F450493

General Info

Members Datasets Scaffolds Average Seq Length
470 205 940 165

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0972997|Ga0501076_0972997_188_679
Length 155
Sequence VPIVDALVPEFDHEMATTRKVLERVPEQKFDWKPHARSFALGDLATHVANIVWWGEMTLNQPEYNLEGQARQPAAASRAALLEIFDRNTAKSDAELMAPWSLKHGRQTIFTMPKAAVWRSFVMNHLVHHRAQLAVYLRMQDVPVPAMYGPSADEQ

Samples

Sample ID Description Type Environment
1 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
145 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
146 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
147 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
148 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
149 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
150 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
151 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
152 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
153 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
154 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
155 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
156 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
172 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
202 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
203 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.64
Rhizosphere 99.15
Stem 0
Stem Tuber 0
Unclassified 21.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501076_0972997 3300049592 Bacteria 699
2 JGI24742J22300_10062470 3300002244 Unclassified 686
3 Ga0065712_10024518 3300005290 Bacteria 1496
4 Ga0065712_10111560 3300005290 Bacteria 1815
5 Ga0065712_10149226 3300005290 Bacteria 1383
6 Ga0065712_10411189 3300005290 Bacteria 721
7 Ga0065712_10606765 3300005290 Unclassified 588
8 Ga0065715_10008143 3300005293 Bacteria 3528
9 Ga0065715_10214214 3300005293 Bacteria 1300
10 Ga0065715_10345605 3300005293 Bacteria 960
11 Ga0070676_10719236 3300005328 Unclassified 730
12 Ga0070683_100025250 3300005329 Bacteria 5333
13 Ga0070690_100012443 3300005330 Bacteria 5006
14 Ga0070690_100110179 3300005330 Bacteria 1836
15 Ga0070670_100012028 3300005331 Bacteria 7403
16 Ga0070670_100236519 3300005331 Unclassified 1590
17 Ga0070677_10003241 3300005333 Bacteria 5238
18 Ga0070677_10009525 3300005333 Bacteria 3298
19 Ga0070677_10019176 3300005333 Bacteria 2474
20 Ga0070677_10224930 3300005333 Unclassified 919
21 Ga0070677_10324938 3300005333 Bacteria 789
22 Ga0068869_100026124 3300005334 Bacteria 4062
23 Ga0068869_100043539 3300005334 Unclassified 3225
24 Ga0070666_10230193 3300005335 Bacteria 1309
25 Ga0070666_10620129 3300005335 Bacteria 790
26 Ga0070680_100443922 3300005336 Unclassified 1108
27 Ga0070680_100599617 3300005336 Unclassified 945
28 Ga0070689_100007829 3300005340 Bacteria 7489
29 Ga0070689_100047340 3300005340 Unclassified 3316
30 Ga0070689_100745228 3300005340 Unclassified 858
31 Ga0070691_10002981 3300005341 Bacteria 7579
32 Ga0070687_100003387 3300005343 Bacteria 6187
33 Ga0070687_100035585 3300005343 Bacteria 2474
34 Ga0070687_100561921 3300005343 Bacteria 778
35 Ga0070661_100057701 3300005344 Bacteria 2845
36 Ga0070661_100320341 3300005344 Bacteria 1211
37 Ga0070661_100559445 3300005344 Bacteria 921
38 Ga0070668_100007282 3300005347 Bacteria 8208
39 Ga0070668_100834146 3300005347 Bacteria 821
40 Ga0070669_100368229 3300005353 Bacteria 1170
41 Ga0070669_100965493 3300005353 Unclassified 730
42 Ga0070675_100010812 3300005354 Bacteria 7136
43 Ga0070675_100039161 3300005354 Bacteria 3866
44 Ga0070675_100171081 3300005354 Bacteria 1873
45 Ga0070675_100435577 3300005354 Bacteria 1174
46 Ga0070675_101272075 3300005354 Bacteria 678
47 Ga0070671_100017974 3300005355 Bacteria 5736
48 Ga0070671_100501540 3300005355 Bacteria 1044
49 Ga0070671_100827711 3300005355 Bacteria 807
50 Ga0070674_100000184 3300005356 Bacteria 29352
51 Ga0070674_100613934 3300005356 Bacteria 920
52 Ga0070674_101128014 3300005356 Bacteria 693
53 Ga0070673_100002459 3300005364 Bacteria 11293
54 Ga0070673_100331470 3300005364 Unclassified 1347
55 Ga0070688_100069059 3300005365 Bacteria 2255
56 Ga0070688_100155058 3300005365 Bacteria 1568
57 Ga0070688_100216558 3300005365 Bacteria 1347
58 Ga0070667_100070485 3300005367 Bacteria 2975
59 Ga0070703_10018052 3300005406 Unclassified 2037
60 Ga0070701_10027881 3300005438 Unclassified 2772
61 Ga0070701_10118987 3300005438 Bacteria 1486
62 Ga0070701_10175605 3300005438 Unclassified 1250
63 Ga0070701_10917151 3300005438 Bacteria 606
64 Ga0070705_100001246 3300005440 Bacteria 13745
65 Ga0070705_100012465 3300005440 Bacteria 4323
66 Ga0070700_100050877 3300005441 Bacteria 2577
