F450477

General Info

Members Datasets Scaffolds Average Seq Length
470 179 470 180

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0054289|Ga0495650_0054289_27_626
Length 199
Sequence LALFFAVPACRSGLKPGNSMKKILTTFIFSSLTVLVFAQTLKPVDEGSKVKFVIKNFGINTGGTFTGLDGTINFDPSNPTTASFDINVDAKTIDTDVESRDNHLRKAEYFNVEKFPALNFKSSKITKTNSSDFLYMFGNITIKGVTKEIKFPFKATQKDDGYLFEGNFKLNRRDFGVGGNSLSLSDELTVNLSVFAKKS

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
158 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.36
Stem 0
Stem Tuber 0
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10106646 3300002067 Bacteria 805
2 JGI24751J29686_10001484 3300002459 Bacteria 4887
3 Ga0065712_10006174 3300005290 Bacteria 3145
4 Ga0065715_10468074 3300005293 Bacteria 788
5 Ga0070658_10014938 3300005327 Bacteria 6218
6 Ga0070658_10035406 3300005327 Bacteria 4021
7 Ga0070658_10242927 3300005327 Bacteria 1526
8 Ga0070658_10263734 3300005327 Bacteria 1463
9 Ga0070658_10666836 3300005327 Bacteria 902
10 Ga0070676_10089757 3300005328 Bacteria 1880
11 Ga0070676_10091763 3300005328 Bacteria 1862
12 Ga0070683_100175638 3300005329 Bacteria 2033
13 Ga0070683_101113958 3300005329 Bacteria 758
14 Ga0070670_100054955 3300005331 Bacteria 3418
15 Ga0070670_100266575 3300005331 Bacteria 1494
16 Ga0070677_10029448 3300005333 Bacteria 2082
17 Ga0070677_10223167 3300005333 Bacteria 922
18 Ga0068869_100003189 3300005334 Bacteria 10019
19 Ga0068869_100028632 3300005334 Bacteria 3896
20 Ga0068869_100106746 3300005334 Bacteria 2125
21 Ga0068869_100148933 3300005334 Bacteria 1813
22 Ga0068869_100207353 3300005334 Unclassified 1548
23 Ga0068869_100292147 3300005334 Bacteria 1313
24 Ga0070666_10000494 3300005335 Bacteria 23741
25 Ga0070666_10018002 3300005335 Bacteria 4534
26 Ga0070680_100029490 3300005336 Bacteria 4407
27 Ga0070680_100107735 3300005336 Bacteria 2318
28 Ga0070682_100010328 3300005337 Bacteria 5298
29 Ga0070682_100023486 3300005337 Bacteria 3660
30 Ga0068868_100053243 3300005338 Bacteria 3188
31 Ga0070660_100036738 3300005339 Bacteria 3712
32 Ga0070660_100046199 3300005339 Bacteria 3337
33 Ga0070660_100046555 3300005339 Bacteria 3325
34 Ga0070660_100084642 3300005339 Bacteria 2493
35 Ga0070660_100241032 3300005339 Bacteria 1473
36 Ga0070689_100013502 3300005340 Bacteria 5913
37 Ga0070689_100060607 3300005340 Bacteria 2943
38 Ga0070689_100363490 3300005340 Bacteria 1216
39 Ga0070689_100455620 3300005340 Bacteria 1089
40 Ga0070687_100608901 3300005343 Bacteria 751
41 Ga0070661_100217290 3300005344 Bacteria 1465
42 Ga0070692_10199412 3300005345 Bacteria 1171
43 Ga0070668_100013664 3300005347 Bacteria 6062
44 Ga0070668_100043208 3300005347 Bacteria 3456
45 Ga0070668_100052593 3300005347 Bacteria 3139
46 Ga0070668_100182891 3300005347 Bacteria 1713
47 Ga0070669_100949848 3300005353 Bacteria 736
48 Ga0070671_100097112 3300005355 Bacteria 2471
49 Ga0070671_100340158 3300005355 Bacteria 1280
50 Ga0070671_101512910 3300005355 Bacteria 594
51 Ga0070674_100008256 3300005356 Bacteria 6189
52 Ga0070674_100203916 3300005356 Bacteria 1529
53 Ga0070673_100014508 3300005364 Bacteria 5492
54 Ga0070673_100064919 3300005364 Unclassified 2910
55 Ga0070673_100124476 3300005364 Bacteria 2155
56 Ga0070673_100459137 3300005364 Bacteria 1147
57 Ga0070688_100047324 3300005365 Bacteria 2667
58 Ga0070688_100106085 3300005365 Bacteria 1861
59 Ga0070688_100753141 3300005365 Bacteria 758
60 Ga0070659_100071881 3300005366 Bacteria 2752
61 Ga0070659_100204944 3300005366 Bacteria 1624
62 Ga0070667_100012244 3300005367 Bacteria 7096
63 Ga0070667_100022473 3300005367 Bacteria 5231
64 Ga0070667_100525096 3300005367 Bacteria 1087
65 Ga0070667_101382556 3300005367 Unclassified 660
66 Ga0070667_101480782 3300005367 Bacteria 637
67 Ga0070701_10253558 3300005438 Bacteria 1063
68 Ga0070700_100452919 3300005441 Bacteria 977
69 Ga0070678_100056344 3300005456 Unclassified 2874
70 Ga0070678_100087050 3300005456 Bacteria 2385
71 Ga0070678_101005328 3300005456 Bacteria 767
72 Ga0070681_10078835 3300005458 Bacteria 3251
73 Ga0070681_10090375 3300005458 Bacteria 3013
74 Ga0070681_10351971 3300005458 Bacteria 1383
75 Ga0070681_10759712 3300005458 Bacteria 886
76 Ga0068867_100036699 3300005459 Bacteria 3560
77 Ga0068867_100063280 3300005459 Bacteria 2749
78 Ga0068867_100406701 3300005459 Bacteria 1149
79 Ga0068867_100421347 3300005459 Bacteria 1131
80 Ga0068867_100961263 3300005459 Bacteria 772
81 Ga0070685_10042825 3300005466 Bacteria 2585
82 Ga0070685_10063042 3300005466 Bacteria 2175
83 Ga0070706_100611810 3300005467 Bacteria 1012
84 Ga0070707_100365201 3300005468 Bacteria 1402
85 Ga0070698_100002098 3300005471 Bacteria 22130
86 Ga0070698_100013615 3300005471 Bacteria 8611
87 Ga0070698_100025763 3300005471 Bacteria 6127
88 Ga0070698_100221774 3300005471 Bacteria 1824
89 Ga0070679_100000723 3300005530 Bacteria 28502
90 Ga0070679_100001843 3300005530 Bacteria 19045
91 Ga0070679_100011352 3300005530 Bacteria 8489
92 Ga0070679_100112459 3300005530 Bacteria 2709
93 Ga0070679_100192850 3300005530 Bacteria 2006
94 Ga0070684_100181359 3300005535 Bacteria 1915
95 Ga0070684_100540113 3300005535 Bacteria 1081
