metagRoot

F450484

General Info

Members	Datasets	Scaffolds	Average Seq Length
470	263	467	253

Family's Representative Sequence

Representative Sequence	3300047444\|Ga0495675_0057135\|Ga0495675_0057135_1550_2422
Length	290
Sequence	VQAVEQAAMSISRPPGRHVMVRVKRMKAARLVVLTVAIAAGGVAAMLAGRSEKPPEVKMTPAPQIATVDVLVAKNDIPMGQAISPGDVRWEQWPTAAAGGNFIRRSDRPNAIENLSGSVARAPFVNGEPIREAKLVNAKGSGFMAAILPSGMRAISTQISPETGAGGFILPNDHVDVILTRRDRDAEKTAGADTHTSETILTNVRVLAIDQNVQEKDGQKVVVGKTATLELTPQQTEALAVSQQLGTLSLALRSITDASHDAPIAEDTLGKRRNGVNVVRFGVGTMMTPR

Samples

	Sample ID	Description	Type	Environment
1	2524023210	Bradyrhizobium sp. Ai1a-2	Isolate	Nodule
2	2643221651	Afipia sp. Root123D2	Isolate	Unclassified
3	2885383462	Bradyrhizobium sp. Leo170	Isolate	Unclassified
4	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
5	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
6	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
7	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
8	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
9	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
10	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
11	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
12	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
13	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
14	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
15	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
16	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
17	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
18	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
19	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
20	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
21	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
22	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
23	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
24	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
25	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
26	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
27	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
28	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
29	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
30	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
31	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
32	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
33	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
34	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
35	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
36	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
37	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
38	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
39	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
40	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
41	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
42	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
43	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
44	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
45	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
46	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
47	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
48	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
49	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
50	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
51	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
52	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
53	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
54	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
55	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
56	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
57	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
58	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
59	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
60	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
61	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
62	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
63	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
64	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
65	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
66	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
67	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
68	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
69	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
70	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
71	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
72	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
73	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
74	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
75	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
76	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
77	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
78	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
79	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
80	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
81	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
82	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
83	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
84	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
121	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
122	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
123	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
124	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
125	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
126	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
127	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
128	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
129	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
130	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
131	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
132	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
133	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
134	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
135	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
136	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
137	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
138	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
139	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
140	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
141	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
142	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
143	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
144	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
145	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
146	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
147	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
148	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
149	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
150	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
151	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
152	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
153	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
154	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
155	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
156	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
157	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
158	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
159	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
160	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
161	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
162	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
163	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
164	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
165	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
166	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
167	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
168	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
169	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
170	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
171	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
172	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
173	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
174	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
175	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
176	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
177	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
178	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
179	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
180	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
181	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
182	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
183	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
184	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
185	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
186	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
187	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
188	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
189	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
190	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
191	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
192	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
193	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
194	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
195	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
196	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
197	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
198	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
199	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
200	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
201	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
202	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
203	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
204	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
205	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
206	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
207	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
208	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
209	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
210	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
211	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
212	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
213	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
214	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
215	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
216	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
217	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
218	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
219	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
220	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
221	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
222	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
223	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
224	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
225	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
226	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
227	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
228	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
229	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
230	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
231	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
232	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
233	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
234	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
235	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
236	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
237	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
238	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
239	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
240	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
241	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
242	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
243	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
244	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
245	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
246	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
247	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
248	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
249	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
250	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
251	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
252	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
253	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
254	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
255	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
256	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
257	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
258	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
259	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
260	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
261	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
262	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
263	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.94
Metatranscriptomes	0.43
Isolates	0.64

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	11.06
Nodule	0.21
Rhizoplane	1.7
Rhizosphere	84.47
Stem	0
Stem Tuber	0
Unclassified	2.55

