585 3300048915 Bacteria 1644
299 Ga0496112_1042525 3300048915 Bacteria 737
300 Ga0496113_0178481 3300048916 Bacteria 1683
301 Ga0496113_0460111 3300048916 Bacteria 1022
302 Ga0496114_0002805 3300048917 Bacteria 13350
303 Ga0496114_0482731 3300048917 Bacteria 1096
304 Ga0496114_1022547 3300048917 Bacteria 710
305 Ga0501031_0037882 3300049568 Bacteria 3147
306 Ga0501031_0041699 3300049568 Bacteria 2997
307 Ga0501031_0218704 3300049568 Unclassified 1241
308 Ga0501031_0330918 3300049568 Bacteria 986
309 Ga0501031_0572466 3300049568 Bacteria 727
310 Ga0501032_0138699 3300049569 Bacteria 1602
311 Ga0501033_0065967 3300049570 Bacteria 2662
312 Ga0501033_0661049 3300049570 Bacteria 713
313 Ga0501036_0031271 3300049572 Bacteria 4498
314 Ga0501036_0188904 3300049572 Bacteria 1733
315 Ga0501036_0252407 3300049572 Bacteria 1478
316 Ga0501036_0259259 3300049572 Bacteria 1456
317 Ga0501037_0084478 3300049573 Bacteria 2299
318 Ga0501038_0044425 3300049574 Bacteria 3860
319 Ga0501038_0116569 3300049574 Bacteria 2207
320 Ga0501038_0121041 3300049574 Bacteria 2158
321 Ga0501038_0873765 3300049574 Bacteria 665
322 Ga0501039_0004363 3300049575 Bacteria 10659
323 Ga0501039_0085194 3300049575 Bacteria 2462
324 Ga0501039_0138645 3300049575 Bacteria 1910
325 Ga0501039_0184323 3300049575 Bacteria 1641
326 Ga0501039_0367733 3300049575 Bacteria 1130
327 Ga0501039_0533845 3300049575 Bacteria 921
328 Ga0501040_0067319 3300049576 Bacteria 2468
329 Ga0501040_0097956 3300049576 Bacteria 2043
330 Ga0501040_0181280 3300049576 Unclassified 1493
331 Ga0501040_0376582 3300049576 Bacteria 1018
332 Ga0501040_0407620 3300049576 Bacteria 976
333 Ga0501041_0000888 3300049577 Bacteria 16190
334 Ga0501041_0117544 3300049577 Bacteria 1651
335 Ga0501041_0149981 3300049577 Bacteria 1455
336 Ga0501042_0011992 3300049578 Bacteria 5859
337 Ga0501042_0018462 3300049578 Bacteria 4828
338 Ga0501042_0185658 3300049578 Bacteria 1500
339 Ga0501042_0279773 3300049578 Bacteria 1205
340 Ga0501043_0059038 3300049579 Bacteria 3010
341 Ga0501043_0532463 3300049579 Unclassified 875
342 Ga0501043_1181752 3300049579 Bacteria 538
343 Ga0501046_0010760 3300049580 Bacteria 7845
344 Ga0501046_0099616 3300049580 Bacteria 2231
345 Ga0501046_0349941 3300049580 Bacteria 1073
346 Ga0501046_0759652 3300049580 Unclassified 681
347 Ga0501046_0896555 3300049580 Bacteria 619
348 Ga0501047_1155113 3300049581 Bacteria 588
349 Ga0501048_0002467 3300049582 Bacteria 14118
350 Ga0501048_0015929 3300049582 Bacteria 5547
351 Ga0501048_0065031 3300049582 Bacteria 2579
352 Ga0501048_0126350 3300049582 Bacteria 1808
353 Ga0501068_0080028 3300049584 Bacteria 2004
354 Ga0501068_0115692 3300049584 Bacteria 1670
355 Ga0501068_0364029 3300049584 Bacteria 930
356 Ga0501068_0369423 3300049584 Bacteria 923
357 Ga0501068_0841898 3300049584 Bacteria 602
358 Ga0501068_0964886 3300049584 Bacteria 562