96 Ga0068853_100032600 3300005539 Bacteria 4414
97 Ga0068853_100040732 3300005539 Bacteria 3965
98 Ga0068853_100133538 3300005539 Bacteria 2223
99 Ga0068853_100604079 3300005539 Bacteria 1042
100 Ga0070672_100032139 3300005543 Bacteria 3958
101 Ga0070672_100085790 3300005543 Bacteria 2531
102 Ga0070672_100089633 3300005543 Bacteria 2478
103 Ga0068855_100004190 3300005563 Bacteria 17595
104 Ga0068855_100053098 3300005563 Bacteria 4769
105 Ga0068855_100165088 3300005563 Bacteria 2511
106 Ga0068855_100252555 3300005563 Bacteria 1966
107 Ga0068855_100431322 3300005563 Bacteria 1441
108 Ga0068857_100028509 3300005577 Bacteria 4927
109 Ga0068857_100269077 3300005577 Bacteria 1566
110 Ga0068857_101750985 3300005577 Bacteria 608
111 Ga0068854_100102963 3300005578 Bacteria 2143
112 Ga0068854_100284622 3300005578 Bacteria 1332
113 Ga0068856_100021551 3300005614 Bacteria 6263
114 Ga0068856_100832015 3300005614 Bacteria 942
115 Ga0068856_101105941 3300005614 Bacteria 810
116 Ga0068852_100000563 3300005616 Bacteria 24454
117 Ga0068852_100014576 3300005616 Bacteria 6058
118 Ga0068852_100055690 3300005616 Bacteria 3414
119 Ga0068852_100096610 3300005616 Unclassified 2656
120 Ga0068852_100363557 3300005616 Bacteria 1416
121 Ga0068859_100000186 3300005617 Bacteria 60206
122 Ga0068859_100085891 3300005617 Bacteria 3192
123 Ga0068859_100121989 3300005617 Bacteria 2673
124 Ga0068859_100457657 3300005617 Bacteria 1372
125 Ga0068859_100921887 3300005617 Bacteria 958
126 Ga0068864_100016143 3300005618 Bacteria 6214
127 Ga0068864_100459123 3300005618 Bacteria 1219
128 Ga0068864_100585508 3300005618 Bacteria 1081
129 Ga0068864_100917030 3300005618 Bacteria 866
130 Ga0068866_10090070 3300005718 Bacteria 1668
131 Ga0068866_10308197 3300005718 Bacteria 991
132 Ga0068866_10738786 3300005718 Bacteria 679
133 Ga0068861_100015284 3300005719 Bacteria 5406
134 Ga0068861_100027622 3300005719 Bacteria 4136
135 Ga0068861_100028073 3300005719 Bacteria 4105
136 Ga0068861_100039890 3300005719 Bacteria 3508
137 Ga0068861_100130243 3300005719 Bacteria 2041
138 Ga0068861_101222344 3300005719 Bacteria 727
139 Ga0068851_10499191 3300005834 Bacteria 729
140 Ga0068870_10010630 3300005840 Bacteria 4236
141 Ga0068870_10067538 3300005840 Bacteria 1940
142 Ga0068863_100005438 3300005841 Bacteria 12547
143 Ga0068863_100054149 3300005841 Bacteria 3802
144 Ga0068863_100377328 3300005841 Bacteria 1384
145 Ga0068863_101595763 3300005841 Bacteria 662
146 Ga0068858_100034101 3300005842 Bacteria 4721
147 Ga0068858_100302223 3300005842 Bacteria 1527
148 Ga0068860_100008158 3300005843 Bacteria 10426
149 Ga0068860_100061503 3300005843 Bacteria 3568
150 Ga0068860_100165180 3300005843 Bacteria 2137
151 Ga0068860_100257136 3300005843 Bacteria 1702
152 Ga0068862_100072373 3300005844 Bacteria 2977
153 Ga0068862_100694136 3300005844 Bacteria 985
154 Ga0070715_10097347 3300006163 Bacteria 1366
155 Ga0097621_100016613 3300006237 Bacteria 5568
156 Ga0097621_100055364 3300006237 Bacteria 3239
157 Ga0097621_100459101 3300006237 Bacteria 1148
158 Ga0068871_100026639 3300006358 Bacteria 4513
159 Ga0068871_100033135 3300006358 Bacteria 4088
160 Ga0068871_100045545 3300006358 Bacteria 3531
161 Ga0068871_100295487 3300006358 Bacteria 1420
162 Ga0075428_100002349 3300006844 Bacteria 20539
163 Ga0075428_100059525 3300006844 Bacteria 4183
164 Ga0075428_100204297 3300006844 Bacteria 2135
165 Ga0075430_100013143 3300006846 Bacteria 7053
166 Ga0075430_100587083 3300006846 Bacteria 919
167 Ga0075431_100035126 3300006847 Bacteria 5162
168 Ga0075429_100004013 3300006880 Bacteria 12599
169 Ga0075429_100180427 3300006880 Bacteria 1850
170 Ga0068865_100021051 3300006881 Bacteria 4238
171 Ga0097620_100000186 3300006931 Bacteria 60206
172 Ga0097620_100085883 3300006931 Bacteria 3192
173 Ga0097620_100121995 3300006931 Bacteria 2673
174 Ga0097620_100457702 3300006931 Bacteria 1372
175 Ga0097620_100921998 3300006931 Bacteria 958
176 Ga0111539_10065795 3300009094 Bacteria 4282
177 Ga0111539_10110494 3300009094 Bacteria 3226
178 Ga0105245_10170786 3300009098 Bacteria 2071
179 Ga0105247_10006330 3300009101 Bacteria 7333
180 Ga0105247_10949954 3300009101 Bacteria 668
181 Ga0114129_10776668 3300009147 Bacteria 1224
182 Ga0114129_10969534 3300009147 Bacteria 1073
183 Ga0105243_10035125 3300009148 Unclassified 3885
184 Ga0105243_10225738 3300009148 Bacteria 1658
185 Ga0105241_10007177 3300009174 Bacteria 8201
186 Ga0105241_10012438 3300009174 Bacteria 6238
187 Ga0105241_10097198 3300009174 Bacteria 2334
188 Ga0105241_10740754 3300009174 Bacteria 900
189 Ga0105242_10019145 3300009176 Bacteria 5363
190 Ga0105242_10028031 3300009176 Bacteria 4480
191 Ga0105242_10028919 3300009176 Bacteria 4416
192 Ga0105242_10037252 3300009176 Bacteria 3906
193 Ga0105242_10117490 3300009176 Bacteria 2277
194 Ga0105242_10232299 3300009176 Bacteria 1653
195 Ga0105242_11575066 3300009176 Bacteria 690
196 Ga0105248_10373833 3300009177 Bacteria 1605
197 Ga0105237_10014667 3300009545 Bacteria 8185
198 Ga0105237_10066269 3300009545 Bacteria 3606
199 Ga0105249_10001561 3300009553 Bacteria 20115
200 Ga0105249_10004353 3300009553 Bacteria 12247