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25153J46596_10011224	3300003215	Bacteria	3977
2	Ga0070658_10004547	3300005327	Bacteria	11276
3	Ga0070658_10184865	3300005327	Bacteria	1755
4	Ga0070676_10030145	3300005328	Bacteria	3091
5	Ga0070676_10168897	3300005328	Bacteria	1413
6	Ga0070683_100032251	3300005329	Bacteria	4771
7	Ga0070670_100188621	3300005331	Bacteria	1791
8	Ga0070670_100370769	3300005331	Bacteria	1260
9	Ga0070680_100011487	3300005336	Bacteria	6852
10	Ga0070680_100227613	3300005336	Bacteria	1574
11	Ga0070660_100019659	3300005339	Bacteria	4952
12	Ga0070660_100283202	3300005339	Bacteria	1357
13	Ga0070689_100517813	3300005340	Bacteria	1024
14	Ga0070669_100043776	3300005353	Bacteria	3262
15	Ga0070675_100033030	3300005354	Bacteria	4192
16	Ga0070671_100125732	3300005355	Bacteria	2158
17	Ga0070674_100011896	3300005356	Bacteria	5319
18	Ga0070673_100115783	3300005364	Bacteria	2229
19	Ga0070659_100026429	3300005366	Bacteria	4468
20	Ga0070659_100136206	3300005366	Bacteria	1997
21	Ga0070659_100161488	3300005366	Bacteria	1832
22	Ga0070667_100015594	3300005367	Bacteria	6283
23	Ga0070667_100185240	3300005367	Bacteria	1842
24	Ga0070714_100021688	3300005435	Bacteria	5257
25	Ga0070713_100009523	3300005436	Bacteria	6960
26	Ga0070710_10311802	3300005437	Bacteria	1030
27	Ga0070678_100012889	3300005456	Bacteria	5217
28	Ga0070681_10029471	3300005458	Bacteria	5512
29	Ga0070681_10069951	3300005458	Bacteria	3475
30	Ga0070681_10393948	3300005458	Bacteria	1296
31	Ga0068867_100186660	3300005459	Bacteria	1652
32	Ga0070685_10024129	3300005466	Bacteria	3337
33	Ga0070679_100096590	3300005530	Bacteria	2942
34	Ga0070679_100101330	3300005530	Bacteria	2866
35	Ga0070679_100106514	3300005530	Bacteria	2789
36	Ga0070684_100011557	3300005535	Bacteria	7034
37	Ga0068853_100094529	3300005539	Bacteria	2634
38	Ga0068853_100168828	3300005539	Bacteria	1978
39	Ga0070672_100081855	3300005543	Bacteria	2589
40	Ga0068855_100010706	3300005563	Bacteria	11066
41	Ga0068855_100135141	3300005563	Bacteria	2814
42	Ga0068855_100272344	3300005563	Bacteria	1882
43	Ga0068855_100362974	3300005563	Bacteria	1593
44	Ga0068857_100016403	3300005577	Bacteria	6491
45	Ga0068857_100063666	3300005577	Bacteria	3279
46	Ga0068854_100285596	3300005578	Bacteria	1330
47	Ga0068856_100708847	3300005614	Bacteria	1027
48	Ga0068852_100126890	3300005616	Bacteria	2344
49	Ga0068852_100358686	3300005616	Bacteria	1425
50	Ga0068859_100017592	3300005617	Bacteria	7186
51	Ga0068863_100028965	3300005841	Bacteria	5289
52	Ga0068858_100171046	3300005842	Bacteria	2049
53	Ga0068862_100478377	3300005844	Bacteria	1178
54	Ga0081455_10034830	3300005937	Bacteria	4507
55	Ga0081538_10072621	3300005981	Bacteria	1885
56	Ga0081540_1005218	3300005983	Bacteria	9724
57	Ga0075365_10000806	3300006038	Bacteria	12877
58	Ga0075365_10000993	3300006038	Bacteria	12114
59	Ga0075368_10021869	3300006042	Bacteria	2432
60	Ga0075363_100001522	3300006048	Bacteria	8872
61	Ga0075363_100096822	3300006048	Bacteria	1630
62	Ga0075363_100298578	3300006048	Bacteria	934
63	Ga0075364_10001819	3300006051	Bacteria	11812
64	Ga0075364_10007447	3300006051	Bacteria	6500
65	Ga0075364_10007652	3300006051	Bacteria	6424
66	Ga0070716_100305302	3300006173	Bacteria	1109
67	Ga0075362_10091774	3300006177	Bacteria	1410
68	Ga0075367_10009807	3300006178	Bacteria	5017
69	Ga0075367_10088393	3300006178	Bacteria	1883
70	Ga0075367_10280624	3300006178	Bacteria	1047
71	Ga0075369_10196872	3300006186	Bacteria	929
72	Ga0075366_10000506	3300006195	Bacteria	18061
73	Ga0075366_10007060	3300006195	Bacteria	6180
74	Ga0075370_10060670	3300006353	Bacteria	2154
75	Ga0075370_10109448	3300006353	Bacteria	1603
76	Ga0075428_100645426	3300006844	Bacteria	1129
77	Ga0075431_100302302	3300006847	Bacteria	1616
78	Ga0075433_10518874	3300006852	Bacteria	1048
79	Ga0075434_100228531	3300006871	Bacteria	1880
80	Ga0075429_100148654	3300006880	Bacteria	2051
81	Ga0068865_100200418	3300006881	Bacteria	1549
82	Ga0075436_100033551	3300006914	Bacteria	3539
83	Ga0075436_100121741	3300006914	Bacteria	1826
84	Ga0097620_100017593	3300006931	Bacteria	7186
85	Ga0099795_10026962	3300007788	Bacteria	1940
86	Ga0105240_10042112	3300009093	Bacteria	5822
87	Ga0105247_10009142	3300009101	Bacteria	6031
88	Ga0114129_10139908	3300009147	Bacteria	3319
89	Ga0114129_10775183	3300009147	Bacteria	1225
90	Ga0114129_10814696	3300009147	Bacteria	1190
91	Ga0114129_10947626	3300009147	Bacteria	1087
92	Ga0105243_10148562	3300009148	Bacteria	2008
93	Ga0105237_10070183	3300009545	Bacteria	3499
94	Ga0105238_10053501	3300009551	Bacteria	4057
95	Ga0105238_10453697	3300009551	Bacteria	1279
96	Ga0105249_10384721	3300009553	Bacteria	1430
97	Ga0099796_10013528	3300010159	Bacteria	2333
98	Ga0157373_10025581	3300013100	Bacteria	4268
99	Ga0157371_10048722	3300013102	Bacteria	3012
100	Ga0157371_10487564	3300013102	Bacteria	909
101	Ga0157370_10014911	3300013104	Bacteria	7927
102	Ga0157370_10434241	3300013104	Bacteria	1208
103	Ga0157369_10072582	3300013105	Bacteria	3694
104	Ga0157372_10129979	3300013307	Bacteria	2897
105	Ga0157372_10270569	3300013307	Bacteria	1974
106	Ga0157372_10467612	3300013307	Bacteria	1470
107	Ga0157375_10201078	3300013308	Bacteria	2148
108	Ga0163163_10050530	3300014325	Bacteria	4094
109	Ga0182008_10113803	3300014497	Bacteria	1341
110	Ga0157379_10156736	3300014968	Bacteria	2054
111	Ga0163161_10260276	3300017792	Bacteria	1355
112	Ga0206354_10071518	3300020081	Bacteria	2371
113	Ga0206353_10496150	3300020082	Bacteria	1107
114	Ga0213875_10000011	3300021388	Bacteria	332447
115	Ga0209677_100388	3300025253	Bacteria	26746
116	Ga0209758_1006431	3300025297	Bacteria	8448
117	Ga0207682_10000372	3300025893	Bacteria	20677
118	Ga0207710_10008840	3300025900	Bacteria	4241
119	Ga0207688_10145530	3300025901	Bacteria	1397
120	Ga0207680_10405009	3300025903	Bacteria	964
121	Ga0207645_10017209	3300025907	Bacteria	4775
122	Ga0207645_10171534	3300025907	Bacteria	1422
123	Ga0207705_10115872	3300025909	Bacteria	1983
124	Ga0207705_10280147	3300025909	Bacteria	1276
125	Ga0207707_10048321	3300025912	Bacteria	3706
126	Ga0207707_10218387	3300025912	Bacteria	1659
127	Ga0207707_10544007	3300025912	Bacteria	987
128	Ga0207695_10028693	3300025913	Bacteria	6161
129	Ga0207693_10064980	3300025915	Bacteria	2857
130	Ga0207693_10152914	3300025915	Bacteria	1815
131	Ga0207693_10221995	3300025915	Bacteria	1484
132	Ga0207660_10145069	3300025917	Bacteria	1818
133	Ga0207660_10165959	3300025917	Bacteria	1707
134	Ga0207660_10250221	3300025917	Bacteria	1398
135	Ga0207662_10017734	3300025918	Bacteria	4031
136	Ga0207657_10002624	3300025919	Bacteria	19420
137	Ga0207657_10040730	3300025919	Bacteria	4114
138	Ga0207657_10050898	3300025919	Bacteria	3602
139	Ga0207652_10010745	3300025921	Bacteria	7371
140	Ga0207652_10088637	3300025921	Bacteria	2715
141	Ga0207681_10183317	3300025923	Bacteria	1596
142	Ga0207694_10037123	3300025924	Bacteria	3740
143	Ga0207694_10047880	3300025924	Bacteria	3307
144	Ga0207694_10049264	3300025924	Bacteria	3261
145	Ga0207650_10088906	3300025925	Bacteria	2357
146	Ga0207659_10142570	3300025926	Bacteria	1861
147	Ga0207659_10191974	3300025926	Bacteria	1626
148	Ga0207664_10029442	3300025929	Bacteria	4182
149	Ga0207686_10410330	3300025934	Bacteria	1034
150	Ga0207670_10375973	3300025936	Bacteria	1131
151	Ga0207669_10006211	3300025937	Bacteria	5439
152	Ga0207665_10037373	3300025939	Bacteria	3232
153	Ga0207661_10035067	3300025944	Bacteria	3907
154	Ga0207667_10053060	3300025949	Bacteria	4267
155	Ga0207667_10091817	3300025949	Bacteria	3136
156	Ga0207667_10221311	3300025949	Bacteria	1939