67 Ga0070700_100476382 3300005441 Unclassified 955
68 Ga0070694_100006230 3300005444 Bacteria 7241
69 Ga0070694_100015315 3300005444 Bacteria 4814
70 Ga0070694_100112589 3300005444 Bacteria 1941
71 Ga0070694_100154819 3300005444 Bacteria 1677
72 Ga0070694_100396744 3300005444 Bacteria 1079
73 Ga0070694_100528910 3300005444 Unclassified 942
74 Ga0070708_100854668 3300005445 Bacteria 855
75 Ga0070678_100044250 3300005456 Bacteria 3178
76 Ga0070678_100259223 3300005456 Bacteria 1461
77 Ga0070678_100281218 3300005456 Bacteria 1407
78 Ga0070678_100350797 3300005456 Unclassified 1269
79 Ga0070678_100787691 3300005456 Bacteria 862
80 Ga0070662_100019192 3300005457 Bacteria 4638
81 Ga0070681_10002269 3300005458 Bacteria 17565
82 Ga0068867_100317551 3300005459 Bacteria 1289
83 Ga0068867_100439897 3300005459 Bacteria 1108
84 Ga0070685_10276941 3300005466 Bacteria 1122
85 Ga0070685_11044425 3300005466 Bacteria 615
86 Ga0070706_100205183 3300005467 Bacteria 1841
87 Ga0070707_100024783 3300005468 Bacteria 5687
88 Ga0070707_100150395 3300005468 Bacteria 2267
89 Ga0070707_100554116 3300005468 Unclassified 1112
90 Ga0070698_100033194 3300005471 Bacteria 5345
91 Ga0070699_100002664 3300005518 Bacteria 15952
92 Ga0070699_100036210 3300005518 Bacteria 4269
93 Ga0070699_100687997 3300005518 Bacteria 934
94 Ga0070679_100946382 3300005530 Unclassified 805
95 Ga0070684_100003808 3300005535 Bacteria 11401
96 Ga0070684_100469140 3300005535 Unclassified 1164
97 Ga0070684_100823497 3300005535 Unclassified 868
98 Ga0070697_100097030 3300005536 Bacteria 2446
99 Ga0070672_100017696 3300005543 Bacteria 5135
100 Ga0070672_100031413 3300005543 Bacteria 3997
101 Ga0070672_100057758 3300005543 Bacteria 3047
102 Ga0070672_100156921 3300005543 Unclassified 1885
103 Ga0070672_101638422 3300005543 Unclassified 578
104 Ga0070686_100008492 3300005544 Bacteria 5752
105 Ga0070686_100113598 3300005544 Bacteria 1849
106 Ga0070686_100558107 3300005544 Unclassified 897
107 Ga0070695_100523285 3300005545 Unclassified 920
108 Ga0070696_100000162 3300005546 Bacteria 37754
109 Ga0070696_100020204 3300005546 Bacteria 4514
110 Ga0070696_100035125 3300005546 Bacteria 3449
111 Ga0070693_100216960 3300005547 Bacteria 1251
112 Ga0070665_100020117 3300005548 Bacteria 6701
113 Ga0070704_100013714 3300005549 Bacteria 5040
114 Ga0070704_100017083 3300005549 Bacteria 4604
115 Ga0070704_100630642 3300005549 Unclassified 945
116 Ga0070704_100805010 3300005549 Unclassified 840
117 Ga0070704_100845279 3300005549 Bacteria 820
118 Ga0070664_100001327 3300005564 Bacteria 19736
119 Ga0070664_100006051 3300005564 Bacteria 9782
120 Ga0070664_100043157 3300005564 Bacteria 3804
121 Ga0070664_100147502 3300005564 Bacteria 2075
122 Ga0070664_100255755 3300005564 Bacteria 1575
123 Ga0070664_101468102 3300005564 Unclassified 645
124 Ga0068854_100320786 3300005578 Bacteria 1259
125 Ga0070702_100120434 3300005615 Bacteria 1642
126 Ga0070702_100123192 3300005615 Bacteria 1626
127 Ga0068852_101444984 3300005616 Unclassified 710
128 Ga0068859_100029687 3300005617 Bacteria 5487
129 Ga0068859_100150168 3300005617 Unclassified 2405
130 Ga0068859_101306364 3300005617 Bacteria 799
131 Ga0068864_100100293 3300005618 Unclassified 2566
132 Ga0068864_100157635 3300005618 Bacteria 2061
133 Ga0068861_100094356 3300005719 Unclassified 2367
134 Ga0068861_100556594 3300005719 Bacteria 1046
135 Ga0068861_101228036 3300005719 Bacteria 726
136 Ga0068870_10002322 3300005840 Bacteria 7907
137 Ga0068870_10016596 3300005840 Bacteria 3522
138 Ga0068870_10141156 3300005840 Bacteria 1410
139 Ga0068870_10159367 3300005840 Bacteria 1337
140 Ga0068863_100005707 3300005841 Bacteria 12221
141 Ga0068863_100148493 3300005841 Bacteria 2242
142 Ga0068858_100039700 3300005842 Unclassified 4364
143 Ga0068858_100042408 3300005842 Bacteria 4219
144 Ga0068858_100894546 3300005842 Unclassified 868
145 Ga0068860_100558868 3300005843 Bacteria 1147
146 Ga0068862_100043253 3300005844 Bacteria 3839
147 Ga0068862_100287366 3300005844 Bacteria 1509
148 Ga0068862_100478810 3300005844 Bacteria 1178
149 Ga0068862_101070832 3300005844 Unclassified 800
150 Ga0097621_100367222 3300006237 Bacteria 1283
151 Ga0097621_101060294 3300006237 Bacteria 760
152 Ga0068871_100326181 3300006358 Bacteria 1353
153 Ga0068871_100854974 3300006358 Bacteria 841
154 Ga0075428_100001330 3300006844 Bacteria 26194
155 Ga0075428_100031815 3300006844 Bacteria 5828
156 Ga0075428_100044117 3300006844 Bacteria 4901
157 Ga0075428_100318155 3300006844 Bacteria 1672
158 Ga0075428_101191674 3300006844 Unclassified 803
159 Ga0075430_100001113 3300006846 Bacteria 21392