201 Ga0105249_10004716 3300009553 Bacteria 11769
202 Ga0105249_10010856 3300009553 Bacteria 8004
203 Ga0105249_10130646 3300009553 Bacteria 2397
204 Ga0105249_10239125 3300009553 Bacteria 1794
205 Ga0105249_10798537 3300009553 Bacteria 1008
206 Ga0105239_10064401 3300010375 Bacteria 4024
207 Ga0105239_10159966 3300010375 Bacteria 2515
208 Ga0105239_10757435 3300010375 Bacteria 1111
209 Ga0105246_10008960 3300011119 Bacteria 6160
210 Ga0105246_10150182 3300011119 Bacteria 1763
211 Ga0105246_10232602 3300011119 Bacteria 1452
212 Ga0157373_10005431 3300013100 Bacteria 9573
213 Ga0157373_10019799 3300013100 Bacteria 4895
214 Ga0157373_10021980 3300013100 Bacteria 4629
215 Ga0157373_10121183 3300013100 Bacteria 1838
216 Ga0157373_10160310 3300013100 Bacteria 1583
217 Ga0157371_10000932 3300013102 Bacteria 32766
218 Ga0157371_10003608 3300013102 Bacteria 13948
219 Ga0157371_10003924 3300013102 Bacteria 13232
220 Ga0157371_10022360 3300013102 Bacteria 4635
221 Ga0157371_10031297 3300013102 Bacteria 3832
222 Ga0157371_10098152 3300013102 Bacteria 2077
223 Ga0157371_10264417 3300013102 Bacteria 1241
224 Ga0157371_10266512 3300013102 Bacteria 1236
225 Ga0157371_10366576 3300013102 Bacteria 1050
226 Ga0157371_10456722 3300013102 Bacteria 940
227 Ga0157370_10003393 3300013104 Bacteria 18718
228 Ga0157370_10095369 3300013104 Bacteria 2791
229 Ga0157370_10151079 3300013104 Bacteria 2161
230 Ga0157370_10226329 3300013104 Bacteria 1731
231 Ga0157369_10084258 3300013105 Bacteria 3398
232 Ga0157369_10159172 3300013105 Bacteria 2384
233 Ga0157369_10201026 3300013105 Bacteria 2092
234 Ga0157369_10963234 3300013105 Bacteria 874
235 Ga0157374_10147256 3300013296 Bacteria 2288
236 Ga0157374_10173000 3300013296 Bacteria 2107
237 Ga0157374_10318678 3300013296 Bacteria 1540
238 Ga0157374_10582744 3300013296 Bacteria 1128
239 Ga0157378_10097306 3300013297 Bacteria 2682
240 Ga0157378_10526616 3300013297 Bacteria 1184
241 Ga0163162_10000503 3300013306 Bacteria 36430
242 Ga0163162_10568149 3300013306 Bacteria 1261
243 Ga0163162_10868458 3300013306 Bacteria 1017
244 Ga0163162_11654577 3300013306 Bacteria 731
245 Ga0157372_10101571 3300013307 Bacteria 3283
246 Ga0157372_10111875 3300013307 Unclassified 3128
247 Ga0157372_10311885 3300013307 Bacteria 1831
248 Ga0157372_10387796 3300013307 Bacteria 1628
249 Ga0157372_10413568 3300013307 Bacteria 1572
250 Ga0157372_10529288 3300013307 Bacteria 1374
251 Ga0157372_10743068 3300013307 Bacteria 1141
252 Ga0157372_11552885 3300013307 Bacteria 762
253 Ga0157372_11623859 3300013307 Bacteria 744
254 Ga0157372_11653009 3300013307 Bacteria 737
255 Ga0157375_10011842 3300013308 Bacteria 7714
256 Ga0157375_10052671 3300013308 Bacteria 4002
257 Ga0157375_10083868 3300013308 Bacteria 3233
258 Ga0157375_10105077 3300013308 Bacteria 2913
259 Ga0157375_10452767 3300013308 Bacteria 1449
260 Ga0157375_10772426 3300013308 Bacteria 1111
261 Ga0157375_12917358 3300013308 Bacteria 571
262 Ga0163163_10111904 3300014325 Unclassified 2759
263 Ga0163163_10190080 3300014325 Bacteria 2102
264 Ga0163163_10885245 3300014325 Bacteria 956
265 Ga0157380_10039474 3300014326 Bacteria 3672
266 Ga0157380_10209766 3300014326 Unclassified 1735
267 Ga0157380_10220838 3300014326 Bacteria 1695
268 Ga0157380_10465703 3300014326 Bacteria 1218
269 Ga0157380_10779692 3300014326 Unclassified 971
270 Ga0157380_11917133 3300014326 Unclassified 653
271 Ga0157377_10039057 3300014745 Bacteria 2624
272 Ga0157379_10173513 3300014968 Bacteria 1946
273 Ga0157376_10005260 3300014969 Bacteria 9038
274 Ga0157376_10432770 3300014969 Bacteria 1279
275 Ga0157376_10880537 3300014969 Bacteria 912
276 Ga0163161_10010065 3300017792 Bacteria 6545
277 Ga0163161_10293300 3300017792 Bacteria 1279
278 Ga0163161_10695627 3300017792 Bacteria 846
279 Ga0207666_1008425 3300025271 Bacteria 1377
280 Ga0207656_10304111 3300025321 Bacteria 790
281 Ga0207682_10119705 3300025893 Bacteria 1167
282 Ga0207642_10010665 3300025899 Bacteria 3250
283 Ga0207688_10191660 3300025901 Bacteria 1223
284 Ga0207680_10000236 3300025903 Bacteria 26619
285 Ga0207680_10725787 3300025903 Bacteria 712
286 Ga0207647_10515727 3300025904 Bacteria 665
287 Ga0207685_10085154 3300025905 Bacteria 1318
288 Ga0207645_10008320 3300025907 Bacteria 7246
289 Ga0207645_10364922 3300025907 Bacteria 968
290 Ga0207643_10004789 3300025908 Bacteria 7250
291 Ga0207643_10023686 3300025908 Bacteria 3387
292 Ga0207705_10003539 3300025909 Bacteria 11893
293 Ga0207705_10046351 3300025909 Unclassified 3124
294 Ga0207705_10068973 3300025909 Bacteria 2560
295 Ga0207705_10078713 3300025909 Bacteria 2400
296 Ga0207705_10666286 3300025909 Bacteria 809
297 Ga0207654_10024318 3300025911 Bacteria 3255
298 Ga0207654_10035846 3300025911 Bacteria 2767
299 Ga0207707_10176178 3300025912 Bacteria 1868
300 Ga0207707_10180504 3300025912 Bacteria 1843
301 Ga0207707_10234179 3300025912 Bacteria 1598
302 Ga0207707_10281061 3300025912 Bacteria 1442
303 Ga0207707_10554714 3300025912 Bacteria 976
304 Ga0207695_10042677 3300025913 Bacteria 4840
305 Ga0207671_10006106 3300025914 Bacteria 10843