157	Ga0207667_10350584	3300025949	Bacteria	1505
158	Ga0207668_10166537	3300025972	Bacteria	1724
159	Ga0207640_10209093	3300025981	Bacteria	1485
160	Ga0207658_10024740	3300025986	Bacteria	4202
161	Ga0207639_10231283	3300026041	Bacteria	1602
162	Ga0207678_10564892	3300026067	Bacteria	996
163	Ga0207702_10000063	3300026078	Bacteria	123034
164	Ga0207702_10605833	3300026078	Bacteria	1075
165	Ga0207648_10014153	3300026089	Bacteria	7377
166	Ga0207648_10333860	3300026089	Bacteria	1364
167	Ga0207676_10011733	3300026095	Bacteria	6265
168	Ga0207674_10015694	3300026116	Bacteria	8311
169	Ga0207674_10055792	3300026116	Bacteria	4015
170	Ga0207683_10017090	3300026121	Bacteria	6174
171	Ga0207698_10098236	3300026142	Bacteria	2419
172	Ga0209179_1001693	3300027512	Bacteria	2793
173	Ga0265318_10011238	3300028577	Bacteria	3862
174	Ga0265338_10021310	3300028800	Bacteria	6764
175	Ga0265330_10007719	3300031235	Bacteria	5224
176	Ga0265330_10019518	3300031235	Bacteria	3106
177	Ga0265330_10033504	3300031235	Bacteria	2297
178	Ga0265332_10012252	3300031238	Bacteria	3805
179	Ga0265325_10000672	3300031241	Bacteria	24929
180	Ga0265325_10007938	3300031241	Bacteria	6305
181	Ga0265325_10020585	3300031241	Bacteria	3635
182	Ga0265325_10046028	3300031241	Bacteria	2264
183	Ga0265325_10070475	3300031241	Bacteria	1756
184	Ga0265329_10018102	3300031242	Bacteria	2413
185	Ga0265329_10048960	3300031242	Bacteria	1347
186	Ga0265340_10037930	3300031247	Bacteria	2385
187	Ga0265331_10046301	3300031250	Bacteria	2096
188	Ga0265316_10026170	3300031344	Bacteria	4860
189	Ga0265316_10029600	3300031344	Bacteria	4499
190	Ga0265316_10141291	3300031344	Bacteria	1808
191	Ga0265316_10158177	3300031344	Bacteria	1695
192	Ga0307408_100518742	3300031548	Bacteria	1046
193	Ga0265313_10000525	3300031595	Bacteria	40049
194	Ga0265313_10011516	3300031595	Bacteria	5490
195	Ga0265313_10011978	3300031595	Bacteria	5346
196	Ga0265314_10003505	3300031711	Bacteria	15140
197	Ga0265314_10007404	3300031711	Bacteria	9517
198	Ga0265314_10095938	3300031711	Bacteria	1919
199	Ga0265342_10000882	3300031712	Bacteria	29894
200	Ga0265342_10006148	3300031712	Bacteria	8986
201	Ga0265342_10011895	3300031712	Bacteria	5921
202	Ga0265342_10030931	3300031712	Bacteria	3313
203	Ga0307405_10148805	3300031731	Bacteria	1644
204	Ga0373923_0000353	3300035111	Bacteria	10413
205	Ga0373936_0001000	3300035113	Bacteria	10085
206	Ga0373941_0000525	3300035115	Bacteria	7684
207	Ga0373945_0002718	3300035116	Bacteria	5553
208	Ga0373953_0009859	3300035117	Bacteria	3306
209	Ga0373954_0028775	3300035118	Bacteria	2556
210	Ga0373956_0078482	3300035119	Bacteria	1512
211	Ga0373957_0021293	3300035120	Bacteria	2300
212	Ga0373943_0001873	3300035170	Bacteria	9516
213	Ga0373946_0011235	3300035171	Bacteria	3335
214	Ga0373955_0000087	3300035172	Bacteria	37402
215	Ga0373955_0013574	3300035172	Bacteria	3943
216	Ga0373955_0061181	3300035172	Bacteria	2079
217	Ga0373924_0000324	3300035410	Bacteria	14673
218	Ga0373924_0085274	3300035410	Bacteria	1347
219	Ga0373935_0000167	3300035692	Bacteria	30761
220	Ga0373927_0073662	3300035695	Bacteria	2211
221	Ga0373933_0010197	3300035724	Bacteria	5146
222	Ga0373933_0021539	3300035724	Bacteria	3662
223	Ga0373947_0003868	3300035725	Bacteria	8814
224	Ga0373937_0000006	3300036401	Bacteria	194781
225	Ga0373937_0078018	3300036401	Bacteria	3060
226	Ga0373925_0000002	3300037068	Bacteria	368879
227	Ga0395899_0012074	3300037312	Bacteria	6616
228	Ga0395900_0001475	3300037418	Bacteria	28056
229	Ga0395900_0481813	3300037418	Bacteria	1193
230	Ga0395898_0022707	3300037466	Bacteria	6350
231	Ga0395898_0289218	3300037466	Bacteria	1563
232	Ga0436364_0728139	3300037853	Bacteria	64829
233	Ga0436364_1379942	3300037853	Bacteria	1789
234	Ga0395901_0011499	3300038443	Bacteria	8969
235	Ga0395901_0037746	3300038443	Bacteria	4996
236	Ga0436365_1003223	3300039437	Bacteria	1652
237	Ga0436365_1681734	3300039437	Bacteria	2918
238	Ga0436365_1813374	3300039437	Bacteria	3886
239	Ga0436363_0348507	3300039450	Bacteria	1673
240	Ga0439453_0009821	3300041408	Bacteria	1566
241	Ga0450908_027652	3300042184	Bacteria	988
242	Ga0466961_0276189	3300044693	Bacteria	1029
243	Ga0466963_0003055	3300044694	Bacteria	9475
244	Ga0466963_0342592	3300044694	Bacteria	1052
245	Ga0466971_0064621	3300044719	Bacteria	1657
246	Ga0466971_0076364	3300044719	Bacteria	1524
247	Ga0466957_0010574	3300044842	Bacteria	5303
248	Ga0466959_0139706	3300045049	Bacteria	1713
249	Ga0466959_0225570	3300045049	Bacteria	1298
250	Ga0466958_0014051	3300045836	Bacteria	4568
251	Ga0466967_0001550	3300045976	Bacteria	13463
252	Ga0466967_0355552	3300045976	Bacteria	1418
253	Ga0466967_0503469	3300045976	Bacteria	1189
254	Ga0495592_0000039	3300046454	Bacteria	124471
255	Ga0495629_0003335	3300046459	Bacteria	12135
256	Ga0495641_0079913	3300046461	Bacteria	1465
257	Ga0495651_0000420	3300046462	Bacteria	32886
258	Ga0495651_0146209	3300046462	Bacteria	1709
259	Ga0495653_0000006	3300046463	Bacteria	363285
260	Ga0495662_0002917	3300046476	Bacteria	8643
261	Ga0495664_0000002	3300046477	Bacteria	625183
262	Ga0495608_0000009	3300046511	Bacteria	266614
263	Ga0495618_0000005	3300046514	Bacteria	230421
264	Ga0495628_0000002	3300046516	Bacteria	589399
265	Ga0495630_0000865	3300046517	Bacteria	21326
266	Ga0495652_0000004	3300046529	Bacteria	588877
267	Ga0495652_0139723	3300046529	Bacteria	1906
268	Ga0495640_0000005	3300046533	Bacteria	318271
269	Ga0495587_0000007	3300046536	Bacteria	290788
270	Ga0495587_0033812	3300046536	Bacteria	3085
271	Ga0495598_0023302	3300046537	Bacteria	1666
272	Ga0495621_0006145	3300046539	Bacteria	3490
273	Ga0495645_0000003	3300046543	Bacteria	570133
274	Ga0495667_0000002	3300046559	Bacteria	437535
275	Ga0495634_0000022	3300046642	Bacteria	118988
276	Ga0495635_0000020	3300046663	Bacteria	189698
277	Ga0495599_0000001	3300046678	Bacteria	537563
278	Ga0495623_0000001	3300046679	Bacteria	313861
279	Ga0495646_0000013	3300046680	Bacteria	159700
280	Ga0495613_0013661	3300046689	Bacteria	6025
281	Ga0495600_0000006	3300046809	Bacteria	151916
282	Ga0495600_0067932	3300046809	Bacteria	2330
283	Ga0495604_0000005	3300047317	Bacteria	424516
284	Ga0495674_0000003	3300047319	Bacteria	562126
285	Ga0495680_0000002	3300047322	Bacteria	197533
286	Ga0495675_0000010	3300047444	Bacteria	153375
287	Ga0495675_0057135	3300047444	Bacteria	2474
288	Ga0495685_036010	3300047447	Bacteria	1700
289	Ga0495684_0000028	3300047471	Bacteria	123549
290	Ga0495593_0002430	3300047673	Bacteria	11194
291	Ga0495602_0000054	3300048088	Bacteria	111411
292	Ga0495602_0322499	3300048088	Bacteria	1123
293	Ga0496100_0169441	3300048903	Bacteria	1571
294	Ga0496104_0327630	3300048907	Bacteria	1445
295	Ga0496108_0230178	3300048911	Bacteria	1612
296	Ga0496109_0139483	3300048912	Bacteria	2267
297	Ga0496109_0324657	3300048912	Bacteria	1453
298	Ga0496112_0028323	3300048915	Bacteria	5406
299	Ga0496112_0323272	3300048915	Bacteria	1487
300	Ga0496113_0058576	3300048916	Bacteria	2899
301	Ga0496118_0003033	3300048921	Bacteria	21657
302	Ga0496121_0027791	3300048924	Bacteria	5284
303	Ga0496125_0138236	3300048928	Bacteria	1699
304	Ga0501031_0000538	3300049568	Bacteria	22173
305	Ga0501031_0072799	3300049568	Bacteria	2237
306	Ga0501031_0098829	3300049568	Bacteria	1904
307	Ga0501031_0229428	3300049568	Bacteria	1208
308	Ga0501032_0000040	3300049569	Bacteria	115662
309	Ga0501032_0056252	3300049569	Bacteria	2644
310	Ga0501033_0000326	3300049570	Bacteria	45367
311	Ga0501033_0011750	3300049570	Bacteria	6694
312	Ga0501033_0307172	3300049570	Bacteria	1116