160 Ga0075430_100012835 3300006846 Bacteria 7139
161 Ga0075430_100087499 3300006846 Bacteria 2607
162 Ga0075431_100000943 3300006847 Bacteria 25642
163 Ga0075431_100041383 3300006847 Bacteria 4750
164 Ga0075431_100053684 3300006847 Unclassified 4155
165 Ga0075433_10006221 3300006852 Bacteria 9417
166 Ga0075433_10007213 3300006852 Bacteria 8800
167 Ga0075433_10046834 3300006852 Bacteria 3761
168 Ga0075433_10117977 3300006852 Bacteria 2355
169 Ga0075433_10286530 3300006852 Bacteria 1459
170 Ga0075434_100000390 3300006871 Bacteria 32102
171 Ga0075434_100013504 3300006871 Bacteria 7777
172 Ga0075434_100017800 3300006871 Bacteria 6853
173 Ga0075434_100022622 3300006871 Bacteria 6120
174 Ga0075434_100026784 3300006871 Bacteria 5653
175 Ga0075434_100065554 3300006871 Bacteria 3617
176 Ga0075429_100021954 3300006880 Bacteria 5535
177 Ga0075429_100024060 3300006880 Bacteria 5282
178 Ga0075429_100055813 3300006880 Bacteria 3437
179 Ga0075429_100105377 3300006880 Bacteria 2463
180 Ga0075429_100239347 3300006880 Bacteria 1590
181 Ga0068865_100077807 3300006881 Bacteria 2371
182 Ga0068865_100159925 3300006881 Bacteria 1717
183 Ga0068865_100222900 3300006881 Bacteria 1475
184 Ga0068865_100637215 3300006881 Bacteria 904
185 Ga0097620_100029686 3300006931 Bacteria 5487
186 Ga0097620_100150173 3300006931 Unclassified 2405
187 Ga0097620_101306564 3300006931 Bacteria 799
188 Ga0075435_100003605 3300007076 Bacteria 10528
189 Ga0075435_100032251 3300007076 Bacteria 4136
190 Ga0075435_100147396 3300007076 Bacteria 1977
191 Ga0075435_100267706 3300007076 Bacteria 1457
192 Ga0075435_100938501 3300007076 Unclassified 755
193 Ga0111539_10000155 3300009094 Bacteria 78151
194 Ga0111539_10001668 3300009094 Bacteria 29647
195 Ga0111539_10004228 3300009094 Bacteria 18819
196 Ga0111539_10028436 3300009094 Bacteria 6820
197 Ga0111539_10060656 3300009094 Bacteria 4482
198 Ga0111539_10163418 3300009094 Bacteria 2604
199 Ga0111539_10693100 3300009094 Bacteria 1186
200 Ga0114129_10007159 3300009147 Bacteria 15875
201 Ga0114129_10100322 3300009147 Bacteria 4006
202 Ga0114129_10166043 3300009147 Unclassified 3012
203 Ga0114129_10186120 3300009147 Bacteria 2822
204 Ga0105243_10020696 3300009148 Bacteria 4990
205 Ga0105242_11505095 3300009176 Bacteria 704
206 Ga0105248_10077517 3300009177 Bacteria 3736
207 Ga0105248_10617832 3300009177 Bacteria 1223
208 Ga0105248_10853040 3300009177 Bacteria 1028
209 Ga0105249_10001875 3300009553 Bacteria 18207
210 Ga0105249_10542142 3300009553 Unclassified 1213
211 Ga0105249_10556982 3300009553 Bacteria 1198
212 Ga0157315_1019667 3300012508 Unclassified 702
213 Ga0157371_10249529 3300013102 Bacteria 1277
214 Ga0157374_10319998 3300013296 Bacteria 1537
215 Ga0157374_10428673 3300013296 Bacteria 1322
216 Ga0157374_11801366 3300013296 Unclassified 637
217 Ga0157375_10072868 3300013308 Unclassified 3452
218 Ga0157375_10871549 3300013308 Unclassified 1046
219 Ga0157375_11226301 3300013308 Unclassified 880
220 Ga0157375_11440200 3300013308 Unclassified 812
221 Ga0163163_10034463 3300014325 Bacteria 4903
222 Ga0163163_11378574 3300014325 Bacteria 767
223 Ga0157380_10002598 3300014326 Bacteria 12209
224 Ga0157380_10106459 3300014326 Unclassified 2347
225 Ga0157380_11865303 3300014326 Unclassified 661
226 Ga0157377_10011273 3300014745 Bacteria 4456
227 Ga0157377_10052414 3300014745 Unclassified 2303
228 Ga0157376_10063633 3300014969 Bacteria 3108
229 Ga0157376_10073937 3300014969 Unclassified 2904
230 Ga0157376_10444213 3300014969 Bacteria 1264
231 Ga0163161_10296146 3300017792 Bacteria 1273
232 Ga0163161_10880478 3300017792 Bacteria 757
233 Ga0207697_10008323 3300025315 Bacteria 4548
234 Ga0207697_10057839 3300025315 Bacteria 1609
235 Ga0207682_10003436 3300025893 Bacteria 6885
236 Ga0207682_10019616 3300025893 Bacteria 2647
237 Ga0207682_10044771 3300025893 Unclassified 1815
238 Ga0207642_10062770 3300025899 Archaea 1735
239 Ga0207688_10001408 3300025901 Bacteria 12540
240 Ga0207688_10033861 3300025901 Bacteria 2827
241 Ga0207680_10022674 3300025903 Bacteria 3418
242 Ga0207680_10148319 3300025903 Bacteria 1562
243 Ga0207680_10434556 3300025903 Bacteria 931
244 Ga0207645_10046655 3300025907 Bacteria 2767
245 Ga0207645_10148446 3300025907 Bacteria 1529
246 Ga0207643_10000832 3300025908 Bacteria 18731
247 Ga0207643_10023989 3300025908 Bacteria 3366
248 Ga0207643_10059877 3300025908 Bacteria 2173
249 Ga0207643_10564266 3300025908 Unclassified 731
250 Ga0207705_10285169 3300025909 Bacteria 1265
251 Ga0207707_10075978 3300025912 Bacteria 2931
252 Ga0207662_10001126 3300025918 Bacteria 12574
253 Ga0207662_10197417 3300025918 Unclassified 1301