359 Ga0501069_0307234 3300049585 Bacteria 931
360 Ga0501069_0326176 3300049585 Bacteria 903
361 Ga0501069_0494462 3300049585 Unclassified 729
362 Ga0501069_0647607 3300049585 Bacteria 636
363 Ga0501070_0052697 3300049586 Bacteria 3377
364 Ga0501071_0020830 3300049587 Bacteria 4561
365 Ga0501071_0022966 3300049587 Bacteria 4352
366 Ga0501071_0039871 3300049587 Bacteria 3361
367 Ga0501071_0054874 3300049587 Bacteria 2875
368 Ga0501071_0108493 3300049587 Bacteria 2051
369 Ga0501071_0127220 3300049587 Bacteria 1891
370 Ga0501071_0480617 3300049587 Bacteria 952
371 Ga0501071_0577086 3300049587 Bacteria 864
372 Ga0501072_0004070 3300049588 Bacteria 11067
373 Ga0501072_0010011 3300049588 Bacteria 7211
374 Ga0501072_0025267 3300049588 Bacteria 4627
375 Ga0501072_0044166 3300049588 Bacteria 3504
376 Ga0501072_0054056 3300049588 Bacteria 3163
377 Ga0501072_0072157 3300049588 Bacteria 2728
378 Ga0501072_0459412 3300049588 Bacteria 1008
379 Ga0501072_0918828 3300049588 Bacteria 683
380 Ga0501073_0320574 3300049589 Bacteria 1070
381 Ga0501074_0002546 3300049590 Bacteria 12717
382 Ga0501074_0056892 3300049590 Bacteria 2818
383 Ga0501074_0128267 3300049590 Bacteria 1815
384 Ga0501074_0155737 3300049590 Bacteria 1632
385 Ga0501074_0238162 3300049590 Bacteria 1295
386 Ga0501074_0285504 3300049590 Bacteria 1173
387 Ga0501074_0957629 3300049590 Bacteria 602
388 Ga0501075_0007107 3300049591 Bacteria 7742
389 Ga0501075_0007450 3300049591 Bacteria 7588
390 Ga0501075_0028315 3300049591 Bacteria 4135
391 Ga0501075_0048639 3300049591 Bacteria 3187
392 Ga0501075_0073017 3300049591 Unclassified 2594
393 Ga0501075_0109586 3300049591 Bacteria 2099
394 Ga0501075_0178870 3300049591 Bacteria 1619
395 Ga0501075_0599507 3300049591 Bacteria 840
396 Ga0501075_0919915 3300049591 Bacteria 665
397 Ga0501076_0002125 3300049592 Bacteria 13600
398 Ga0501076_0003084 3300049592 Bacteria 11607
399 Ga0501076_0006341 3300049592 Bacteria 8574
400 Ga0501076_0059206 3300049592 Bacteria 3046
401 Ga0501076_0206374 3300049592 Bacteria 1605
402 Ga0501076_0253537 3300049592 Bacteria 1440
403 Ga0501076_0619225 3300049592 Bacteria 893
404 Ga0501077_0116969 3300049593 Bacteria 1690
405 Ga0501077_0213142 3300049593 Bacteria 1227
406 Ga0501077_0343973 3300049593 Unclassified 951
407 Ga0501077_0356857 3300049593 Bacteria 933
408 Ga0501077_0380032 3300049593 Bacteria 902
409 Ga0501079_0022170 3300049741 Bacteria 4867
410 Ga0501079_0050560 3300049741 Bacteria 3209
411 Ga0501079_0053096 3300049741 Bacteria 3127
412 Ga0501079_0076318 3300049741 Bacteria 2592
413 Ga0501079_0100996 3300049741 Bacteria 2237
414 Ga0501079_0167148 3300049741 Bacteria 1715
415 Ga0501079_0230733 3300049741 Bacteria 1446
416 Ga0501080_0728171 3300049742 Bacteria 874
417 Ga0501080_0962427 3300049742 Bacteria 742
418 Ga0501080_1089967 3300049742 Bacteria 690
419 Ga0501081_0000646 3300049743 Bacteria 19907