306 Ga0207663_10451170 3300025916 Bacteria 992
307 Ga0207660_10084884 3300025917 Bacteria 2334
308 Ga0207660_10252788 3300025917 Bacteria 1391
309 Ga0207660_10273574 3300025917 Bacteria 1338
310 Ga0207657_10061191 3300025919 Bacteria 3229
311 Ga0207657_10065191 3300025919 Bacteria 3106
312 Ga0207657_10078741 3300025919 Bacteria 2774
313 Ga0207657_10087157 3300025919 Bacteria 2612
314 Ga0207657_10169888 3300025919 Bacteria 1767
315 Ga0207649_10138311 3300025920 Bacteria 1663
316 Ga0207652_10000546 3300025921 Bacteria 38083
317 Ga0207652_10001189 3300025921 Bacteria 23425
318 Ga0207652_10017232 3300025921 Bacteria 5910
319 Ga0207652_11302505 3300025921 Bacteria 629
320 Ga0207646_10970328 3300025922 Bacteria 752
321 Ga0207681_10028136 3300025923 Bacteria 3640
322 Ga0207681_10609524 3300025923 Bacteria 903
323 Ga0207650_10052379 3300025925 Bacteria 3023
324 Ga0207650_10513051 3300025925 Bacteria 1003
325 Ga0207659_10230097 3300025926 Bacteria 1495
326 Ga0207687_10422193 3300025927 Bacteria 1101
327 Ga0207644_10014788 3300025931 Bacteria 5230
328 Ga0207644_11319514 3300025931 Bacteria 606
329 Ga0207690_10005226 3300025932 Bacteria 7657
330 Ga0207706_10178721 3300025933 Bacteria 1864
331 Ga0207686_10001727 3300025934 Bacteria 12163
332 Ga0207686_10103959 3300025934 Unclassified 1901
333 Ga0207686_10314854 3300025934 Bacteria 1167
334 Ga0207670_10038548 3300025936 Bacteria 3122
335 Ga0207670_10045588 3300025936 Bacteria 2907
336 Ga0207670_10714098 3300025936 Bacteria 831
337 Ga0207669_10273030 3300025937 Bacteria 1271
338 Ga0207669_10857368 3300025937 Bacteria 756
339 Ga0207704_10067150 3300025938 Bacteria 2255
340 Ga0207704_10077226 3300025938 Bacteria 2137
341 Ga0207704_10362674 3300025938 Bacteria 1132
342 Ga0207691_10007169 3300025940 Bacteria 10754
343 Ga0207691_10125897 3300025940 Bacteria 2267
344 Ga0207689_10000687 3300025942 Bacteria 32323
345 Ga0207689_10010494 3300025942 Bacteria 7978
346 Ga0207689_10022434 3300025942 Bacteria 5309
347 Ga0207689_10064671 3300025942 Bacteria 3009
348 Ga0207689_10075453 3300025942 Bacteria 2771
349 Ga0207689_10078905 3300025942 Bacteria 2706
350 Ga0207661_11009531 3300025944 Bacteria 766
351 Ga0207679_10931375 3300025945 Bacteria 795
352 Ga0207667_10058892 3300025949 Bacteria 4026
353 Ga0207667_10075413 3300025949 Bacteria 3502
354 Ga0207667_10330965 3300025949 Bacteria 1555
355 Ga0207651_10075508 3300025960 Bacteria 2405
356 Ga0207651_10459038 3300025960 Unclassified 1094
357 Ga0207651_11155913 3300025960 Bacteria 694
358 Ga0207712_10001621 3300025961 Bacteria 15164
359 Ga0207712_10005567 3300025961 Bacteria 7949
360 Ga0207712_10009906 3300025961 Bacteria 6040
361 Ga0207712_10068905 3300025961 Bacteria 2537
362 Ga0207712_10505723 3300025961 Bacteria 1033
363 Ga0207668_10022072 3300025972 Bacteria 4069
364 Ga0207668_10205143 3300025972 Bacteria 1572
365 Ga0207640_10141488 3300025981 Bacteria 1754
366 Ga0207640_10328213 3300025981 Bacteria 1221
367 Ga0207658_10024336 3300025986 Bacteria 4236
368 Ga0207658_10104504 3300025986 Bacteria 2226
369 Ga0207658_10284315 3300025986 Bacteria 1419
370 Ga0207658_10366983 3300025986 Bacteria 1258
371 Ga0207658_10389658 3300025986 Bacteria 1222
372 Ga0207658_11280481 3300025986 Unclassified 670
373 Ga0207677_10158634 3300026023 Unclassified 1755
374 Ga0207677_10812979 3300026023 Bacteria 837
375 Ga0207703_10062624 3300026035 Bacteria 3047
376 Ga0207703_10544913 3300026035 Bacteria 1093
377 Ga0207639_10080415 3300026041 Bacteria 2578
378 Ga0207639_10082021 3300026041 Bacteria 2556
379 Ga0207639_10110375 3300026041 Bacteria 2240
380 Ga0207639_10303168 3300026041 Bacteria 1413
381 Ga0207708_10983627 3300026075 Bacteria 733
382 Ga0207702_10132760 3300026078 Bacteria 2242
383 Ga0207641_10000194 3300026088 Bacteria 82153
384 Ga0207641_10023102 3300026088 Bacteria 5123
385 Ga0207641_10848095 3300026088 Bacteria 905
386 Ga0207641_11725184 3300026088 Bacteria 628
387 Ga0207648_10003655 3300026089 Bacteria 16101
388 Ga0207648_10130338 3300026089 Bacteria 2213
389 Ga0207648_10454524 3300026089 Bacteria 1167
390 Ga0207648_10712306 3300026089 Bacteria 931
391 Ga0207648_10766777 3300026089 Bacteria 897
392 Ga0207676_10009188 3300026095 Bacteria 7038
393 Ga0207676_10278590 3300026095 Bacteria 1517
394 Ga0207676_10355157 3300026095 Bacteria 1357
395 Ga0207674_10024037 3300026116 Bacteria 6517
396 Ga0207674_10048047 3300026116 Bacteria 4371
397 Ga0207674_10232372 3300026116 Bacteria 1792
398 Ga0207674_10412915 3300026116 Bacteria 1304
399 Ga0207674_10727608 3300026116 Bacteria 958
400 Ga0207675_100008546 3300026118 Bacteria 9630
401 Ga0207675_100014275 3300026118 Bacteria 7403
402 Ga0207675_100020892 3300026118 Bacteria 6104
403 Ga0207675_100110239 3300026118 Bacteria 2597
404 Ga0207675_100719031 3300026118 Bacteria 1008
405 Ga0207675_101118766 3300026118 Bacteria 807
406 Ga0207675_101194221 3300026118 Bacteria 781
407 Ga0207683_10001842 3300026121 Bacteria 18744
408 Ga0207683_10010191 3300026121 Bacteria 8015
409 Ga0207683_10137141 3300026121 Bacteria 2203
410 Ga0207683_10224692 3300026121 Bacteria 1711
411 Ga0207683_10230677 3300026121 Bacteria 1688