313	Ga0501034_0000254	3300049571	Bacteria	97896
314	Ga0501034_0000734	3300049571	Bacteria	49577
315	Ga0501034_0022707	3300049571	Bacteria	6391
316	Ga0501034_0042997	3300049571	Bacteria	4573
317	Ga0501034_0148973	3300049571	Bacteria	2316
318	Ga0501034_0541288	3300049571	Bacteria	1074
319	Ga0501034_0568291	3300049571	Bacteria	1042
320	Ga0501036_0005317	3300049572	Bacteria	10414
321	Ga0501036_0119318	3300049572	Bacteria	2227
322	Ga0501037_0000041	3300049573	Bacteria	118457
323	Ga0501037_0010168	3300049573	Bacteria	6903
324	Ga0501037_0044444	3300049573	Bacteria	3262
325	Ga0501038_0000057	3300049574	Bacteria	92766
326	Ga0501038_0066265	3300049574	Bacteria	3075
327	Ga0501038_0106367	3300049574	Bacteria	2329
328	Ga0501038_0126383	3300049574	Bacteria	2104
329	Ga0501039_0000084	3300049575	Bacteria	71542
330	Ga0501039_0015274	3300049575	Bacteria	5877
331	Ga0501039_0044970	3300049575	Bacteria	3410
332	Ga0501042_0180437	3300049578	Bacteria	1523
333	Ga0501042_0194527	3300049578	Bacteria	1463
334	Ga0501042_0235404	3300049578	Bacteria	1321
335	Ga0501043_0000184	3300049579	Bacteria	56470
336	Ga0501043_0011800	3300049579	Bacteria	6843
337	Ga0501043_0031876	3300049579	Bacteria	4143
338	Ga0501043_0330107	3300049579	Bacteria	1162
339	Ga0501046_0000072	3300049580	Bacteria	106407
340	Ga0501046_0020915	3300049580	Bacteria	5403
341	Ga0501046_0070864	3300049580	Bacteria	2709
342	Ga0501046_0182011	3300049580	Bacteria	1571
343	Ga0501047_0000044	3300049581	Bacteria	174789
344	Ga0501047_0011180	3300049581	Bacteria	8494
345	Ga0501047_0024453	3300049581	Bacteria	5796
346	Ga0501047_0038179	3300049581	Bacteria	4645
347	Ga0501047_0050728	3300049581	Bacteria	4007
348	Ga0501047_0087365	3300049581	Bacteria	2995
349	Ga0501047_0220785	3300049581	Bacteria	1751
350	Ga0501047_0450871	3300049581	Bacteria	1116
351	Ga0501047_0477811	3300049581	Bacteria	1074
352	Ga0501048_0069756	3300049582	Bacteria	2482
353	Ga0501048_0093316	3300049582	Bacteria	2123
354	Ga0501067_0000946	3300049583	Bacteria	15551
355	Ga0501067_0033763	3300049583	Bacteria	2838
356	Ga0501067_0049530	3300049583	Bacteria	2327
357	Ga0501067_0104976	3300049583	Bacteria	1570
358	Ga0501068_0000113	3300049584	Bacteria	34900
359	Ga0501068_0072334	3300049584	Bacteria	2105
360	Ga0501068_0138455	3300049584	Bacteria	1525
361	Ga0501068_0152519	3300049584	Bacteria	1453
362	Ga0501069_0001364	3300049585	Bacteria	11987
363	Ga0501069_0019185	3300049585	Bacteria	3695
364	Ga0501069_0064922	3300049585	Bacteria	2040
365	Ga0501069_0200933	3300049585	Bacteria	1155
366	Ga0501070_0000310	3300049586	Bacteria	44627
367	Ga0501070_0012759	3300049586	Bacteria	7084
368	Ga0501070_0170535	3300049586	Bacteria	1792
369	Ga0501070_0206382	3300049586	Bacteria	1613
370	Ga0501070_0492621	3300049586	Bacteria	985
371	Ga0501071_0141085	3300049587	Bacteria	1794
372	Ga0501072_0000297	3300049588	Bacteria	35134
373	Ga0501072_0081941	3300049588	Bacteria	2558
374	Ga0501072_0224051	3300049588	Bacteria	1498
375	Ga0501072_0274212	3300049588	Bacteria	1342
376	Ga0501072_0408587	3300049588	Bacteria	1077
377	Ga0501073_0000043	3300049589	Bacteria	80142
378	Ga0501073_0030355	3300049589	Bacteria	3859
379	Ga0501073_0265037	3300049589	Bacteria	1185
380	Ga0501074_0000111	3300049590	Bacteria	40575
381	Ga0501074_0005366	3300049590	Bacteria	9220
382	Ga0501074_0093031	3300049590	Bacteria	2159
383	Ga0501074_0256124	3300049590	Bacteria	1244
384	Ga0501074_0472186	3300049590	Bacteria	889
385	Ga0501075_0333598	3300049591	Bacteria	1156
386	Ga0501079_0027449	3300049741	Bacteria	4365
387	Ga0501079_0065854	3300049741	Bacteria	2795
388	Ga0501079_0123756	3300049741	Bacteria	2011
389	Ga0501080_0001812	3300049742	Bacteria	18330
390	Ga0501080_0138607	3300049742	Bacteria	2250
391	Ga0501080_0155262	3300049742	Bacteria	2114
392	Ga0501080_0264661	3300049742	Bacteria	1566
393	Ga0501081_0088042	3300049743	Bacteria	2181
394	Ga0501081_0191354	3300049743	Bacteria	1482
395	Ga0501083_0003568	3300049744	Bacteria	10904
396	Ga0501083_0015275	3300049744	Bacteria	5377
397	Ga0501083_0040771	3300049744	Bacteria	3151
398	Ga0501083_0129306	3300049744	Bacteria	1655
399	Ga0501083_0255843	3300049744	Bacteria	1140
400	Ga0501083_0259416	3300049744	Bacteria	1131
401	Ga0501035_0000128	3300049822	Bacteria	92297
402	Ga0501035_0038703	3300049822	Bacteria	4317
403	Ga0501035_0458675	3300049822	Bacteria	1053
404	Ga0501044_0000907	3300049823	Bacteria	35617
405	Ga0501044_0057312	3300049823	Bacteria	3998
406	Ga0501044_0144918	3300049823	Bacteria	2361
407	Ga0501044_0257213	3300049823	Bacteria	1685
408	Ga0501044_0294670	3300049823	Bacteria	1553
409	Ga0501045_0011740	3300049824	Bacteria	6155
410	Ga0501045_0035779	3300049824	Bacteria	3606
411	Ga0501045_0398254	3300049824	Bacteria	1025
412	nmdc:mga03n38_131528_c1	3300050490	Bacteria	1240
413	nmdc:mga03n38_62208_c1	3300050490	Bacteria	1702
414	nmdc:mga03n38_71221_c1	3300050490	Bacteria	1610
415	nmdc:mga00v17_147213_c1	3300050491	Bacteria	1512
416	nmdc:mga00v17_388941_c1	3300050491	Bacteria	907
417	nmdc:mga00v17_4175_c1	3300050491	Bacteria	7487
418	nmdc:mga00v17_7230_c1	3300050491	Bacteria	5916
419	nmdc:mga0yw44_101092_c1	3300050492	Bacteria	1837
420	nmdc:mga0yw44_633_c1	3300050492	Bacteria	12783
421	nmdc:mga0yw44_77769_c1	3300050492	Bacteria	2073
422	nmdc:mga0yw44_88888_c1	3300050492	Bacteria	1949
423	nmdc:mga0k408_1585_c1	3300050493	Bacteria	12299
424	nmdc:mga0k408_23450_c1	3300050493	Bacteria	3045
425	nmdc:mga06z11_12271_c1	3300050494	Bacteria	3722
426	nmdc:mga06z11_156771_c1	3300050494	Bacteria	1299
427	nmdc:mga06z11_171043_c1	3300050494	Bacteria	1248
428	nmdc:mga06z11_47475_c1	3300050494	Bacteria	2181
429	nmdc:mga06z11_5156_c1	3300050494	Bacteria	5213
430	nmdc:mga07m45_103498_c1	3300050496	Bacteria	1636
431	nmdc:mga07m45_103876_c1	3300050496	Bacteria	1633
432	nmdc:mga07m45_32590_c1	3300050496	Bacteria	2890
433	nmdc:mga05p37_142109_c1	3300050507	Bacteria	2940
434	nmdc:mga05p37_507020_c1	3300050507	Bacteria	1383
435	nmdc:mga0qj67_563241_c1	3300050509	Bacteria	913
436	nmdc:mga06r32_114921_c1	3300050510	Bacteria	2650
437	nmdc:mga08y16_209897_c1	3300050511	Bacteria	2017
438	nmdc:mga08x19_122523_c1	3300050514	Bacteria	1744
439	nmdc:mga0sz30_63508_c1	3300050516	Bacteria	1581
440	Ga0495601_0000008	3300053077	Bacteria	362152
441	Ga0495601_0020902	3300053077	Bacteria	4002
442	Ga0495601_0175805	3300053077	Bacteria	1399
443	Ga0495612_0000002	3300053078	Bacteria	310466
444	Ga0495612_0041019	3300053078	Bacteria	1887
445	Ga0495612_0066416	3300053078	Bacteria	1499
446	Ga0495595_0000008	3300053084	Bacteria	196206
447	Ga0495619_0000002	3300053085	Bacteria	530226
448	Ga0495619_0036464	3300053085	Bacteria	3203
449	Ga0495619_0045272	3300053085	Bacteria	2891
450	Ga0495619_0133438	3300053085	Bacteria	1707
451	Ga0495619_0138197	3300053085	Bacteria	1676
452	Ga0500583_0140975	3300053092	Bacteria	1198
453	Ga0500641_0001637	3300053096	Bacteria	7976
454	Ga0500641_0085381	3300053096	Bacteria	1343
455	Ga0500641_0148999	3300053096	Bacteria	1010
456	Ga0500658_0129710	3300053134	Bacteria	1123
457	Ga0500568_0061605	3300053139	Bacteria	1451
458	Ga0500604_0120639	3300053151	Bacteria	876
459	Ga0500616_0000038	3300053153	Bacteria	386801
460	Ga0500645_016332	3300053730	Bacteria	2340
461	Ga0501084_0006582	3300054114	Bacteria	9547
462	Ga0501084_0043717	3300054114	Bacteria	3747
463	Ga0501084_0592228	3300054114	Bacteria	937
464	Ga0501082_0006113	3300060353	Bacteria	10451
465	Ga0501082_0237183	3300060353	Bacteria	1587
466	Ga0501082_0237436	3300060353	Bacteria	1586
467	Ga0501082_0274387	3300060353	Bacteria	1468