420 Ga0501081_0044415 3300049743 Bacteria 3050
421 Ga0501081_0055057 3300049743 Bacteria 2748
422 Ga0501081_0091328 3300049743 Bacteria 2141
423 Ga0501081_0528566 3300049743 Bacteria 880
424 Ga0501083_0302239 3300049744 Bacteria 1041
425 Ga0501035_0018801 3300049822 Bacteria 6365
426 Ga0501044_1270011 3300049823 Bacteria 603
427 Ga0501045_0000806 3300049824 Bacteria 20249
428 Ga0501045_0013522 3300049824 Bacteria 5765
429 Ga0501045_0041962 3300049824 Bacteria 3329
430 Ga0501045_0186092 3300049824 Bacteria 1547
431 Ga0501045_0193311 3300049824 Bacteria 1516
432 Ga0501045_0258028 3300049824 Unclassified 1297
433 Ga0501045_0413116 3300049824 Bacteria 1004
434 Ga0501045_0976870 3300049824 Bacteria 621
435 nmdc:mga05p37_211523_c1 3300050507 Bacteria 2344
436 nmdc:mga05p37_652875_c1 3300050507 Bacteria 1178
437 nmdc:mga09592_76932_c1 3300050508 Bacteria 982
438 nmdc:mga06r32_1302754_c1 3300050510 Bacteria 670
439 nmdc:mga08y16_145901_c1 3300050511 Bacteria 2460
440 nmdc:mga0n895_403359_c1 3300050512 Bacteria 1383
441 nmdc:mga0n895_62236_c1 3300050512 Bacteria 3687
442 nmdc:mga0rr50_594150_c1 3300050513 Bacteria 944
443 nmdc:mga08x19_457064_c1 3300050514 Bacteria 899
444 nmdc:mga0a205_513540_c1 3300050515 Bacteria 1055
445 Ga0495601_0042425 3300053077 Bacteria 2854
446 Ga0495619_0153526 3300053085 Bacteria 1588
447 Ga0501084_0025926 3300054114 Bacteria 4888
448 Ga0501084_0063851 3300054114 Bacteria 3083
449 Ga0501084_0087920 3300054114 Bacteria 2609
450 Ga0501084_0134033 3300054114 Bacteria 2085
451 Ga0501084_0203666 3300054114 Bacteria 1670
452 Ga0501084_0249910 3300054114 Bacteria 1497
453 Ga0501084_0272181 3300054114 Bacteria 1430
454 Ga0501084_0341908 3300054114 Bacteria 1264
455 Ga0501084_0479870 3300054114 Bacteria 1051
456 Ga0501082_0009052 3300060353 Bacteria 8587
457 Ga0501082_0020085 3300060353 Bacteria 5757
458 Ga0501082_0023440 3300060353 Bacteria 5325
459 Ga0501082_0048945 3300060353 Bacteria 3644
460 Ga0501082_0068370 3300060353 Bacteria 3059
461 Ga0501082_0069787 3300060353 Bacteria 3026
462 Ga0501082_0103289 3300060353 Bacteria 2465
463 Ga0501082_0592505 3300060353 Bacteria 970
464 Ga0501082_1589096 3300060353 Bacteria 571
465 Ga0530510_0005403 3300061734 Bacteria 8846
466 Ga0530510_0016158 3300061734 Bacteria 5279
467 Ga0530510_0016273 3300061734 Bacteria 5260
468 Ga0530510_0030033 3300061734 Bacteria 3903
469 Ga0530510_0058618 3300061734 Bacteria 2784
470 Ga0530510_0587137 3300061734 Bacteria 847
471 Ga0530510_0932200 3300061734 Bacteria 664
472 Ga0207645_11042027
473 Ga0070676_11430225
474 Ga0070677_10495901
475 Ga0070682_100137820
476 Ga0068868_100264384
477 Ga0070689_100689735
478 Ga0070669_100997781
479 Ga0070674_100011638
480 Ga0070674_100028718
481 Ga0070711_101655320
482 Ga0070700_100003737
483 Ga0070694_100813431
484 Ga0070708_100204933
485 Ga0070708_100218171
486 Ga0070708_100617886
487 Ga0070678_100088410
488 Ga0070685_10958150