412 Ga0207698_10036983 3300026142 Bacteria 3590
413 Ga0207698_10069798 3300026142 Unclassified 2781
414 Ga0207698_10086896 3300026142 Bacteria 2545
415 Ga0207698_10126464 3300026142 Bacteria 2175
416 Ga0207698_10580077 3300026142 Bacteria 1103
417 Ga0207428_10145231 3300027907 Bacteria 1808
418 Ga0268265_10091305 3300028380 Bacteria 2435
419 Ga0268265_10099902 3300028380 Unclassified 2340
420 Ga0268265_10301884 3300028380 Bacteria 1442
421 Ga0268264_10006791 3300028381 Bacteria 9615
422 Ga0268264_10027588 3300028381 Bacteria 4642
423 Ga0268264_10037701 3300028381 Bacteria 3986
424 Ga0268264_10273963 3300028381 Bacteria 1578
425 Ga0268264_10696496 3300028381 Bacteria 1009
426 Ga0307509_10336868 3300031507 Bacteria 1238
427 Ga0395899_0001590 3300037312 Bacteria 19085
428 Ga0395899_0109957 3300037312 Bacteria 1982
429 Ga0395899_0274702 3300037312 Bacteria 1148
430 Ga0395900_0004139 3300037418 Bacteria 15441
431 Ga0395900_0005994 3300037418 Bacteria 12692
432 Ga0395900_0847646 3300037418 Bacteria 839
433 Ga0395898_0001279 3300037466 Bacteria 37056
434 Ga0395898_0432205 3300037466 Bacteria 1254
435 Ga0395898_1134014 3300037466 Bacteria 714
436 Ga0395905_0453179 3300037471 Bacteria 1181
437 Ga0395901_0004694 3300038443 Bacteria 13783
438 Ga0395901_0007368 3300038443 Bacteria 11099
439 Ga0395901_0082713 3300038443 Bacteria 3354
440 Ga0451839_0634014 3300041496 Bacteria 829
441 Ga0451853_2221581 3300041512 Bacteria 850
442 Ga0439441_072500 3300042001 Bacteria 740
443 Ga0466969_0189093 3300044656 Unclassified 941
444 Ga0466971_0006994 3300044719 Bacteria 4910
445 Ga0466957_0399041 3300044842 Unclassified 940
446 Ga0466959_0023246 3300045049 Bacteria 4587
447 Ga0466959_0400243 3300045049 Bacteria 933
448 Ga0451576_1095910 3300045051 Bacteria 833
449 Ga0495650_0054289 3300046471 Bacteria 1636
450 Ga0495594_0070596 3300046499 Bacteria 1942
451 Ga0495621_0042690 3300046539 Bacteria 1597
452 Ga0495658_0166106 3300046683 Bacteria 1364
453 Ga0501031_0139675 3300049568 Bacteria 1583
454 Ga0501036_0104660 3300049572 Bacteria 2393
455 Ga0501037_0046793 3300049573 Bacteria 3172
456 Ga0501038_0016450 3300049574 Bacteria 6704
457 Ga0501038_0069401 3300049574 Bacteria 2994
458 Ga0501039_0080907 3300049575 Bacteria 2528
459 Ga0501070_0052241 3300049586 Bacteria 3392
460 Ga0501072_0048925 3300049588 Bacteria 3328
461 Ga0501035_0071677 3300049822 Bacteria 3067
462 Ga0501035_0072140 3300049822 Bacteria 3057
463 Ga0501044_0180619 3300049823 Bacteria 2077
464 nmdc:mga09592_141298_c1 3300050508 Bacteria 2076
465 nmdc:mga09592_84060_c1 3300050508 Unclassified 2714
466 nmdc:mga0qj67_342495_c1 3300050509 Bacteria 1209
467 nmdc:mga0qj67_508059_c1 3300050509 Unclassified 969
468 nmdc:mga06r32_1003295_c1 3300050510 Unclassified 787
469 nmdc:mga06r32_93200_c1 3300050510 Bacteria 2946
470 nmdc:mga08y16_311490_c1 3300050511 Bacteria 1621

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050510 nmdc:mga06r32_1003295_c1 nmdc:mga06r32_1003295_c1_42_536 164
2 3300005327 Ga0070658_10014938 Ga0070658_100149383 165
3 3300025909 Ga0207705_10078713 Ga0207705_100787133 165
4 3300026041 Ga0207639_10303168 Ga0207639_103031682 165
5 3300013307 Ga0157372_11653009 Ga0157372_116530091 166
6 3300013105 Ga0157369_10963234 Ga0157369_109632342 168
7 3300013307 Ga0157372_10529288 Ga0157372_105292882 168
8 3300013307 Ga0157372_10743068 Ga0157372_107430681 168
9 3300025909 Ga0207705_10046351 Ga0207705_100463515 168
10 3300005343 Ga0070687_100608901 Ga0070687_1006089011 169
11 3300005617 Ga0068859_100921887 Ga0068859_1009218872 169
12 3300006931 Ga0097620_100921998 Ga0097620_1009219982 169
13 3300013297 Ga0157378_10097306 Ga0157378_100973063 169
14 3300026118 Ga0207675_100008546 Ga0207675_1000085468 169
15 3300005333 Ga0070677_10029448 Ga0070677_100294482 170
16 3300005456 Ga0070678_100056344 Ga0070678_1000563442 170
17 3300026121 Ga0207683_10010191 Ga0207683_100101916 170
18 3300005340 Ga0070689_100455620 Ga0070689_1004556202 171
19 3300005471 Ga0070698_100002098 Ga0070698_10000209815 171
20 3300005719 Ga0068861_100027622 Ga0068861_1000276222 171
21 3300013102 Ga0157371_10031297 Ga0157371_100312972 171
22 3300013307 Ga0157372_10111875 Ga0157372_101118752 171
23 3300002459 JGI24751J29686_10001484 JGI24751J29686_100014849 172
24 3300005331 Ga0070670_100054955 Ga0070670_1000549552 172
25 3300026095 Ga0207676_10355157 Ga0207676_103551572 172
26 3300044656 Ga0466969_0189093 Ga0466969_0189093_199_729 174
27 3300044719 Ga0466971_0006994 Ga0466971_0006994_3306_3836 174
28 3300044842 Ga0466957_0399041 Ga0466957_0399041_132_662 174
29 3300045049 Ga0466959_0023246 Ga0466959_0023246_3284_3814 174
30 3300045049 Ga0466959_0400243 Ga0466959_0400243_276_806 174
31 3300005616 Ga0068852_100055690 Ga0068852_1000556902 175
32 3300005618 Ga0068864_100459123 Ga0068864_1004591232 175
33 3300009553 Ga0105249_10004353 Ga0105249_100043537 175
34 3300014325 Ga0163163_10190080 Ga0163163_101900802 175
35 3300014326 Ga0157380_11917133 Ga0157380_119171331 175
36 3300025961 Ga0207712_10009906 Ga0207712_100099067 175
37 3300026095 Ga0207676_10278590 Ga0207676_102785902 175
38 3300005334 Ga0068869_100003189 Ga0068869_1000031898 176