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300053077	Ga0495601_0020902	Ga0495601_0020902_2900_3691	225
2	3300053078	Ga0495612_0041019	Ga0495612_0041019_186_977	225
3	3300053085	Ga0495619_0036464	Ga0495619_0036464_974_1765	225
4	3300005329	Ga0070683_100032251	Ga0070683_1000322514	226
5	3300005535	Ga0070684_100011557	Ga0070684_1000115574	226
6	3300013307	Ga0157372_10129979	Ga0157372_101299794	226
7	3300017792	Ga0163161_10260276	Ga0163161_102602761	226
8	3300025924	Ga0207694_10037123	Ga0207694_100371233	226
9	3300025944	Ga0207661_10035067	Ga0207661_100350673	226
10	3300031241	Ga0265325_10070475	Ga0265325_100704751	226
11	3300031344	Ga0265316_10026170	Ga0265316_100261703	226
12	3300031711	Ga0265314_10095938	Ga0265314_100959382	226
13	3300031712	Ga0265342_10006148	Ga0265342_100061485	226
14	3300005331	Ga0070670_100188621	Ga0070670_1001886212	227
15	3300005539	Ga0068853_100168828	Ga0068853_1001688282	227
16	3300005577	Ga0068857_100016403	Ga0068857_1000164032	227
17	3300005617	Ga0068859_100017592	Ga0068859_1000175922	227
18	3300005841	Ga0068863_100028965	Ga0068863_1000289652	227
19	3300005842	Ga0068858_100171046	Ga0068858_1001710463	227
20	3300006931	Ga0097620_100017593	Ga0097620_1000175932	227
21	3300009101	Ga0105247_10009142	Ga0105247_100091429	227
22	3300013308	Ga0157375_10201078	Ga0157375_102010782	227
23	3300014325	Ga0163163_10050530	Ga0163163_100505303	227
24	3300025900	Ga0207710_10008840	Ga0207710_100088404	227
25	3300025901	Ga0207688_10145530	Ga0207688_101455302	227
26	3300025903	Ga0207680_10405009	Ga0207680_104050091	227
27	3300025918	Ga0207662_10017734	Ga0207662_100177345	227
28	3300025924	Ga0207694_10049264	Ga0207694_100492642	227
29	3300025925	Ga0207650_10088906	Ga0207650_100889062	227
30	3300026095	Ga0207676_10011733	Ga0207676_100117337	227
31	3300026116	Ga0207674_10015694	Ga0207674_1001569411	227
32	3300005844	Ga0068862_100478377	Ga0068862_1004783772	228
33	3300009553	Ga0105249_10384721	Ga0105249_103847212	228
34	3300025907	Ga0207645_10171534	Ga0207645_101715342	228
35	3300039437	Ga0436365_1681734	Ga0436365_1681734_98_898	228
36	3300050511	nmdc:mga08y16_209897_c1	nmdc:mga08y16_209897_c1_1054_1857	228
37	3300005328	Ga0070676_10030145	Ga0070676_100301454	229
38	3300005353	Ga0070669_100043776	Ga0070669_1000437761	229
39	3300005354	Ga0070675_100033030	Ga0070675_1000330303	229
40	3300005355	Ga0070671_100125732	Ga0070671_1001257322	229
41	3300005356	Ga0070674_100011896	Ga0070674_1000118963	229
42	3300005364	Ga0070673_100115783	Ga0070673_1001157832	229
43	3300005367	Ga0070667_100185240	Ga0070667_1001852402	229
44	3300005456	Ga0070678_100012889	Ga0070678_1000128894	229
45	3300005459	Ga0068867_100186660	Ga0068867_1001866602	229
46	3300005466	Ga0070685_10024129	Ga0070685_100241295	229
47	3300005543	Ga0070672_100081855	Ga0070672_1000818553	229
48	3300006881	Ga0068865_100200418	Ga0068865_1002004182	229
49	3300025893	Ga0207682_10000372	Ga0207682_1000037214	229
50	3300025907	Ga0207645_10017209	Ga0207645_100172092	229
51	3300025926	Ga0207659_10142570	Ga0207659_101425702	229
52	3300025937	Ga0207669_10006211	Ga0207669_100062113	229
53	3300026089	Ga0207648_10014153	Ga0207648_100141535	229
54	3300026121	Ga0207683_10017090	Ga0207683_100170904	229
55	3300046537	Ga0495598_0023302	Ga0495598_0023302_35_835	229
56	3300046539	Ga0495621_0006145	Ga0495621_0006145_65_865	229
57	3300046809	Ga0495600_0067932	Ga0495600_0067932_157_954	229
58	3300047447	Ga0495685_036010	Ga0495685_036010_562_1362	229
59	3300048088	Ga0495602_0322499	Ga0495602_0322499_218_1015	229
60	3300048915	Ga0496112_0323272	Ga0496112_0323272_323_1120	229
61	3300048916	Ga0496113_0058576	Ga0496113_0058576_903_1700	229
62	3300049568	Ga0501031_0000538	Ga0501031_0000538_21242_21976	229
63	3300049569	Ga0501032_0000040	Ga0501032_0000040_55902_56636	229
64	3300049570	Ga0501033_0000326	Ga0501033_0000326_36553_37287	229
65	3300049571	Ga0501034_0000254	Ga0501034_0000254_46939_47673	229
66	3300049572	Ga0501036_0005317	Ga0501036_0005317_1600_2334	229
67	3300049573	Ga0501037_0000041	Ga0501037_0000041_55802_56536	229
68	3300049574	Ga0501038_0000057	Ga0501038_0000057_55387_56121	229
69	3300049575	Ga0501039_0000084	Ga0501039_0000084_29935_30669	229
70	3300049578	Ga0501042_0180437	Ga0501042_0180437_336_1070	229
71	3300049579	Ga0501043_0000184	Ga0501043_0000184_52831_53565	229
72	3300049580	Ga0501046_0000072	Ga0501046_0000072_49748_50482	229
73	3300049581	Ga0501047_0000044	Ga0501047_0000044_55884_56618	229
74	3300049583	Ga0501067_0000946	Ga0501067_0000946_10570_11304	229
75	3300049584	Ga0501068_0000113	Ga0501068_0000113_18618_19352	229
76	3300049585	Ga0501069_0001364	Ga0501069_0001364_701_1435	229
77	3300049586	Ga0501070_0000310	Ga0501070_0000310_4029_4763	229
78	3300049588	Ga0501072_0000297	Ga0501072_0000297_23350_24084	229
79	3300049589	Ga0501073_0000043	Ga0501073_0000043_36869_37603	229
80	3300049590	Ga0501074_0000111	Ga0501074_0000111_39141_39875	229
81	3300049741	Ga0501079_0027449	Ga0501079_0027449_1138_1872	229
82	3300049742	Ga0501080_0001812	Ga0501080_0001812_7076_7810	229
83	3300049822	Ga0501035_0000128	Ga0501035_0000128_19886_20620	229
84	3300049823	Ga0501044_0000907	Ga0501044_0000907_24595_25329	229
85	3300049824	Ga0501045_0011740	Ga0501045_0011740_5275_6009	229
86	3300050491	nmdc:mga00v17_4175_c1	nmdc:mga00v17_4175_c1_1968_2702	229
87	3300050492	nmdc:mga0yw44_101092_c1	nmdc:mga0yw44_101092_c1_664_1398	229
88	3300054114	Ga0501084_0006582	Ga0501084_0006582_8633_9367	229
89	3300060353	Ga0501082_0006113	Ga0501082_0006113_2646_3380	229
90	3300009148	Ga0105243_10148562	Ga0105243_101485621	230
91	3300025934	Ga0207686_10410330	Ga0207686_104103301	230
92	3300035111	Ga0373923_0000353	Ga0373923_0000353_5454_6248	230
93	3300035113	Ga0373936_0001000	Ga0373936_0001000_2951_3745	230
94	3300035116	Ga0373945_0002718	Ga0373945_0002718_995_1789	230
95	3300035117	Ga0373953_0009859	Ga0373953_0009859_1190_1984	230
96	3300035119	Ga0373956_0078482	Ga0373956_0078482_139_933	230
97	3300035170	Ga0373943_0001873	Ga0373943_0001873_5448_6242	230
98	3300035171	Ga0373946_0011235	Ga0373946_0011235_1232_2026	230
99	3300035172	Ga0373955_0000087	Ga0373955_0000087_31626_32420	230
100	3300035410	Ga0373924_0000324	Ga0373924_0000324_13200_13994	230
101	3300035410	Ga0373924_0085274	Ga0373924_0085274_345_1142	230
102	3300035692	Ga0373935_0000167	Ga0373935_0000167_26148_26942	230
103	3300035695	Ga0373927_0073662	Ga0373927_0073662_283_1077	230
104	3300035724	Ga0373933_0021539	Ga0373933_0021539_1548_2342	230
105	3300035725	Ga0373947_0003868	Ga0373947_0003868_2504_3298	230
106	3300036401	Ga0373937_0000006	Ga0373937_0000006_115285_116079	230
107	3300037068	Ga0373925_0000002	Ga0373925_0000002_246861_247655	230
108	3300042184	Ga0450908_027652	Ga0450908_027652_135_935	230
109	3300046454	Ga0495592_0000039	Ga0495592_0000039_120107_120901	230
110	3300046459	Ga0495629_0003335	Ga0495629_0003335_4876_5670	230
111	3300046461	Ga0495641_0079913	Ga0495641_0079913_223_1017	230
112	3300046462	Ga0495651_0000420	Ga0495651_0000420_14740_15534	230
113	3300046463	Ga0495653_0000006	Ga0495653_0000006_247009_247803	230
114	3300046476	Ga0495662_0002917	Ga0495662_0002917_1679_2473	230
115	3300046477	Ga0495664_0000002	Ga0495664_0000002_282643_283437	230
116	3300046511	Ga0495608_0000009	Ga0495608_0000009_196998_197792	230
117	3300046514	Ga0495618_0000005	Ga0495618_0000005_60002_60796	230
118	3300046516	Ga0495628_0000002	Ga0495628_0000002_247028_247822	230
119	3300046517	Ga0495630_0000865	Ga0495630_0000865_14702_15496	230