254 Ga0207662_10216371 3300025918 Bacteria 1246
255 Ga0207649_10033337 3300025920 Bacteria 3077
256 Ga0207649_10195421 3300025920 Bacteria 1425
257 Ga0207649_10492711 3300025920 Bacteria 931
258 Ga0207652_11032103 3300025921 Unclassified 721
259 Ga0207646_10028251 3300025922 Bacteria 5108
260 Ga0207646_10842481 3300025922 Bacteria 815
261 Ga0207681_10051542 3300025923 Bacteria 2789
262 Ga0207681_10093822 3300025923 Bacteria 2149
263 Ga0207681_10389437 3300025923 Bacteria 1123
264 Ga0207681_10899323 3300025923 Unclassified 741
265 Ga0207650_10018796 3300025925 Bacteria 4853
266 Ga0207650_10177728 3300025925 Bacteria 1695
267 Ga0207650_10566605 3300025925 Unclassified 953
268 Ga0207659_10009648 3300025926 Bacteria 6038
269 Ga0207659_10186805 3300025926 Bacteria 1646
270 Ga0207659_10384820 3300025926 Bacteria 1170
271 Ga0207659_10405043 3300025926 Bacteria 1142
272 Ga0207659_10443488 3300025926 Unclassified 1092
273 Ga0207644_10012282 3300025931 Bacteria 5685
274 Ga0207644_10116372 3300025931 Unclassified 2029
275 Ga0207644_10733187 3300025931 Bacteria 825
276 Ga0207706_10001167 3300025933 Bacteria 26640
277 Ga0207706_10134630 3300025933 Unclassified 2173
278 Ga0207686_11074155 3300025934 Bacteria 655
279 Ga0207709_10018246 3300025935 Bacteria 3926
280 Ga0207670_10009419 3300025936 Bacteria 5574
281 Ga0207670_10057670 3300025936 Unclassified 2634
282 Ga0207670_10085868 3300025936 Bacteria 2212
283 Ga0207669_10003092 3300025937 Bacteria 7167
284 Ga0207669_10265269 3300025937 Bacteria 1287
285 Ga0207704_10079924 3300025938 Bacteria 2109
286 Ga0207704_10089847 3300025938 Bacteria 2014
287 Ga0207704_10658060 3300025938 Bacteria 863
288 Ga0207691_10002416 3300025940 Bacteria 18274
289 Ga0207691_10012096 3300025940 Bacteria 8273
290 Ga0207691_10115709 3300025940 Bacteria 2381
291 Ga0207691_10132534 3300025940 Bacteria 2200
292 Ga0207691_10210034 3300025940 Unclassified 1691
293 Ga0207689_10001780 3300025942 Bacteria 20354
294 Ga0207689_10012443 3300025942 Bacteria 7270
295 Ga0207689_10146464 3300025942 Bacteria 1946
296 Ga0207661_10055765 3300025944 Bacteria 3171
297 Ga0207661_11216920 3300025944 Unclassified 693
298 Ga0207679_10017606 3300025945 Bacteria 4770
299 Ga0207679_10024238 3300025945 Bacteria 4159
300 Ga0207679_10210450 3300025945 Bacteria 1630
301 Ga0207651_10001324 3300025960 Bacteria 11180
302 Ga0207651_10057591 3300025960 Bacteria 2681
303 Ga0207651_10196038 3300025960 Bacteria 1614
304 Ga0207712_10003102 3300025961 Bacteria 10607
305 Ga0207712_10221836 3300025961 Bacteria 1512
306 Ga0207668_10005576 3300025972 Bacteria 7421
307 Ga0207668_10311070 3300025972 Bacteria 1304
308 Ga0207668_11820962 3300025972 Unclassified 549
309 Ga0207658_10228834 3300025986 Bacteria 1568
310 Ga0207677_10434626 3300026023 Bacteria 1121
311 Ga0207703_10020351 3300026035 Bacteria 5188
312 Ga0207703_10504397 3300026035 Bacteria 1136
313 Ga0207703_10748721 3300026035 Bacteria 931
314 Ga0207708_10016714 3300026075 Bacteria 5521
315 Ga0207708_10026199 3300026075 Unclassified 4410
316 Ga0207708_10954726 3300026075 Bacteria 744
317 Ga0207641_10087563 3300026088 Bacteria 2717
318 Ga0207641_10590152 3300026088 Bacteria 1087
319 Ga0207648_10004887 3300026089 Bacteria 13658
320 Ga0207648_10040027 3300026089 Bacteria 4119
321 Ga0207648_10095352 3300026089 Bacteria 2602
322 Ga0207674_10340299 3300026116 Bacteria 1450
323 Ga0207674_10441875 3300026116 Bacteria 1257
324 Ga0207675_100003798 3300026118 Bacteria 14710
325 Ga0207675_100111527 3300026118 Unclassified 2581
326 Ga0207675_101179924 3300026118 Unclassified 786
327 Ga0207675_101417632 3300026118 Bacteria 715
328 Ga0207683_10005236 3300026121 Bacteria 11137
329 Ga0207683_10063158 3300026121 Bacteria 3262
330 Ga0207683_10094442 3300026121 Unclassified 2665
331 Ga0207683_10337587 3300026121 Bacteria 1382
332 Ga0207698_10105529 3300026142 Bacteria 2348
333 Ga0207698_10859051 3300026142 Bacteria 913
334 Ga0209970_1045507 3300027614 Unclassified 787
335 Ga0207428_10000743 3300027907 Bacteria 37326
336 Ga0207428_10003157 3300027907 Bacteria 16148
337 Ga0207428_10034330 3300027907 Bacteria 4157
338 Ga0207428_10097362 3300027907 Bacteria 2277
339 Ga0268266_10033074 3300028379 Bacteria 4397
340 Ga0268265_10249991 3300028380 Bacteria 1570
341 Ga0268265_10264679 3300028380 Bacteria 1530
342 Ga0268265_10468476 3300028380 Bacteria 1180
343 Ga0268264_10082762 3300028381 Bacteria 2747
344 Ga0307408_100281388 3300031548 Bacteria 1385
345 Ga0307408_100526902 3300031548 Bacteria 1039
346 Ga0307408_100613022 3300031548 Bacteria 969
347 Ga0307408_100747157 3300031548 Bacteria 883
348 Ga0307405_10004140 3300031731 Bacteria 6817