39 3300005335 Ga0070666_10000494 Ga0070666_1000049412 176
40 3300005338 Ga0068868_100053243 Ga0068868_1000532433 176
41 3300005340 Ga0070689_100363490 Ga0070689_1003634902 176
42 3300005355 Ga0070671_100097112 Ga0070671_1000971123 176
43 3300005364 Ga0070673_100064919 Ga0070673_1000649193 176
44 3300005365 Ga0070688_100753141 Ga0070688_1007531411 176
45 3300005367 Ga0070667_100012244 Ga0070667_1000122443 176
46 3300005459 Ga0068867_100961263 Ga0068867_1009612631 176
47 3300005616 Ga0068852_100096610 Ga0068852_1000966102 176
48 3300005617 Ga0068859_100000186 Ga0068859_10000018638 176
49 3300005618 Ga0068864_100016143 Ga0068864_1000161436 176
50 3300005618 Ga0068864_100917030 Ga0068864_1009170302 176
51 3300005841 Ga0068863_100005438 Ga0068863_1000054387 176
52 3300005842 Ga0068858_100034101 Ga0068858_1000341012 176
53 3300005843 Ga0068860_100008158 Ga0068860_1000081589 176
54 3300006237 Ga0097621_100055364 Ga0097621_1000553643 176
55 3300006358 Ga0068871_100033135 Ga0068871_1000331351 176
56 3300006358 Ga0068871_100045545 Ga0068871_1000455454 176
57 3300006931 Ga0097620_100000186 Ga0097620_10000018624 176
58 3300009098 Ga0105245_10170786 Ga0105245_101707862 176
59 3300009101 Ga0105247_10006330 Ga0105247_100063309 176
60 3300009148 Ga0105243_10035125 Ga0105243_100351255 176
61 3300009174 Ga0105241_10007177 Ga0105241_100071774 176
62 3300009176 Ga0105242_10019145 Ga0105242_100191455 176
63 3300009545 Ga0105237_10014667 Ga0105237_100146674 176
64 3300009553 Ga0105249_10001561 Ga0105249_1000156114 176
65 3300010375 Ga0105239_10159966 Ga0105239_101599665 176
66 3300013296 Ga0157374_10173000 Ga0157374_101730002 176
67 3300013306 Ga0163162_10000503 Ga0163162_1000050323 176
68 3300013308 Ga0157375_10011842 Ga0157375_100118421 176
69 3300014325 Ga0163163_10111904 Ga0163163_101119042 176
70 3300014969 Ga0157376_10005260 Ga0157376_100052603 176
71 3300014969 Ga0157376_10880537 Ga0157376_108805372 176
72 3300025903 Ga0207680_10000236 Ga0207680_1000023612 176
73 3300025904 Ga0207647_10515727 Ga0207647_105157271 176
74 3300025911 Ga0207654_10024318 Ga0207654_100243183 176
75 3300025914 Ga0207671_10006106 Ga0207671_100061067 176
76 3300025927 Ga0207687_10422193 Ga0207687_104221932 176
77 3300025931 Ga0207644_10014788 Ga0207644_100147883 176
78 3300025934 Ga0207686_10103959 Ga0207686_101039593 176
79 3300025938 Ga0207704_10362674 Ga0207704_103626742 176
80 3300025942 Ga0207689_10000687 Ga0207689_1000068712 176
81 3300025960 Ga0207651_10459038 Ga0207651_104590382 176
82 3300025961 Ga0207712_10001621 Ga0207712_1000162110 176
83 3300025986 Ga0207658_10024336 Ga0207658_100243363 176
84 3300026023 Ga0207677_10158634 Ga0207677_101586342 176
85 3300026035 Ga0207703_10062624 Ga0207703_100626243 176
86 3300026088 Ga0207641_10000194 Ga0207641_1000019437 176
87 3300026089 Ga0207648_10712306 Ga0207648_107123062 176
88 3300026095 Ga0207676_10009188 Ga0207676_100091888 176
89 3300026142 Ga0207698_10069798 Ga0207698_100697982 176
90 3300028381 Ga0268264_10027588 Ga0268264_100275888 176
91 3300031507 Ga0307509_10336868 Ga0307509_103368682 176
92 3300005328 Ga0070676_10091763 Ga0070676_100917632 177
93 3300005331 Ga0070670_100266575 Ga0070670_1002665752 177
94 3300005334 Ga0068869_100106746 Ga0068869_1001067463 177
95 3300005334 Ga0068869_100148933 Ga0068869_1001489332 177
96 3300005334 Ga0068869_100292147 Ga0068869_1002921472 177
97 3300005335 Ga0070666_10018002 Ga0070666_100180022 177
98 3300005347 Ga0070668_100013664 Ga0070668_1000136645 177
99 3300005347 Ga0070668_100043208 Ga0070668_1000432085 177
100 3300005347 Ga0070668_100182891 Ga0070668_1001828912 177
101 3300005355 Ga0070671_100340158 Ga0070671_1003401582 177
102 3300005356 Ga0070674_100008256 Ga0070674_1000082563 177
103 3300005364 Ga0070673_100014508 Ga0070673_1000145083 177
104 3300005364 Ga0070673_100459137 Ga0070673_1004591371 177
105 3300005367 Ga0070667_100022473 Ga0070667_1000224736 177
106 3300005367 Ga0070667_101382556 Ga0070667_1013825561 177
107 3300005367 Ga0070667_101480782 Ga0070667_1014807821 177
108 3300005456 Ga0070678_100087050 Ga0070678_1000870503 177
109 3300005456 Ga0070678_101005328 Ga0070678_1010053281 177
110 3300005459 Ga0068867_100036699 Ga0068867_1000366992 177
111 3300005459 Ga0068867_100063280 Ga0068867_1000632803 177
112 3300005459 Ga0068867_100421347 Ga0068867_1004213471 177
113 3300005539 Ga0068853_100133538 Ga0068853_1001335382 177
114 3300005543 Ga0070672_100032139 Ga0070672_1000321391 177
115 3300005543 Ga0070672_100085790 Ga0070672_1000857903 177
116 3300005617 Ga0068859_100121989 Ga0068859_1001219893 177
117 3300005718 Ga0068866_10090070 Ga0068866_100900702 177
118 3300005718 Ga0068866_10738786 Ga0068866_107387861 177
119 3300005719 Ga0068861_100028073 Ga0068861_1000280735 177
120 3300005719 Ga0068861_100039890 Ga0068861_1000398904 177
121 3300005719 Ga0068861_100130243 Ga0068861_1001302433 177
122 3300005840 Ga0068870_10010630 Ga0068870_100106304 177
123 3300005843 Ga0068860_100165180 Ga0068860_1001651802 177
124 3300005843 Ga0068860_100257136 Ga0068860_1002571361 177
125 3300005844 Ga0068862_100072373 Ga0068862_1000723733 177