120	3300046529	Ga0495652_0000004	Ga0495652_0000004_341061_341855	230
121	3300046533	Ga0495640_0000005	Ga0495640_0000005_197013_197807	230
122	3300046536	Ga0495587_0000007	Ga0495587_0000007_120435_121229	230
123	3300046543	Ga0495645_0000003	Ga0495645_0000003_228279_229073	230
124	3300046559	Ga0495667_0000002	Ga0495667_0000002_189901_190695	230
125	3300046642	Ga0495634_0000022	Ga0495634_0000022_34217_35011	230
126	3300046663	Ga0495635_0000020	Ga0495635_0000020_56401_57195	230
127	3300046678	Ga0495599_0000001	Ga0495599_0000001_385706_386500	230
128	3300046679	Ga0495623_0000001	Ga0495623_0000001_154651_155445	230
129	3300046680	Ga0495646_0000013	Ga0495646_0000013_5284_6078	230
130	3300046689	Ga0495613_0013661	Ga0495613_0013661_1247_2041	230
131	3300046809	Ga0495600_0000006	Ga0495600_0000006_116186_116980	230
132	3300047317	Ga0495604_0000005	Ga0495604_0000005_272672_273466	230
133	3300047319	Ga0495674_0000003	Ga0495674_0000003_314304_315098	230
134	3300047322	Ga0495680_0000002	Ga0495680_0000002_50095_50889	230
135	3300047444	Ga0495675_0000010	Ga0495675_0000010_69165_69959	230
136	3300047471	Ga0495684_0000028	Ga0495684_0000028_2456_3250	230
137	3300047673	Ga0495593_0002430	Ga0495593_0002430_5642_6436	230
138	3300048088	Ga0495602_0000054	Ga0495602_0000054_85872_86666	230
139	3300049584	Ga0501068_0152519	Ga0501068_0152519_671_1408	230
140	3300050492	nmdc:mga0yw44_77769_c1	nmdc:mga0yw44_77769_c1_949_1755	230
141	3300053077	Ga0495601_0000008	Ga0495601_0000008_74920_75714	230
142	3300053077	Ga0495601_0175805	Ga0495601_0175805_487_1359	230
143	3300053078	Ga0495612_0000002	Ga0495612_0000002_158624_159418	230
144	3300053078	Ga0495612_0066416	Ga0495612_0066416_134_931	230
145	3300053084	Ga0495595_0000008	Ga0495595_0000008_75048_75842	230
146	3300053085	Ga0495619_0000002	Ga0495619_0000002_247031_247825	230
147	3300053085	Ga0495619_0045272	Ga0495619_0045272_132_941	230
148	3300053092	Ga0500583_0140975	Ga0500583_0140975_126_932	230
149	3300053096	Ga0500641_0085381	Ga0500641_0085381_107_913	230
150	3300053134	Ga0500658_0129710	Ga0500658_0129710_301_1107	230
151	3300053151	Ga0500604_0120639	Ga0500604_0120639_12_818	230
152	3300005937	Ga0081455_10034830	Ga0081455_100348301	231
153	3300006880	Ga0075429_100148654	Ga0075429_1001486542	231
154	3300048911	Ga0496108_0230178	Ga0496108_0230178_743_1552	231
155	3300005340	Ga0070689_100517813	Ga0070689_1005178131	232
156	3300005435	Ga0070714_100021688	Ga0070714_1000216884	232
157	3300021388	Ga0213875_10000011	Ga0213875_10000011202	232
158	3300037853	Ga0436364_0728139	Ga0436364_0728139_60854_61651	232
159	3300048912	Ga0496109_0139483	Ga0496109_0139483_929_1720	232
160	3300005458	Ga0070681_10393948	Ga0070681_103939481	233
161	3300049570	Ga0501033_0307172	Ga0501033_0307172_287_1084	233
162	3300049588	Ga0501072_0408587	Ga0501072_0408587_230_1051	233
163	3300049591	Ga0501075_0333598	Ga0501075_0333598_272_1093	233
164	3300049824	Ga0501045_0398254	Ga0501045_0398254_109_912	233
165	3300006038	Ga0075365_10000993	Ga0075365_100009936	234
166	3300006051	Ga0075364_10007447	Ga0075364_100074478	234
167	3300025915	Ga0207693_10064980	Ga0207693_100649802	234
168	3300025939	Ga0207665_10037373	Ga0207665_100373732	234
169	3300053085	Ga0495619_0133438	Ga0495619_0133438_612_1400	234
170	3300025972	Ga0207668_10166537	Ga0207668_101665372	235
171	3300027512	Ga0209179_1001693	Ga0209179_10016933	235
172	3300031241	Ga0265325_10000672	Ga0265325_1000067211	235
173	3300031595	Ga0265313_10011978	Ga0265313_100119782	235
174	3300025936	Ga0207670_10375973	Ga0207670_103759731	236
175	3300041408	Ga0439453_0009821	Ga0439453_0009821_333_1115	236
176	3300049743	Ga0501081_0191354	Ga0501081_0191354_19_813	236
177	3300060353	Ga0501082_0274387	Ga0501082_0274387_551_1345	236
178	3300009147	Ga0114129_10139908	Ga0114129_101399082	237
179	3300031241	Ga0265325_10020585	Ga0265325_100205854	237
180	3300050507	nmdc:mga05p37_142109_c1	nmdc:mga05p37_142109_c1_237_1025	237
181	3300005366	Ga0070659_100026429	Ga0070659_1000264296	239
182	3300026089	Ga0207648_10333860	Ga0207648_103338602	239
183	3300050509	nmdc:mga0qj67_563241_c1	nmdc:mga0qj67_563241_c1_12_809	239
184	3300006847	Ga0075431_100302302	Ga0075431_1003023022	240
185	3300031548	Ga0307408_100518742	Ga0307408_1005187421	240
186	3300050510	nmdc:mga06r32_114921_c1	nmdc:mga06r32_114921_c1_1312_2124	240
187	3300005981	Ga0081538_10072621	Ga0081538_100726212	241
188	3300009551	Ga0105238_10053501	Ga0105238_100535014	241
189	3300025923	Ga0207681_10183317	Ga0207681_101833171	241
190	3300028800	Ga0265338_10021310	Ga0265338_100213103	241
191	3300031235	Ga0265330_10007719	Ga0265330_100077194	241
192	3300031241	Ga0265325_10007938	Ga0265325_100079384	241
193	3300031712	Ga0265342_10011895	Ga0265342_100118953	241
194	3300005436	Ga0070713_100009523	Ga0070713_1000095233	242
195	3300006195	Ga0075366_10007060	Ga0075366_100070604	242
196	3300006914	Ga0075436_100121741	Ga0075436_1001217412	242
197	3300026067	Ga0207678_10564892	Ga0207678_105648921	242
198	3300031731	Ga0307405_10148805	Ga0307405_101488052	242
199	3300050514	nmdc:mga08x19_122523_c1	nmdc:mga08x19_122523_c1_811_1590	242
200	3300005437	Ga0070710_10311802	Ga0070710_103118021	243
201	3300028577	Ga0265318_10011238	Ga0265318_100112383	243
202	3300031235	Ga0265330_10033504	Ga0265330_100335043	243
203	3300031238	Ga0265332_10012252	Ga0265332_100122523	243
204	3300031241	Ga0265325_10046028	Ga0265325_100460282	243
205	3300031242	Ga0265329_10048960	Ga0265329_100489602	243
206	3300031247	Ga0265340_10037930	Ga0265340_100379303	243
207	3300031250	Ga0265331_10046301	Ga0265331_100463012	243
208	3300031344	Ga0265316_10029600	Ga0265316_100296003	243
209	3300031712	Ga0265342_10030931	Ga0265342_100309313	243
210	3300044693	Ga0466961_0276189	Ga0466961_0276189_12_806	243
211	3300044694	Ga0466963_0342592	Ga0466963_0342592_198_992	243
212	3300044719	Ga0466971_0076364	Ga0466971_0076364_207_1001	243
213	3300044842	Ga0466957_0010574	Ga0466957_0010574_4088_4882	243
214	3300045049	Ga0466959_0139706	Ga0466959_0139706_576_1370	243
215	3300045836	Ga0466958_0014051	Ga0466958_0014051_3078_3872	243
216	3300006844	Ga0075428_100645426	Ga0075428_1006454261	244
217	3300045976	Ga0466967_0503469	Ga0466967_0503469_145_930	244
218	3300031235	Ga0265330_10019518	Ga0265330_100195182	245
219	3300025926	Ga0207659_10191974	Ga0207659_101919742	247
220	3300049571	Ga0501034_0042997	Ga0501034_0042997_3599_4399	247
221	3300049581	Ga0501047_0024453	Ga0501047_0024453_2254_3054	247
222	3300049583	Ga0501067_0033763	Ga0501067_0033763_508_1308	247
223	3300049586	Ga0501070_0012759	Ga0501070_0012759_1419_2219	247
224	3300031595	Ga0265313_10000525	Ga0265313_1000052522	248
225	3300049571	Ga0501034_0541288	Ga0501034_0541288_131_913	248
226	3300049579	Ga0501043_0330107	Ga0501043_0330107_341_1123	248
227	3300049585	Ga0501069_0200933	Ga0501069_0200933_61_843	248
228	3300049588	Ga0501072_0081941	Ga0501072_0081941_521_1348	248
229	3300049742	Ga0501080_0155262	Ga0501080_0155262_609_1391	248
230	3300049744	Ga0501083_0040771	Ga0501083_0040771_2008_2790	248
231	3300049744	Ga0501083_0259416	Ga0501083_0259416_72_899	248
232	3300060353	Ga0501082_0237183	Ga0501082_0237183_308_1090	248
233	3300006048	Ga0075363_100001522	Ga0075363_1000015225	250
234	3300006051	Ga0075364_10007652	Ga0075364_100076529	250
235	3300006178	Ga0075367_10088393	Ga0075367_100883932	250
236	3300006195	Ga0075366_10000506	Ga0075366_1000050616	250
237	3300006353	Ga0075370_10109448	Ga0075370_101094482	250
238	3300044694	Ga0466963_0003055	Ga0466963_0003055_4951_5718	250