349 Ga0307413_10082428 3300031824 Bacteria 2066
350 Ga0307413_10216875 3300031824 Unclassified 1394
351 Ga0307413_10345978 3300031824 Bacteria 1145
352 Ga0307410_10033247 3300031852 Bacteria 3328
353 Ga0307410_10034867 3300031852 Bacteria 3263
354 Ga0307407_10001340 3300031903 Bacteria 8836
355 Ga0307412_10531017 3300031911 Unclassified 985
356 Ga0307412_10644937 3300031911 Bacteria 902
357 Ga0307412_11390900 3300031911 Bacteria 635
358 Ga0307409_100004345 3300031995 Bacteria 7945
359 Ga0307409_100011026 3300031995 Bacteria 5667
360 Ga0307409_100047542 3300031995 Bacteria 3258
361 Ga0307409_100472160 3300031995 Bacteria 1215
362 Ga0307409_100957480 3300031995 Unclassified 872
363 Ga0307409_101642150 3300031995 Unclassified 671
364 Ga0307416_100026803 3300032002 Bacteria 4254
365 Ga0307416_100110150 3300032002 Unclassified 2424
366 Ga0307416_100242212 3300032002 Bacteria 1748
367 Ga0307416_100517699 3300032002 Bacteria 1260
368 Ga0307416_100683516 3300032002 Bacteria 1114
369 Ga0307416_101313957 3300032002 Unclassified 829
370 Ga0307414_10047186 3300032004 Unclassified 2963
371 Ga0307414_10450874 3300032004 Bacteria 1128
372 Ga0307411_10013832 3300032005 Bacteria 4470
373 Ga0307411_10075046 3300032005 Bacteria 2307
374 Ga0307415_100005547 3300032126 Bacteria 6713
375 Ga0316583_10214805 3300032133 Bacteria 667
376 Ga0373949_0004120 3300035090 Bacteria 3362
377 Ga0373932_0004782 3300035112 Bacteria 3193
378 Ga0373961_0059658 3300035241 Bacteria 1154
379 Ga0400489_87963 3300039093 Bacteria 1019
380 Ga0451807_0396761 3300041486 Bacteria 939
381 Ga0439433_0052949 3300041999 Unclassified 959
382 Ga0439450_003085 3300042008 Bacteria 2713
383 Ga0439455_0084608 3300042012 Unclassified 865
384 Ga0450923_111619 3300042125 Unclassified 638
385 Ga0439446_0270573 3300042156 Unclassified 590
386 Ga0439464_0023161 3300042439 Bacteria 1714
387 Ga0450918_055175 3300042531 Unclassified 728
388 Ga0453683_0319586 3300044673 Bacteria 995
389 Ga0451576_0015279 3300045051 Bacteria 8511
390 Ga0451576_0021557 3300045051 Bacteria 7003
391 Ga0451576_0043125 3300045051 Bacteria 4760
392 Ga0451576_0188661 3300045051 Bacteria 2153
393 Ga0451576_1109911 3300045051 Bacteria 827
394 Ga0451576_1160653 3300045051 Bacteria 807
395 Ga0495603_0022746 3300046455 Bacteria 3793
396 Ga0495629_0112291 3300046459 Bacteria 1899
397 Ga0495594_0191594 3300046499 Bacteria 1165
398 Ga0495609_0114787 3300046538 Unclassified 1161
399 Ga0495621_0087375 3300046539 Bacteria 1171
400 Ga0495633_0299593 3300046558 Bacteria 730
401 Ga0495656_0543610 3300046615 Bacteria 619
402 Ga0495658_0026318 3300046683 Bacteria 3117
403 Ga0495624_0049896 3300046690 Bacteria 2653
404 Ga0495670_0199951 3300046691 Bacteria 1058
405 Ga0495670_0207502 3300046691 Bacteria 1039
406 Ga0495672_0264755 3300047320 Bacteria 828
407 Ga0495676_0094234 3300047321 Bacteria 2231
408 Ga0495677_0095610 3300047445 Bacteria 1122
409 Ga0495685_114902 3300047447 Bacteria 885
410 Ga0496109_0119134 3300048912 Bacteria 2458
411 Ga0496114_1104750 3300048917 Bacteria 678
412 Ga0501036_0035587 3300049572 Unclassified 4213
413 Ga0501036_0802734 3300049572 Unclassified 775
414 Ga0501037_0223787 3300049573 Bacteria 1323
415 Ga0501039_0016018 3300049575 Bacteria 5741
416 Ga0501040_0010188 3300049576 Bacteria 6146
417 Ga0501041_0709303 3300049577 Bacteria 644
418 Ga0501042_0047087 3300049578 Unclassified 3074
419 Ga0501043_0417710 3300049579 Unclassified 1011
420 Ga0501046_0091999 3300049580 Unclassified 2333
421 Ga0501046_0366834 3300049580 Bacteria 1044
422 Ga0501048_0093968 3300049582 Unclassified 2115
423 Ga0501071_1124666 3300049587 Unclassified 607
424 Ga0501074_0966113 3300049590 Unclassified 599
425 Ga0501075_0111412 3300049591 Unclassified 2081
426 Ga0501202_155128 3300049652 Bacteria 602
427 Ga0501080_1806531 3300049742 Unclassified 513
428 Ga0501081_0405938 3300049743 Unclassified 1009
429 Ga0501035_1353907 3300049822 Bacteria 547
430 Ga0501045_0035906 3300049824 Unclassified 3599
431 nmdc:mga05p37_18864_c1 3300050507 Bacteria 8338
432 nmdc:mga05p37_25657_c1 3300050507 Bacteria 6651
433 nmdc:mga05p37_617258_c1 3300050507 Unclassified 1221
434 nmdc:mga05p37_954644_c1 3300050507 Unclassified 917
435 nmdc:mga09592_16506_c1 3300050508 Bacteria 6041
436 nmdc:mga09592_226010_c1 3300050508 Bacteria 1622
437 nmdc:mga09592_43372_c1 3300050508 Bacteria 3786
438 nmdc:mga09592_76455_c1 3300050508 Bacteria 2847
439 nmdc:mga0qj67_16784_c1 3300050509 Bacteria 5561
440 nmdc:mga0qj67_96232_c1 3300050509 Bacteria 2384
441 nmdc:mga06r32_12137_c1 3300050510 Bacteria 7771
442 nmdc:mga06r32_1694_c1 3300050510 Bacteria 19858