126 3300006237 Ga0097621_100459101 Ga0097621_1004591012 177
127 3300006358 Ga0068871_100026639 Ga0068871_1000266394 177
128 3300006881 Ga0068865_100021051 Ga0068865_1000210514 177
129 3300006931 Ga0097620_100121995 Ga0097620_1001219953 177
130 3300009101 Ga0105247_10949954 Ga0105247_109499541 177
131 3300009148 Ga0105243_10225738 Ga0105243_102257382 177
132 3300009174 Ga0105241_10097198 Ga0105241_100971983 177
133 3300009176 Ga0105242_10028031 Ga0105242_100280314 177
134 3300009176 Ga0105242_10232299 Ga0105242_102322992 177
135 3300009553 Ga0105249_10130646 Ga0105249_101306462 177
136 3300009553 Ga0105249_10798537 Ga0105249_107985371 177
137 3300010375 Ga0105239_10757435 Ga0105239_107574352 177
138 3300011119 Ga0105246_10008960 Ga0105246_100089604 177
139 3300013296 Ga0157374_10582744 Ga0157374_105827442 177
140 3300013306 Ga0163162_10868458 Ga0163162_108684582 177
141 3300013308 Ga0157375_10052671 Ga0157375_100526711 177
142 3300013308 Ga0157375_10772426 Ga0157375_107724262 177
143 3300014325 Ga0163163_10885245 Ga0163163_108852451 177
144 3300014745 Ga0157377_10039057 Ga0157377_100390573 177
145 3300014969 Ga0157376_10432770 Ga0157376_104327702 177
146 3300017792 Ga0163161_10695627 Ga0163161_106956272 177
147 3300025899 Ga0207642_10010665 Ga0207642_100106652 177
148 3300025901 Ga0207688_10191660 Ga0207688_101916601 177
149 3300025903 Ga0207680_10725787 Ga0207680_107257872 177
150 3300025907 Ga0207645_10008320 Ga0207645_100083203 177
151 3300025907 Ga0207645_10364922 Ga0207645_103649221 177
152 3300025908 Ga0207643_10023686 Ga0207643_100236862 177
153 3300025923 Ga0207681_10028136 Ga0207681_100281364 177
154 3300025925 Ga0207650_10052379 Ga0207650_100523792 177
155 3300025933 Ga0207706_10178721 Ga0207706_101787213 177
156 3300025934 Ga0207686_10314854 Ga0207686_103148542 177
157 3300025936 Ga0207670_10714098 Ga0207670_107140981 177
158 3300025937 Ga0207669_10857368 Ga0207669_108573682 177
159 3300025938 Ga0207704_10077226 Ga0207704_100772261 177
160 3300025940 Ga0207691_10007169 Ga0207691_100071695 177
161 3300025940 Ga0207691_10125897 Ga0207691_101258972 177
162 3300025942 Ga0207689_10010494 Ga0207689_100104946 177
163 3300025942 Ga0207689_10075453 Ga0207689_100754534 177
164 3300025945 Ga0207679_10931375 Ga0207679_109313752 177
165 3300025960 Ga0207651_10075508 Ga0207651_100755083 177
166 3300025961 Ga0207712_10505723 Ga0207712_105057231 177
167 3300025972 Ga0207668_10022072 Ga0207668_100220723 177
168 3300025972 Ga0207668_10205143 Ga0207668_102051432 177
169 3300025986 Ga0207658_10366983 Ga0207658_103669831 177
170 3300025986 Ga0207658_10389658 Ga0207658_103896582 177
171 3300025986 Ga0207658_11280481 Ga0207658_112804811 177
172 3300026041 Ga0207639_10080415 Ga0207639_100804152 177
173 3300026089 Ga0207648_10003655 Ga0207648_1000365514 177
174 3300026089 Ga0207648_10130338 Ga0207648_101303383 177
175 3300026089 Ga0207648_10766777 Ga0207648_107667772 177
176 3300026116 Ga0207674_10412915 Ga0207674_104129151 177
177 3300026118 Ga0207675_100014275 Ga0207675_1000142754 177
178 3300026118 Ga0207675_100110239 Ga0207675_1001102393 177
179 3300026121 Ga0207683_10001842 Ga0207683_100018426 177
180 3300026121 Ga0207683_10224692 Ga0207683_102246922 177
181 3300028381 Ga0268264_10037701 Ga0268264_100377017 177
182 3300028381 Ga0268264_10273963 Ga0268264_102739633 177
183 3300041512 Ga0451853_2221581 Ga0451853_2221581_211_753 177
184 3300045051 Ga0451576_1095910 Ga0451576_1095910_41_583 177
185 3300049568 Ga0501031_0139675 Ga0501031_0139675_581_1123 177
186 3300049572 Ga0501036_0104660 Ga0501036_0104660_1063_1605 177
187 3300049573 Ga0501037_0046793 Ga0501037_0046793_1653_2195 177
188 3300049574 Ga0501038_0016450 Ga0501038_0016450_5246_5788 177
189 3300049575 Ga0501039_0080907 Ga0501039_0080907_1874_2416 177
190 3300049822 Ga0501035_0072140 Ga0501035_0072140_2118_2660 177
191 3300049823 Ga0501044_0180619 Ga0501044_0180619_663_1205 177
192 3300005459 Ga0068867_100406701 Ga0068867_1004067012 178
193 3300005617 Ga0068859_100457657 Ga0068859_1004576572 178
194 3300006931 Ga0097620_100457702 Ga0097620_1004577022 178
195 3300009176 Ga0105242_10028919 Ga0105242_100289193 178
196 3300013308 Ga0157375_10452767 Ga0157375_104527673 178
197 3300026089 Ga0207648_10454524 Ga0207648_104545241 178
198 3300026118 Ga0207675_100719031 Ga0207675_1007190312 178
199 3300046471 Ga0495650_0054289 Ga0495650_0054289_27_626 178
200 3300049588 Ga0501072_0048925 Ga0501072_0048925_2071_2613 178
201 3300005290 Ga0065712_10006174 Ga0065712_100061742 179
202 3300005293 Ga0065715_10468074 Ga0065715_104680741 179
203 3300005328 Ga0070676_10089757 Ga0070676_100897573 179
204 3300005333 Ga0070677_10223167 Ga0070677_102231672 179
205 3300005334 Ga0068869_100028632 Ga0068869_1000286324 179
206 3300005340 Ga0070689_100013502 Ga0070689_1000135025 179
207 3300005340 Ga0070689_100060607 Ga0070689_1000606072 179
208 3300005353 Ga0070669_100949848 Ga0070669_1009498481 179
209 3300005355 Ga0070671_101512910 Ga0070671_1015129101 179
210 3300005356 Ga0070674_100203916 Ga0070674_1002039162 179
211 3300005364 Ga0070673_100124476 Ga0070673_1001244763 179