239	3300045976	Ga0466967_0001550	Ga0466967_0001550_10240_11007	250
240	3300050491	nmdc:mga00v17_7230_c1	nmdc:mga00v17_7230_c1_795_1598	250
241	3300050493	nmdc:mga0k408_1585_c1	nmdc:mga0k408_1585_c1_11007_11810	250
242	3300050494	nmdc:mga06z11_47475_c1	nmdc:mga06z11_47475_c1_884_1687	250
243	3300050496	nmdc:mga07m45_103876_c1	nmdc:mga07m45_103876_c1_299_1102	250
244	3300006048	Ga0075363_100298578	Ga0075363_1002985781	251
245	3300006186	Ga0075369_10196872	Ga0075369_101968722	251
246	3300020082	Ga0206353_10496150	Ga0206353_104961501	251
247	3300050490	nmdc:mga03n38_71221_c1	nmdc:mga03n38_71221_c1_749_1546	251
248	3300050491	nmdc:mga00v17_388941_c1	nmdc:mga00v17_388941_c1_78_875	251
249	3300050492	nmdc:mga0yw44_88888_c1	nmdc:mga0yw44_88888_c1_68_865	251
250	3300050493	nmdc:mga0k408_23450_c1	nmdc:mga0k408_23450_c1_498_1295	251
251	3300050494	nmdc:mga06z11_156771_c1	nmdc:mga06z11_156771_c1_416_1213	251
252	3300050496	nmdc:mga07m45_32590_c1	nmdc:mga07m45_32590_c1_2029_2826	251
253	3300050516	nmdc:mga0sz30_63508_c1	nmdc:mga0sz30_63508_c1_698_1495	251
254	iso_pu_bacteria	2643221651	2644290466	251
255	3300005366	Ga0070659_100136206	Ga0070659_1001362062	252
256	3300005563	Ga0068855_100362974	Ga0068855_1003629742	252
257	3300005577	Ga0068857_100063666	Ga0068857_1000636662	252
258	3300005614	Ga0068856_100708847	Ga0068856_1007088472	252
259	3300005616	Ga0068852_100358686	Ga0068852_1003586862	252
260	3300005983	Ga0081540_1005218	Ga0081540_10052189	252
261	3300006038	Ga0075365_10000806	Ga0075365_100008063	252
262	3300006051	Ga0075364_10001819	Ga0075364_100018192	252
263	3300006178	Ga0075367_10280624	Ga0075367_102806242	252
264	3300013307	Ga0157372_10270569	Ga0157372_102705692	252
265	3300013307	Ga0157372_10467612	Ga0157372_104676121	252
266	3300025912	Ga0207707_10544007	Ga0207707_105440071	252
267	3300025924	Ga0207694_10047880	Ga0207694_100478802	252
268	3300025929	Ga0207664_10029442	Ga0207664_100294423	252
269	3300025949	Ga0207667_10053060	Ga0207667_100530604	252
270	3300025949	Ga0207667_10221311	Ga0207667_102213112	252
271	3300026078	Ga0207702_10605833	Ga0207702_106058332	252
272	3300026116	Ga0207674_10055792	Ga0207674_100557925	252
273	3300026142	Ga0207698_10098236	Ga0207698_100982364	252
274	3300050491	nmdc:mga00v17_147213_c1	nmdc:mga00v17_147213_c1_581_1360	252
275	3300050492	nmdc:mga0yw44_633_c1	nmdc:mga0yw44_633_c1_9794_10573	252
276	3300050494	nmdc:mga06z11_5156_c1	nmdc:mga06z11_5156_c1_640_1419	252
277	3300053730	Ga0500645_016332	Ga0500645_016332_51_848	252
278	iso_pu_bacteria	2524023210	2524465285	252
279	iso_pu_bacteria	2885383462	2885390136	252
280	3300005327	Ga0070658_10184865	Ga0070658_101848652	253
281	3300005328	Ga0070676_10168897	Ga0070676_101688971	253
282	3300005336	Ga0070680_100011487	Ga0070680_1000114875	253
283	3300005339	Ga0070660_100283202	Ga0070660_1002832022	253
284	3300005458	Ga0070681_10029471	Ga0070681_100294712	253
285	3300005530	Ga0070679_100096590	Ga0070679_1000965902	253
286	3300005563	Ga0068855_100135141	Ga0068855_1001351414	253
287	3300005616	Ga0068852_100126890	Ga0068852_1001268902	253
288	3300009147	Ga0114129_10775183	Ga0114129_107751832	253
289	3300025909	Ga0207705_10115872	Ga0207705_101158722	253
290	3300025912	Ga0207707_10218387	Ga0207707_102183872	253
291	3300025917	Ga0207660_10165959	Ga0207660_101659592	253
292	3300025919	Ga0207657_10040730	Ga0207657_100407304	253
293	3300025921	Ga0207652_10088637	Ga0207652_100886372	253
294	3300025949	Ga0207667_10350584	Ga0207667_103505842	253
295	3300031595	Ga0265313_10011516	Ga0265313_100115164	253
296	3300031712	Ga0265342_10000882	Ga0265342_1000088230	253
297	3300049581	Ga0501047_0050728	Ga0501047_0050728_1238_2014	253
298	3300049823	Ga0501044_0257213	Ga0501044_0257213_257_1033	253
299	3300050490	nmdc:mga03n38_131528_c1	nmdc:mga03n38_131528_c1_233_1018	253
300	3300005327	Ga0070658_10004547	Ga0070658_100045477	254
301	3300005336	Ga0070680_100227613	Ga0070680_1002276131	254
302	3300005339	Ga0070660_100019659	Ga0070660_1000196592	254
303	3300005366	Ga0070659_100161488	Ga0070659_1001614882	254
304	3300005458	Ga0070681_10069951	Ga0070681_100699514	254
305	3300005530	Ga0070679_100101330	Ga0070679_1001013303	254
306	3300005530	Ga0070679_100106514	Ga0070679_1001065144	254
307	3300005539	Ga0068853_100094529	Ga0068853_1000945292	254
308	3300005563	Ga0068855_100010706	Ga0068855_1000107069	254
309	3300005563	Ga0068855_100272344	Ga0068855_1002723442	254
310	3300005578	Ga0068854_100285596	Ga0068854_1002855962	254
311	3300006871	Ga0075434_100228531	Ga0075434_1002285311	254
312	3300009093	Ga0105240_10042112	Ga0105240_100421125	254
313	3300009551	Ga0105238_10453697	Ga0105238_104536972	254
314	3300013100	Ga0157373_10025581	Ga0157373_100255817	254
315	3300013102	Ga0157371_10048722	Ga0157371_100487224	254
316	3300013104	Ga0157370_10014911	Ga0157370_100149115	254
317	3300013104	Ga0157370_10434241	Ga0157370_104342411	254
318	3300013105	Ga0157369_10072582	Ga0157369_100725822	254
319	3300020081	Ga0206354_10071518	Ga0206354_100715182	254
320	3300025909	Ga0207705_10280147	Ga0207705_102801471	254
321	3300025912	Ga0207707_10048321	Ga0207707_100483212	254
322	3300025913	Ga0207695_10028693	Ga0207695_100286935	254
323	3300025917	Ga0207660_10250221	Ga0207660_102502212	254
324	3300025919	Ga0207657_10002624	Ga0207657_1000262423	254
325	3300025919	Ga0207657_10050898	Ga0207657_100508982	254
326	3300025921	Ga0207652_10010745	Ga0207652_100107452	254
327	3300025949	Ga0207667_10091817	Ga0207667_100918173	254
328	3300025981	Ga0207640_10209093	Ga0207640_102090932	254
329	3300026041	Ga0207639_10231283	Ga0207639_102312832	254
330	3300037466	Ga0395898_0289218	Ga0395898_0289218_587_1390	254
331	3300037853	Ga0436364_1379942	Ga0436364_1379942_103_903	254
332	3300044719	Ga0466971_0064621	Ga0466971_0064621_200_976	254
333	3300045976	Ga0466967_0355552	Ga0466967_0355552_299_1081	254
334	3300049573	Ga0501037_0044444	Ga0501037_0044444_2005_2793	254
335	3300049575	Ga0501039_0044970	Ga0501039_0044970_1922_2710	254
336	3300049580	Ga0501046_0020915	Ga0501046_0020915_4213_5001	254
337	3300049581	Ga0501047_0450871	Ga0501047_0450871_76_852	254
338	3300049583	Ga0501067_0104976	Ga0501067_0104976_163_951	254
339	3300049584	Ga0501068_0138455	Ga0501068_0138455_531_1319	254
340	3300049585	Ga0501069_0019185	Ga0501069_0019185_2741_3529	254
341	3300049590	Ga0501074_0093031	Ga0501074_0093031_616_1404	254
342	3300049744	Ga0501083_0255843	Ga0501083_0255843_297_1085	254
343	3300049822	Ga0501035_0458675	Ga0501035_0458675_161_949	254
344	3300006042	Ga0075368_10021869	Ga0075368_100218692	255
345	3300006048	Ga0075363_100096822	Ga0075363_1000968222	255
346	3300006173	Ga0070716_100305302	Ga0070716_1003053022	255
347	3300006178	Ga0075367_10009807	Ga0075367_100098075	255
348	3300009147	Ga0114129_10814696	Ga0114129_108146962	255
349	3300025915	Ga0207693_10221995	Ga0207693_102219952	255
350	3300031711	Ga0265314_10007404	Ga0265314_100074047	255
351	3300048907	Ga0496104_0327630	Ga0496104_0327630_66_878	255
352	3300049571	Ga0501034_0148973	Ga0501034_0148973_585_1370	255
353	3300050490	nmdc:mga03n38_62208_c1	nmdc:mga03n38_62208_c1_422_1213	255
354	3300050494	nmdc:mga06z11_12271_c1	nmdc:mga06z11_12271_c1_1411_2202	255
355	3300050507	nmdc:mga05p37_507020_c1	nmdc:mga05p37_507020_c1_13_807	255
356	3300053096	Ga0500641_0001637	Ga0500641_0001637_5002_5784	255
357	3300053139	Ga0500568_0061605	Ga0500568_0061605_262_1056	255
358	3300006353	Ga0075370_10060670	Ga0075370_100606703	256
359	3300009545	Ga0105237_10070183	Ga0105237_100701833	256
360	3300014497	Ga0182008_10113803	Ga0182008_101138032	256