443 nmdc:mga06r32_186960_c1 3300050510 Bacteria 2059
444 nmdc:mga06r32_32001_c1 3300050510 Bacteria 4944
445 nmdc:mga08y16_10760_c1 3300050511 Bacteria 9602
446 nmdc:mga08y16_22501_c1 3300050511 Bacteria 6653
447 nmdc:mga08y16_395527_c1 3300050511 Unclassified 1415
448 nmdc:mga08y16_48221_c1 3300050511 Bacteria 4458
449 nmdc:mga08y16_6917_c1 3300050511 Bacteria 11893
450 nmdc:mga08y16_70921_c1 3300050511 Bacteria 3631
451 nmdc:mga0n895_13608_c1 3300050512 Bacteria 7351
452 nmdc:mga0n895_21210_c1 3300050512 Bacteria 6070
453 nmdc:mga0n895_40876_c1 3300050512 Bacteria 4506
454 nmdc:mga0n895_49363_c1 3300050512 Unclassified 4122
455 nmdc:mga0n895_5713_c1 3300050512 Bacteria 10434
456 nmdc:mga0n895_655111_c1 3300050512 Bacteria 1049
457 nmdc:mga0rr50_237815_c1 3300050513 Bacteria 1509
458 nmdc:mga0rr50_51719_c1 3300050513 Bacteria 3050
459 nmdc:mga0rr50_58595_c1 3300050513 Bacteria 2887
460 nmdc:mga0a205_216313_c1 3300050515 Bacteria 1803
461 nmdc:mga0a205_5087_c1 3300050515 Bacteria 11826
462 nmdc:mga0a205_598_c1 3300050515 Bacteria 28678
463 nmdc:mga0a205_70086_c1 3300050515 Unclassified 3385
464 nmdc:mga0a205_810988_c1 3300050515 Bacteria 784
465 Ga0501084_0227350 3300054114 Unclassified 1574
466 Ga0590071_000394 3300059421 Bacteria 12861
467 Ga0590074_031366 3300059423 Bacteria 939
468 Ga0590075_013340 3300059424 Bacteria 2002
469 Ga0590077_008490 3300059426 Bacteria 2103
470 Ga0530510_0002611 3300061734 Bacteria 12391
471 Ga0501076_0972997
472 JGI24742J22300_10062470
473 Ga0065712_10024518
474 Ga0065712_10111560
475 Ga0065712_10149226
476 Ga0065712_10411189
477 Ga0065712_10606765
478 Ga0065715_10008143
479 Ga0065715_10214214
480 Ga0065715_10345605
481 Ga0070676_10719236
482 Ga0070683_100025250
483 Ga0070690_100012443
484 Ga0070690_100110179
485 Ga0070670_100012028
486 Ga0070670_100236519
487 Ga0070677_10003241
488 Ga0070677_10009525
489 Ga0070677_10019176
490 Ga0070677_10224930
491 Ga0070677_10324938
492 Ga0068869_100026124
493 Ga0068869_100043539
494 Ga0070666_10230193
495 Ga0070666_10620129
496 Ga0070680_100443922
497 Ga0070680_100599617
498 Ga0070689_100007829
499 Ga0070689_100047340
500 Ga0070689_100745228
501 Ga0070691_10002981
502 Ga0070687_100003387
503 Ga0070687_100035585
504 Ga0070687_100561921
505 Ga0070661_100057701
506 Ga0070661_100320341
507 Ga0070661_100559445
508 Ga0070668_100007282
509 Ga0070668_100834146
510 Ga0070669_100368229
511 Ga0070669_100965493
512 Ga0070675_100010812
513 Ga0070675_100039161
514 Ga0070675_100171081
515 Ga0070675_100435577
516 Ga0070675_101272075
517 Ga0070671_100017974
518 Ga0070671_100501540
519 Ga0070671_100827711
520 Ga0070674_100000184
521 Ga0070674_100613934
522 Ga0070674_101128014
523 Ga0070673_100002459
524 Ga0070673_100331470
525 Ga0070688_100069059
526 Ga0070688_100155058
527 Ga0070688_100216558
528 Ga0070667_100070485
529 Ga0070703_10018052
530 Ga0070701_10027881
531 Ga0070701_10118987
532 Ga0070701_10175605
533 Ga0070701_10917151
534 Ga0070705_100001246
535 Ga0070705_100012465
536 Ga0070700_100050877
537 Ga0070700_100476382
538 Ga0070694_100006230
539 Ga0070694_100015315
540 Ga0070694_100112589
541 Ga0070694_100154819
542 Ga0070694_100396744
543 Ga0070694_100528910
544 Ga0070708_100854668
545 Ga0070678_100044250
546 Ga0070678_100259223
547 Ga0070678_100281218
548 Ga0070678_100350797
549 Ga0070678_100787691
550 Ga0070662_100019192
551 Ga0070681_10002269
552 Ga0068867_100317551
553 Ga0068867_100439897
554 Ga0070685_10276941
555 Ga0070685_11044425
556 Ga0070706_100205183
557 Ga0070707_100024783
558 Ga0070707_100150395
559 Ga0070707_100554116
560 Ga0070698_100033194
561 Ga0070699_100002664
562 Ga0070699_100036210
563 Ga0070699_100687997
564 Ga0070679_100946382
565 Ga0070684_100003808
566 Ga0070684_100469140
567 Ga0070684_100823497
568 Ga0070697_100097030
569 Ga0070672_100017696
570 Ga0070672_100031413
571 Ga0070672_100057758
572 Ga0070672_100156921
573 Ga0070672_101638422
574 Ga0070686_100008492
575 Ga0070686_100113598
576 Ga0070686_100558107
577 Ga0070695_100523285
578 Ga0070696_100000162
579 Ga0070696_100020204
580 Ga0070696_100035125
581 Ga0070693_100216960
582 Ga0070665_100020117
583 Ga0070704_100013714
584 Ga0070704_100017083
585 Ga0070704_100630642
586 Ga0070704_100805010
587 Ga0070704_100845279
588 Ga0070664_100001327
589 Ga0070664_100006051
590 Ga0070664_100043157
591 Ga0070664_100147502
592 Ga0070664_100255755
593 Ga0070664_101468102
594 Ga0068854_100320786
595 Ga0070702_100120434
596 Ga0070702_100123192
597 Ga0068852_101444984
598 Ga0068859_100029687
599 Ga0068859_100150168
600 Ga0068859_101306364
601 Ga0068864_100100293
602 Ga0068864_100157635