489 Ga0070706_100007907
490 Ga0070706_100028161
491 Ga0070706_100181097
492 Ga0070706_100372917
493 Ga0070706_101715777
494 Ga0070706_101716660
495 Ga0070707_100162451
496 Ga0070707_100182447
497 Ga0070707_100556623
498 Ga0070707_100868150
499 Ga0070698_100014232
500 Ga0070698_100038335
501 Ga0070698_100058353
502 Ga0070698_100087390
503 Ga0070698_100162557
504 Ga0070698_100346693
505 Ga0070698_100515946
506 Ga0070699_100153225
507 Ga0070699_100249194
508 Ga0070699_100427427
509 Ga0070699_101611172
510 Ga0070679_100142464
511 Ga0070684_100198891
512 Ga0070697_100000030
513 Ga0070697_100025886
514 Ga0070697_100027860
515 Ga0070697_100089939
516 Ga0070697_100182179
517 Ga0070697_100491446
518 Ga0070672_100986932
519 Ga0070672_101206731
520 Ga0070686_100010743
521 Ga0070686_100011732
522 Ga0070686_101943491
523 Ga0070695_100095177
524 Ga0070696_100060190
525 Ga0070665_100169897
526 Ga0070704_100544131
527 Ga0068856_101884749
528 Ga0068859_101999068
529 Ga0068864_100316252
530 Ga0068864_100379004
531 Ga0068863_100998304
532 Ga0068858_100513124
533 Ga0097621_101950194
534 Ga0068871_100262795
535 Ga0068871_100340142
536 Ga0068871_102328674
537 Ga0075428_100085799
538 Ga0075433_10107829
539 Ga0075433_10227728
540 Ga0075434_100204665
541 Ga0075434_100724762
542 Ga0075429_100796140
543 Ga0068865_101577292
544 Ga0075436_100380677
545 Ga0097620_101998873
546 Ga0075435_100264780
547 Ga0075435_100357930
548 Ga0075435_100372807
549 Ga0111539_10118938
550 Ga0105245_11267917
551 Ga0105245_12305561
552 Ga0105245_12535162
553 Ga0105245_13003802
554 Ga0105247_10393851
555 Ga0114129_10032132
556 Ga0114129_10066846
557 Ga0114129_10112467
558 Ga0114129_11644092
559 Ga0114129_12058523
560 Ga0105243_10003169
561 Ga0105243_10360172
562 Ga0105243_10528601
563 Ga0105248_10242177
564 Ga0105248_12535144
565 Ga0105237_10156522
566 Ga0105238_11658108
567 Ga0105249_10726386
568 Ga0105249_11275290
569 Ga0105246_10162584
570 Ga0105246_11099544
571 Ga0105246_11742228
572 Ga0157371_11507171
573 Ga0157374_10617531
574 Ga0157378_12507857
575 Ga0163162_12033280
576 Ga0163162_12127935
577 Ga0163162_13187520
578 Ga0157375_10058622
579 Ga0157375_10236514
580 Ga0163163_10042187
581 Ga0163163_10085085
582 Ga0163163_10175409
583 Ga0163163_10845380
584 Ga0157380_10369320
585 Ga0157380_11617693
586 Ga0157380_12839182
587 Ga0157377_10139064
588 Ga0157377_10637537
589 Ga0157379_10108847
590 Ga0157379_12163892
591 Ga0157376_10326354
592 Ga0157376_12452563
593 Ga0163161_10032910
594 Ga0163161_10469686
595 Ga0213876_10004830
596 Ga0207653_10004407
597 Ga0207684_10000154
598 Ga0207684_10001246
599 Ga0207684_10006151
600 Ga0207684_10026138
601 Ga0207684_10069705
602 Ga0207684_10626776
603 Ga0207684_10861382
604 Ga0207684_10933687
605 Ga0207684_10971205
606 Ga0207660_10289742
607 Ga0207660_10484814
608 Ga0207662_10058699
609 Ga0207652_10400145
610 Ga0207646_10004504