361	3300025253	Ga0209677_100388	Ga0209677_10038816	256
362	3300025915	Ga0207693_10152914	Ga0207693_101529143	256
363	3300026078	Ga0207702_10000063	Ga0207702_1000006372	256
364	3300031242	Ga0265329_10018102	Ga0265329_100181022	256
365	3300031344	Ga0265316_10158177	Ga0265316_101581772	256
366	3300031711	Ga0265314_10003505	Ga0265314_100035054	256
367	3300035172	Ga0373955_0061181	Ga0373955_0061181_1184_1972	256
368	3300039437	Ga0436365_1813374	Ga0436365_1813374_1722_2525	256
369	3300039450	Ga0436363_0348507	Ga0436363_0348507_316_1101	256
370	3300048903	Ga0496100_0169441	Ga0496100_0169441_241_1062	256
371	3300048912	Ga0496109_0324657	Ga0496109_0324657_557_1351	256
372	3300048915	Ga0496112_0028323	Ga0496112_0028323_3037_3831	256
373	3300048921	Ga0496118_0003033	Ga0496118_0003033_18593_19414	256
374	3300048924	Ga0496121_0027791	Ga0496121_0027791_75_896	256
375	3300048928	Ga0496125_0138236	Ga0496125_0138236_202_1023	256
376	3300049568	Ga0501031_0098829	Ga0501031_0098829_720_1511	256
377	3300049578	Ga0501042_0235404	Ga0501042_0235404_334_1125	256
378	3300049581	Ga0501047_0220785	Ga0501047_0220785_550_1341	256
379	3300049582	Ga0501048_0069756	Ga0501048_0069756_1228_2019	256
380	3300049583	Ga0501067_0049530	Ga0501067_0049530_781_1572	256
381	3300049588	Ga0501072_0224051	Ga0501072_0224051_306_1097	256
382	3300049589	Ga0501073_0265037	Ga0501073_0265037_128_919	256
383	3300049590	Ga0501074_0256124	Ga0501074_0256124_284_1075	256
384	3300049741	Ga0501079_0065854	Ga0501079_0065854_1354_2145	256
385	3300049743	Ga0501081_0088042	Ga0501081_0088042_317_1108	256
386	3300049744	Ga0501083_0015275	Ga0501083_0015275_453_1244	256
387	3300049824	Ga0501045_0035779	Ga0501045_0035779_1787_2578	256
388	3300050496	nmdc:mga07m45_103498_c1	nmdc:mga07m45_103498_c1_427_1209	256
389	3300054114	Ga0501084_0043717	Ga0501084_0043717_487_1278	256
390	3300060353	Ga0501082_0237436	Ga0501082_0237436_246_1037	256
391	3300005331	Ga0070670_100370769	Ga0070670_1003707692	257
392	3300005367	Ga0070667_100015594	Ga0070667_1000155946	257
393	3300006852	Ga0075433_10518874	Ga0075433_105188741	257
394	3300006914	Ga0075436_100033551	Ga0075436_1000335514	257
395	3300007788	Ga0099795_10026962	Ga0099795_100269621	257
396	3300010159	Ga0099796_10013528	Ga0099796_100135282	257
397	3300014968	Ga0157379_10156736	Ga0157379_101567363	257
398	3300025986	Ga0207658_10024740	Ga0207658_100247402	257
399	3300035118	Ga0373954_0028775	Ga0373954_0028775_1625_2422	257
400	3300035120	Ga0373957_0021293	Ga0373957_0021293_977_1774	257
401	3300035172	Ga0373955_0013574	Ga0373955_0013574_480_1277	257
402	3300035724	Ga0373933_0010197	Ga0373933_0010197_51_848	257
403	3300036401	Ga0373937_0078018	Ga0373937_0078018_1596_2393	257
404	3300039437	Ga0436365_1003223	Ga0436365_1003223_119_913	257
405	3300046462	Ga0495651_0146209	Ga0495651_0146209_853_1650	257
406	3300046529	Ga0495652_0139723	Ga0495652_0139723_755_1552	257
407	3300046536	Ga0495587_0033812	Ga0495587_0033812_510_1307	257
408	3300047444	Ga0495675_0057135	Ga0495675_0057135_1550_2422	257
409	3300049568	Ga0501031_0229428	Ga0501031_0229428_139_936	257
410	3300049571	Ga0501034_0022707	Ga0501034_0022707_5070_5867	257
411	3300049574	Ga0501038_0106367	Ga0501038_0106367_1237_2070	257
412	3300049574	Ga0501038_0126383	Ga0501038_0126383_167_964	257
413	3300049580	Ga0501046_0070864	Ga0501046_0070864_190_984	257
414	3300049580	Ga0501046_0182011	Ga0501046_0182011_423_1220	257
415	3300049581	Ga0501047_0011180	Ga0501047_0011180_4524_5357	257
416	3300049581	Ga0501047_0087365	Ga0501047_0087365_2033_2830	257
417	3300049581	Ga0501047_0477811	Ga0501047_0477811_173_1006	257
418	3300049586	Ga0501070_0492621	Ga0501070_0492621_19_852	257
419	3300049589	Ga0501073_0030355	Ga0501073_0030355_2460_3257	257
420	3300049590	Ga0501074_0472186	Ga0501074_0472186_64_861	257
421	3300049742	Ga0501080_0264661	Ga0501080_0264661_41_874	257
422	3300049744	Ga0501083_0003568	Ga0501083_0003568_4083_4880	257
423	3300049823	Ga0501044_0057312	Ga0501044_0057312_1093_1890	257
424	3300049823	Ga0501044_0294670	Ga0501044_0294670_542_1375	257
425	3300053085	Ga0495619_0138197	Ga0495619_0138197_571_1443	257
426	3300053153	Ga0500616_0000038	Ga0500616_0000038_335442_336245	257
427	3300013102	Ga0157371_10487564	Ga0157371_104875641	258
428	3300025917	Ga0207660_10145069	Ga0207660_101450692	258
429	3300031344	Ga0265316_10141291	Ga0265316_101412912	258
430	3300037312	Ga0395899_0012074	Ga0395899_0012074_4694_5485	258
431	3300037418	Ga0395900_0001475	Ga0395900_0001475_7956_8747	258
432	3300037418	Ga0395900_0481813	Ga0395900_0481813_40_831	258
433	3300037466	Ga0395898_0022707	Ga0395898_0022707_1593_2384	258
434	3300038443	Ga0395901_0011499	Ga0395901_0011499_8134_8925	258
435	3300038443	Ga0395901_0037746	Ga0395901_0037746_2796_3587	258
436	3300045049	Ga0466959_0225570	Ga0466959_0225570_449_1240	258
437	3300049571	Ga0501034_0000734	Ga0501034_0000734_25290_26087	258
438	3300049586	Ga0501070_0206382	Ga0501070_0206382_521_1321	258
439	3300049588	Ga0501072_0274212	Ga0501072_0274212_265_1065	258
440	3300049742	Ga0501080_0138607	Ga0501080_0138607_967_1767	258
441	3300054114	Ga0501084_0592228	Ga0501084_0592228_24_821	258
442	3300009147	Ga0114129_10947626	Ga0114129_109476262	259
443	3300035115	Ga0373941_0000525	Ga0373941_0000525_5651_6451	259
444	3300049568	Ga0501031_0072799	Ga0501031_0072799_1265_2065	259
445	3300049569	Ga0501032_0056252	Ga0501032_0056252_1063_1863	259
446	3300049570	Ga0501033_0011750	Ga0501033_0011750_972_1772	259
447	3300049572	Ga0501036_0119318	Ga0501036_0119318_964_1764	259
448	3300049573	Ga0501037_0010168	Ga0501037_0010168_3886_4686	259
449	3300049574	Ga0501038_0066265	Ga0501038_0066265_817_1617	259
450	3300049575	Ga0501039_0015274	Ga0501039_0015274_4337_5137	259
451	3300049578	Ga0501042_0194527	Ga0501042_0194527_127_927	259
452	3300049579	Ga0501043_0011800	Ga0501043_0011800_5568_6368	259
453	3300049579	Ga0501043_0031876	Ga0501043_0031876_2575_3375	259
454	3300049581	Ga0501047_0038179	Ga0501047_0038179_1143_1943	259
455	3300049582	Ga0501048_0093316	Ga0501048_0093316_955_1755	259
456	3300049584	Ga0501068_0072334	Ga0501068_0072334_621_1421	259
457	3300049585	Ga0501069_0064922	Ga0501069_0064922_743_1543	259
458	3300049586	Ga0501070_0170535	Ga0501070_0170535_961_1761	259
459	3300049587	Ga0501071_0141085	Ga0501071_0141085_192_992	259
460	3300049590	Ga0501074_0005366	Ga0501074_0005366_4548_5348	259
461	3300049741	Ga0501079_0123756	Ga0501079_0123756_249_1049	259
462	3300049744	Ga0501083_0129306	Ga0501083_0129306_196_996	259
463	3300049822	Ga0501035_0038703	Ga0501035_0038703_1300_2100	259
464	3300049823	Ga0501044_0144918	Ga0501044_0144918_592_1392	259
465	3300006177	Ga0075362_10091774	Ga0075362_100917742	261
466	3300050494	nmdc:mga06z11_171043_c1	nmdc:mga06z11_171043_c1_365_1162	261
467	3300053096	Ga0500641_0148999	Ga0500641_0148999_53_850	261
468	3300049571	Ga0501034_0568291	Ga0501034_0568291_138_926	262
469	3300003215	JGI25153J46596_10011224	JGI25153J46596_100112242	263
470	3300025297	Ga0209758_1006431	Ga0209758_10064317	263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16976

RcpC

Flp pilus assembly protein RcpC/CpaB

142

253

0.98 PF08666

SAF

SAF domain

68

136

0.96 Feature Viewer

pLDDT	pTM	Quality
71.65	0.47	Low

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F450484

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF16976

RcpC

Flp pilus assembly protein RcpC/CpaB

142

253

0.98

PF08666

SAF

SAF domain

68

136

0.96

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map