603 Ga0068861_100094356
604 Ga0068861_100556594
605 Ga0068861_101228036
606 Ga0068870_10002322
607 Ga0068870_10016596
608 Ga0068870_10141156
609 Ga0068870_10159367
610 Ga0068863_100005707
611 Ga0068863_100148493
612 Ga0068858_100039700
613 Ga0068858_100042408
614 Ga0068858_100894546
615 Ga0068860_100558868
616 Ga0068862_100043253
617 Ga0068862_100287366
618 Ga0068862_100478810
619 Ga0068862_101070832
620 Ga0097621_100367222
621 Ga0097621_101060294
622 Ga0068871_100326181
623 Ga0068871_100854974
624 Ga0075428_100001330
625 Ga0075428_100031815
626 Ga0075428_100044117
627 Ga0075428_100318155
628 Ga0075428_101191674
629 Ga0075430_100001113
630 Ga0075430_100012835
631 Ga0075430_100087499
632 Ga0075431_100000943
633 Ga0075431_100041383
634 Ga0075431_100053684
635 Ga0075433_10006221
636 Ga0075433_10007213
637 Ga0075433_10046834
638 Ga0075433_10117977
639 Ga0075433_10286530
640 Ga0075434_100000390
641 Ga0075434_100013504
642 Ga0075434_100017800
643 Ga0075434_100022622
644 Ga0075434_100026784
645 Ga0075434_100065554
646 Ga0075429_100021954
647 Ga0075429_100024060
648 Ga0075429_100055813
649 Ga0075429_100105377
650 Ga0075429_100239347
651 Ga0068865_100077807
652 Ga0068865_100159925
653 Ga0068865_100222900
654 Ga0068865_100637215
655 Ga0097620_100029686
656 Ga0097620_100150173
657 Ga0097620_101306564
658 Ga0075435_100003605
659 Ga0075435_100032251
660 Ga0075435_100147396
661 Ga0075435_100267706
662 Ga0075435_100938501
663 Ga0111539_10000155
664 Ga0111539_10001668
665 Ga0111539_10004228
666 Ga0111539_10028436
667 Ga0111539_10060656
668 Ga0111539_10163418
669 Ga0111539_10693100
670 Ga0114129_10007159
671 Ga0114129_10100322
672 Ga0114129_10166043
673 Ga0114129_10186120
674 Ga0105243_10020696
675 Ga0105242_11505095
676 Ga0105248_10077517
677 Ga0105248_10617832
678 Ga0105248_10853040
679 Ga0105249_10001875
680 Ga0105249_10542142
681 Ga0105249_10556982
682 Ga0157315_1019667
683 Ga0157371_10249529
684 Ga0157374_10319998
685 Ga0157374_10428673
686 Ga0157374_11801366
687 Ga0157375_10072868
688 Ga0157375_10871549
689 Ga0157375_11226301
690 Ga0157375_11440200
691 Ga0163163_10034463
692 Ga0163163_11378574
693 Ga0157380_10002598
694 Ga0157380_10106459
695 Ga0157380_11865303
696 Ga0157377_10011273
697 Ga0157377_10052414
698 Ga0157376_10063633
699 Ga0157376_10073937
700 Ga0157376_10444213
701 Ga0163161_10296146
702 Ga0163161_10880478
703 Ga0207697_10008323
704 Ga0207697_10057839
705 Ga0207682_10003436
706 Ga0207682_10019616
707 Ga0207682_10044771
708 Ga0207642_10062770
709 Ga0207688_10001408
710 Ga0207688_10033861
711 Ga0207680_10022674
712 Ga0207680_10148319
713 Ga0207680_10434556
714 Ga0207645_10046655
715 Ga0207645_10148446
716 Ga0207643_10000832
717 Ga0207643_10023989
718 Ga0207643_10059877
719 Ga0207643_10564266
720 Ga0207705_10285169
721 Ga0207707_10075978
722 Ga0207662_10001126
723 Ga0207662_10197417
724 Ga0207662_10216371
725 Ga0207649_10033337
726 Ga0207649_10195421
727 Ga0207649_10492711
728 Ga0207652_11032103
729 Ga0207646_10028251
730 Ga0207646_10842481
731 Ga0207681_10051542
732 Ga0207681_10093822
733 Ga0207681_10389437
734 Ga0207681_10899323
735 Ga0207650_10018796
736 Ga0207650_10177728
737 Ga0207650_10566605
738 Ga0207659_10009648
739 Ga0207659_10186805
740 Ga0207659_10384820
741 Ga0207659_10405043
742 Ga0207659_10443488
743 Ga0207644_10012282
744 Ga0207644_10116372
745 Ga0207644_10733187
746 Ga0207706_10001167
747 Ga0207706_10134630
748 Ga0207686_11074155
749 Ga0207709_10018246
750 Ga0207670_10009419
751 Ga0207670_10057670
752 Ga0207670_10085868
753 Ga0207669_10003092
754 Ga0207669_10265269
755 Ga0207704_10079924
756 Ga0207704_10089847
757 Ga0207704_10658060
758 Ga0207691_10002416
759 Ga0207691_10012096
760 Ga0207691_10115709
761 Ga0207691_10132534
762 Ga0207691_10210034
763 Ga0207689_10001780
764 Ga0207689_10012443
765 Ga0207689_10146464
766 Ga0207661_10055765
767 Ga0207661_11216920
768 Ga0207679_10017606
769 Ga0207679_10024238
770 Ga0207679_10210450
771 Ga0207651_10001324
772 Ga0207651_10057591
773 Ga0207651_10196038
774 Ga0207712_10003102
775 Ga0207712_10221836
776 Ga0207668_10005576
777 Ga0207668_10311070
778 Ga0207668_11820962
779 Ga0207658_10228834
780 Ga0207677_10434626
781 Ga0207703_10020351
782 Ga0207703_10504397
783 Ga0207703_10748721
784 Ga0207708_10016714
785 Ga0207708_10026199
786 Ga0207708_10954726
787 Ga0207641_10087563
788 Ga0207641_10590152
789 Ga0207648_10004887
790 Ga0207648_10040027
791 Ga0207648_10095352
792 Ga0207674_10340299
793 Ga0207674_10441875
794 Ga0207675_100003798
795 Ga0207675_100111527
796 Ga0207675_101179924
797 Ga0207675_101417632
798 Ga0207683_10005236
799 Ga0207683_10063158
800 Ga0207683_10094442