611 Ga0207646_10006122
612 Ga0207646_10011920
613 Ga0207646_10014546
614 Ga0207646_10021737
615 Ga0207646_10064351
616 Ga0207646_10642068
617 Ga0207681_10335867
618 Ga0207687_11095388
619 Ga0207700_11290222
620 Ga0207664_10396481
621 Ga0207709_10224637
622 Ga0207709_10305317
623 Ga0207669_10057015
624 Ga0207669_10340411
625 Ga0207669_10470876
626 Ga0207704_10481611
627 Ga0207704_10850973
628 Ga0207704_11767122
629 Ga0207665_10050616
630 Ga0207689_11380715
631 Ga0207661_11847758
632 Ga0207712_10765490
633 Ga0207712_11524376
634 Ga0207640_10127106
635 Ga0207640_12137813
636 Ga0207678_11361283
637 Ga0207678_11390760
638 Ga0207708_10002360
639 Ga0207641_10476720
640 Ga0209588_1011436
641 Ga0209998_10048782
642 Ga0265326_10152871
643 Ga0265326_10192989
644 Ga0265334_10014284
645 Ga0265334_10048174
646 Ga0265334_10058673
647 Ga0265318_10077606
648 Ga0265336_10027359
649 Ga0265336_10029328
650 Ga0265338_10464704
651 Ga0265338_10965098
652 Ga0265324_10079229
653 Ga0265332_10049254
654 Ga0265320_10012141
655 Ga0265325_10036989
656 Ga0265325_10071675
657 Ga0265325_10252696
658 Ga0265329_10034169
659 Ga0265339_10078035
660 Ga0265339_10116450
661 Ga0265314_10031678
662 Ga0265314_10047374
663 Ga0265314_10647947
664 Ga0265342_10108695
665 Ga0307409_100152654
666 Ga0307411_11866701
667 Ga0373958_0045676
668 Ga0373928_0024041
669 Ga0373939_0085842
670 Ga0373941_0050583
671 Ga0373955_0574916
672 Ga0373942_0097362
673 Ga0373937_1553706
674 Ga0395900_0175040
675 Ga0395900_1895408
676 Ga0395905_0623229
677 Ga0436365_0756978
678 Ga0436365_0786437
679 Ga0436365_1147937
680 Ga0436365_1482977
681 Ga0436362_0091825
682 Ga0451793_0719026
683 Ga0451800_0119329
684 Ga0451804_0449098
685 Ga0451807_1932912
686 Ga0451807_2734624
687 Ga0451833_0531072
688 Ga0451841_0385688
689 Ga0451845_0242542
690 Ga0451845_0314345
691 Ga0451849_0071100
692 Ga0451849_1045695
693 Ga0451851_0258200
694 Ga0451853_0273911
695 Ga0451853_1418260
696 Ga0451853_1896236
697 Ga0450923_015442
698 Ga0439446_0365151
699 Ga0439435_0249099
700 Ga0450918_097308
701 Ga0450893_0022754
702 Ga0451577_0457557
703 Ga0453683_0858739
704 Ga0466968_0154386
705 Ga0466968_0553032
706 Ga0466960_0027059
707 Ga0466959_1091821
708 Ga0451576_0049099
709 Ga0495592_0133860
710 Ga0495603_0318508
711 Ga0495629_0201026
712 Ga0495641_0208174
713 Ga0495641_0324154
714 Ga0495641_0372327
715 Ga0495641_0532907
716 Ga0495651_0019022
717 Ga0495653_0115089
718 Ga0495582_0492249
719 Ga0495582_0569069
720 Ga0495584_0427968
721 Ga0495608_0204785
722 Ga0495628_0280241
723 Ga0495630_0062514
724 Ga0495666_0335671
725 Ga0495652_0459466
726 Ga0495640_0653579
727 Ga0495587_0449457
728 Ga0495667_0386880
729 Ga0495634_0774891
730 Ga0495635_0076970
731 Ga0495599_0222325
732 Ga0495658_0431809
733 Ga0495600_0451361
734 Ga0495581_0431705
735 Ga0495604_0105993
736 Ga0495604_0472235
737 Ga0495674_0247281
738 Ga0495676_0222259
739 Ga0495676_0597492
740 Ga0495676_0850848
741 Ga0495680_0505579
742 Ga0495593_0062620
743 Ga0495602_0185509
744 Ga0496100_0032212
745 Ga0496100_0778073
746 Ga0496100_1171106
747 Ga0496101_0009804
748 Ga0496101_0266017
749 Ga0496101_0968512
750 Ga0496102_0438344
751 Ga0496104_0018759
752 Ga0496104_0047584
753 Ga0496105_0010056
754 Ga0496105_0041843
755 Ga0496105_0782604
756 Ga0496106_0030427
757 Ga0496108_0025217
758 Ga0496108_0090827
759 Ga0496108_0152929
760 Ga0496108_0252893
761 Ga0496109_0003216
762 Ga0496109_0025666
763 Ga0496109_0104122
764 Ga0496109_1024406
765 Ga0496110_0434773
766 Ga0496111_0076484
767 Ga0496111_0124766
768 Ga0496112_0192148
769 Ga0496112_0271585
770 Ga0496112_1042525
771 Ga0496113_0178481
772 Ga0496113_0460111
773 Ga0496114_0002805
774 Ga0496114_0482731
775 Ga0496114_1022547
776 Ga0501031_0037882
777 Ga0501031_0041699
778 Ga0501031_0218704
779 Ga0501031_0330918
780 Ga0501031_0572466
781 Ga0501032_0138699
782 Ga0501033_0065967
783 Ga0501033_0661049
784 Ga0501036_0031271
785 Ga0501036_0188904
786 Ga0501036_0252407
787 Ga0501036_0259259
788 Ga0501037_0084478
789 Ga0501038_0044425
790 Ga0501038_0116569
791 Ga0501038_0121041
792 Ga0501038_0873765
793 Ga0501039_0004363
794 Ga0501039_0085194
795 Ga0501039_0138645
796 Ga0501039_0184323
797 Ga0501039_0367733
798 Ga0501039_0533845
799 Ga0501040_0067319
800 Ga0501040_0097956
801 Ga0501040_0181280
802 Ga0501040_0376582
803 Ga0501040_0407620
804 Ga0501041_0000888
805 Ga0501041_0117544
806 Ga0501041_0149981
807 Ga0501042_0011992
808 Ga0501042_0018462
809 Ga0501042_0185658
810 Ga0501042_0279773
811 Ga0501043_0059038
812 Ga0501043_0532463
813 Ga0501043_1181752
814 Ga0501046_0010760
815 Ga0501046_0099616
816 Ga0501046_0349941
817 Ga0501046_0759652
818 Ga0501046_0896555
819 Ga0501047_1155113
820 Ga0501048_0002467
821 Ga0501048_0015929
822 Ga0501048_0065031
823 Ga0501048_0126350
824 Ga0501068_0080028
825 Ga0501068_0115692
826 Ga0501068_0364029
827 Ga0501068_0369423
828 Ga0501068_0841898
829 Ga0501068_0964886
830 Ga0501069_0307234
831 Ga0501069_0326176
832 Ga0501069_0494462
833 Ga0501069_0647607
834 Ga0501070_0052697
835 Ga0501071_0020830
836 Ga0501071_0022966
837 Ga0501071_0039871
838 Ga0501071_0054874
839 Ga0501071_0108493
840 Ga0501071_0127220
841 Ga0501071_0480617
842 Ga0501071_0577086
843 Ga0501072_0004070
844 Ga0501072_0010011
845 Ga0501072_0025267
846 Ga0501072_0044166
847 Ga0501072_0054056
848 Ga0501072_0072157
849 Ga0501072_0459412
850 Ga0501072_0918828
851 Ga0501073_0320574
852 Ga0501074_0002546
853 Ga0501074_0056892
854 Ga0501074_0128267
855 Ga0501074_0155737
856 Ga0501074_0238162
857 Ga0501074_0285504
858 Ga0501074_0957629
859 Ga0501075_0007107
860 Ga0501075_0007450
861 Ga0501075_0028315
862 Ga0501075_0048639
863 Ga0501075_0073017
864 Ga0501075_0109586
865 Ga0501075_0178870
866 Ga0501075_0599507
867 Ga0501075_0919915
868 Ga0501076_0002125