801 Ga0207683_10337587
802 Ga0207698_10105529
803 Ga0207698_10859051
804 Ga0209970_1045507
805 Ga0207428_10000743
806 Ga0207428_10003157
807 Ga0207428_10034330
808 Ga0207428_10097362
809 Ga0268266_10033074
810 Ga0268265_10249991
811 Ga0268265_10264679
812 Ga0268265_10468476
813 Ga0268264_10082762
814 Ga0307408_100281388
815 Ga0307408_100526902
816 Ga0307408_100613022
817 Ga0307408_100747157
818 Ga0307405_10004140
819 Ga0307413_10082428
820 Ga0307413_10216875
821 Ga0307413_10345978
822 Ga0307410_10033247
823 Ga0307410_10034867
824 Ga0307407_10001340
825 Ga0307412_10531017
826 Ga0307412_10644937
827 Ga0307412_11390900
828 Ga0307409_100004345
829 Ga0307409_100011026
830 Ga0307409_100047542
831 Ga0307409_100472160
832 Ga0307409_100957480
833 Ga0307409_101642150
834 Ga0307416_100026803
835 Ga0307416_100110150
836 Ga0307416_100242212
837 Ga0307416_100517699
838 Ga0307416_100683516
839 Ga0307416_101313957
840 Ga0307414_10047186
841 Ga0307414_10450874
842 Ga0307411_10013832
843 Ga0307411_10075046
844 Ga0307415_100005547
845 Ga0316583_10214805
846 Ga0373949_0004120
847 Ga0373932_0004782
848 Ga0373961_0059658
849 Ga0400489_87963
850 Ga0451807_0396761
851 Ga0439433_0052949
852 Ga0439450_003085
853 Ga0439455_0084608
854 Ga0450923_111619
855 Ga0439446_0270573
856 Ga0439464_0023161
857 Ga0450918_055175
858 Ga0453683_0319586
859 Ga0451576_0015279
860 Ga0451576_0021557
861 Ga0451576_0043125
862 Ga0451576_0188661
863 Ga0451576_1109911
864 Ga0451576_1160653
865 Ga0495603_0022746
866 Ga0495629_0112291
867 Ga0495594_0191594
868 Ga0495609_0114787
869 Ga0495621_0087375
870 Ga0495633_0299593
871 Ga0495656_0543610
872 Ga0495658_0026318
873 Ga0495624_0049896
874 Ga0495670_0199951
875 Ga0495670_0207502
876 Ga0495672_0264755
877 Ga0495676_0094234
878 Ga0495677_0095610
879 Ga0495685_114902
880 Ga0496109_0119134
881 Ga0496114_1104750
882 Ga0501036_0035587
883 Ga0501036_0802734
884 Ga0501037_0223787
885 Ga0501039_0016018
886 Ga0501040_0010188
887 Ga0501041_0709303
888 Ga0501042_0047087
889 Ga0501043_0417710
890 Ga0501046_0091999
891 Ga0501046_0366834
892 Ga0501048_0093968
893 Ga0501071_1124666
894 Ga0501074_0966113
895 Ga0501075_0111412
896 Ga0501202_155128
897 Ga0501080_1806531
898 Ga0501081_0405938
899 Ga0501035_1353907
900 Ga0501045_0035906
901 nmdc:mga05p37_18864_c1
902 nmdc:mga05p37_25657_c1
903 nmdc:mga05p37_617258_c1
904 nmdc:mga05p37_954644_c1
905 nmdc:mga09592_16506_c1
906 nmdc:mga09592_226010_c1
907 nmdc:mga09592_43372_c1
908 nmdc:mga09592_76455_c1
909 nmdc:mga0qj67_16784_c1
910 nmdc:mga0qj67_96232_c1
911 nmdc:mga06r32_12137_c1
912 nmdc:mga06r32_1694_c1
913 nmdc:mga06r32_186960_c1
914 nmdc:mga06r32_32001_c1
915 nmdc:mga08y16_10760_c1
916 nmdc:mga08y16_22501_c1
917 nmdc:mga08y16_395527_c1
918 nmdc:mga08y16_48221_c1
919 nmdc:mga08y16_6917_c1
920 nmdc:mga08y16_70921_c1
921 nmdc:mga0n895_13608_c1
922 nmdc:mga0n895_21210_c1
923 nmdc:mga0n895_40876_c1
924 nmdc:mga0n895_49363_c1
925 nmdc:mga0n895_5713_c1
926 nmdc:mga0n895_655111_c1
927 nmdc:mga0rr50_237815_c1
928 nmdc:mga0rr50_51719_c1
929 nmdc:mga0rr50_58595_c1
930 nmdc:mga0a205_216313_c1
931 nmdc:mga0a205_5087_c1
932 nmdc:mga0a205_598_c1
933 nmdc:mga0a205_70086_c1
934 nmdc:mga0a205_810988_c1
935 Ga0501084_0227350
936 Ga0590071_000394
937 Ga0590074_031366
938 Ga0590075_013340
939 Ga0590077_008490
940 Ga0530510_0002611

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05163

DinB

DinB family

4

155

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dka-assembly1.cif.gz_A crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.8221 6 155
3dka-assembly1.cif.gz_B crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.8177 6 155
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.8111 1 156
3gor-assembly2.cif.gz_D crystal structure of putative metal-dependent hydrolase apc36150 0.8055 4 155
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.8003 2 156
ID Description Score Start End Superfamily
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8224 6 148 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8138 4 149 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.805 6 148 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7879 2 156 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7818 4 149 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A7S7NN10-F1-model_v4 DinB family protein 0.981 1 163
AF-A0A523DJI7-F1-model_v4 DUF664 domain-containing protein 0.9803 1 162
AF-A0A5B8V9W8-F1-model_v4 DinB family protein 0.9795 1 163
AF-A0A7X4E0P0-F1-model_v4 DUF664 domain-containing protein 0.9785 4 163
AF-A0A2W0BAR8-F1-model_v4 Damage-inducible protein DinB 0.9781 1 163

Map