869 Ga0501076_0003084
870 Ga0501076_0006341
871 Ga0501076_0059206
872 Ga0501076_0206374
873 Ga0501076_0253537
874 Ga0501076_0619225
875 Ga0501077_0116969
876 Ga0501077_0213142
877 Ga0501077_0343973
878 Ga0501077_0356857
879 Ga0501077_0380032
880 Ga0501079_0022170
881 Ga0501079_0050560
882 Ga0501079_0053096
883 Ga0501079_0076318
884 Ga0501079_0100996
885 Ga0501079_0167148
886 Ga0501079_0230733
887 Ga0501080_0728171
888 Ga0501080_0962427
889 Ga0501080_1089967
890 Ga0501081_0000646
891 Ga0501081_0044415
892 Ga0501081_0055057
893 Ga0501081_0091328
894 Ga0501081_0528566
895 Ga0501083_0302239
896 Ga0501035_0018801
897 Ga0501044_1270011
898 Ga0501045_0000806
899 Ga0501045_0013522
900 Ga0501045_0041962
901 Ga0501045_0186092
902 Ga0501045_0193311
903 Ga0501045_0258028
904 Ga0501045_0413116
905 Ga0501045_0976870
906 nmdc:mga05p37_211523_c1
907 nmdc:mga05p37_652875_c1
908 nmdc:mga09592_76932_c1
909 nmdc:mga06r32_1302754_c1
910 nmdc:mga08y16_145901_c1
911 nmdc:mga0n895_403359_c1
912 nmdc:mga0n895_62236_c1
913 nmdc:mga0rr50_594150_c1
914 nmdc:mga08x19_457064_c1
915 nmdc:mga0a205_513540_c1
916 Ga0495601_0042425
917 Ga0495619_0153526
918 Ga0501084_0025926
919 Ga0501084_0063851
920 Ga0501084_0087920
921 Ga0501084_0134033
922 Ga0501084_0203666
923 Ga0501084_0249910
924 Ga0501084_0272181
925 Ga0501084_0341908
926 Ga0501084_0479870
927 Ga0501082_0009052
928 Ga0501082_0020085
929 Ga0501082_0023440
930 Ga0501082_0048945
931 Ga0501082_0068370
932 Ga0501082_0069787
933 Ga0501082_0103289
934 Ga0501082_0592505
935 Ga0501082_1589096
936 Ga0530510_0005403
937 Ga0530510_0016158
938 Ga0530510_0016273
939 Ga0530510_0030033
940 Ga0530510_0058618
941 Ga0530510_0587137
942 Ga0530510_0932200

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9407 12 86
3f6v-assembly1.cif.gz_A-2 crystal structure of possible transcriptional regulator for arsenical resistance 0.915 17 93
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9092 12 95
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.8806 36 79
1wq2-assembly1.cif.gz_A neutron crystal structure of dissimilatory sulfite reductase d (dsrd) 0.8764 21 78
ID Description Score Start End Superfamily
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9336 12 93 1.10.10.10
3f6vA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.915 17 93 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9008 12 90 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8949 15 78 1.10.10.10
af_Q4DZU8_467_618_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.892 36 79 3.30.230.130
ID Description Score Start End GO Terms
AF-A0A2S9G3J3-F1-model_v4 Transcriptional regulator 0.9584 12 89 GO:0003700
AF-A0A3S9VAS7-F1-model_v4 ArsR family transcriptional regulator 0.9548 14 94 GO:0003700
AF-A0A2V5DW04-F1-model_v4 deleted 0.9534 11 95
AF-A0A6G3NUL2-F1-model_v4 deleted 0.9525 12 90
AF-A0A352QZT6-F1-model_v4 deleted 0.9521 11 91

Map