212 3300005365 Ga0070688_100047324 Ga0070688_1000473241 179
213 3300005365 Ga0070688_100106085 Ga0070688_1001060853 179
214 3300005367 Ga0070667_100525096 Ga0070667_1005250962 179
215 3300005438 Ga0070701_10253558 Ga0070701_102535582 179
216 3300005441 Ga0070700_100452919 Ga0070700_1004529191 179
217 3300005466 Ga0070685_10042825 Ga0070685_100428252 179
218 3300005466 Ga0070685_10063042 Ga0070685_100630422 179
219 3300005467 Ga0070706_100611810 Ga0070706_1006118101 179
220 3300005468 Ga0070707_100365201 Ga0070707_1003652012 179
221 3300005471 Ga0070698_100013615 Ga0070698_1000136154 179
222 3300005471 Ga0070698_100025763 Ga0070698_1000257637 179
223 3300005471 Ga0070698_100221774 Ga0070698_1002217742 179
224 3300005543 Ga0070672_100089633 Ga0070672_1000896332 179
225 3300005614 Ga0068856_100832015 Ga0068856_1008320152 179
226 3300005616 Ga0068852_100363557 Ga0068852_1003635571 179
227 3300005617 Ga0068859_100085891 Ga0068859_1000858913 179
228 3300005618 Ga0068864_100585508 Ga0068864_1005855082 179
229 3300005718 Ga0068866_10308197 Ga0068866_103081972 179
230 3300005719 Ga0068861_100015284 Ga0068861_1000152847 179
231 3300005719 Ga0068861_101222344 Ga0068861_1012223441 179
232 3300005840 Ga0068870_10067538 Ga0068870_100675383 179
233 3300005841 Ga0068863_100054149 Ga0068863_1000541494 179
234 3300005841 Ga0068863_101595763 Ga0068863_1015957631 179
235 3300005842 Ga0068858_100302223 Ga0068858_1003022231 179
236 3300005844 Ga0068862_100694136 Ga0068862_1006941362 179
237 3300006163 Ga0070715_10097347 Ga0070715_100973472 179
238 3300006237 Ga0097621_100016613 Ga0097621_1000166132 179
239 3300006358 Ga0068871_100295487 Ga0068871_1002954871 179
240 3300006844 Ga0075428_100002349 Ga0075428_10000234920 179
241 3300006844 Ga0075428_100059525 Ga0075428_1000595254 179
242 3300006844 Ga0075428_100204297 Ga0075428_1002042971 179
243 3300006846 Ga0075430_100013143 Ga0075430_1000131434 179
244 3300006846 Ga0075430_100587083 Ga0075430_1005870831 179
245 3300006847 Ga0075431_100035126 Ga0075431_1000351268 179
246 3300006880 Ga0075429_100004013 Ga0075429_10000401314 179
247 3300006880 Ga0075429_100180427 Ga0075429_1001804271 179
248 3300006931 Ga0097620_100085883 Ga0097620_1000858833 179
249 3300009094 Ga0111539_10065795 Ga0111539_100657952 179
250 3300009094 Ga0111539_10110494 Ga0111539_101104943 179
251 3300009147 Ga0114129_10776668 Ga0114129_107766682 179
252 3300009147 Ga0114129_10969534 Ga0114129_109695342 179
253 3300009174 Ga0105241_10740754 Ga0105241_107407542 179
254 3300009176 Ga0105242_10037252 Ga0105242_100372523 179
255 3300009176 Ga0105242_10117490 Ga0105242_101174902 179
256 3300009176 Ga0105242_11575066 Ga0105242_115750661 179
257 3300009177 Ga0105248_10373833 Ga0105248_103738332 179
258 3300009553 Ga0105249_10004716 Ga0105249_100047168 179
259 3300009553 Ga0105249_10010856 Ga0105249_100108562 179
260 3300009553 Ga0105249_10239125 Ga0105249_102391252 179
261 3300011119 Ga0105246_10232602 Ga0105246_102326021 179
262 3300013296 Ga0157374_10147256 Ga0157374_101472562 179
263 3300013297 Ga0157378_10526616 Ga0157378_105266162 179
264 3300013306 Ga0163162_10568149 Ga0163162_105681492 179
265 3300013306 Ga0163162_11654577 Ga0163162_116545771 179
266 3300013308 Ga0157375_10083868 Ga0157375_100838682 179
267 3300013308 Ga0157375_10105077 Ga0157375_101050773 179
268 3300013308 Ga0157375_12917358 Ga0157375_129173581 179
269 3300014326 Ga0157380_10039474 Ga0157380_100394744 179
270 3300014326 Ga0157380_10209766 Ga0157380_102097661 179
271 3300014326 Ga0157380_10220838 Ga0157380_102208381 179
272 3300014326 Ga0157380_10465703 Ga0157380_104657032 179
273 3300014968 Ga0157379_10173513 Ga0157379_101735132 179
274 3300017792 Ga0163161_10010065 Ga0163161_100100658 179
275 3300017792 Ga0163161_10293300 Ga0163161_102933001 179
276 3300025271 Ga0207666_1008425 Ga0207666_10084252 179
277 3300025321 Ga0207656_10304111 Ga0207656_103041112 179
278 3300025905 Ga0207685_10085154 Ga0207685_100851542 179
279 3300025908 Ga0207643_10004789 Ga0207643_100047891 179
280 3300025922 Ga0207646_10970328 Ga0207646_109703281 179
281 3300025923 Ga0207681_10609524 Ga0207681_106095242 179
282 3300025925 Ga0207650_10513051 Ga0207650_105130512 179
283 3300025926 Ga0207659_10230097 Ga0207659_102300972 179
284 3300025931 Ga0207644_11319514 Ga0207644_113195141 179
285 3300025934 Ga0207686_10001727 Ga0207686_1000172710 179
286 3300025936 Ga0207670_10038548 Ga0207670_100385481 179
287 3300025936 Ga0207670_10045588 Ga0207670_100455883 179
288 3300025937 Ga0207669_10273030 Ga0207669_102730302 179
289 3300025938 Ga0207704_10067150 Ga0207704_100671501 179
290 3300025942 Ga0207689_10022434 Ga0207689_100224342 179
291 3300025942 Ga0207689_10078905 Ga0207689_100789052 179
292 3300025960 Ga0207651_11155913 Ga0207651_111559131 179
293 3300025961 Ga0207712_10005567 Ga0207712_1000556710 179
294 3300025961 Ga0207712_10068905 Ga0207712_100689054 179
295 3300025986 Ga0207658_10284315 Ga0207658_102843152 179
296 3300026023 Ga0207677_10812979 Ga0207677_108129792 179
297 3300026035 Ga0207703_10544913 Ga0207703_105449132 179
298 3300026075 Ga0207708_10983627 Ga0207708_109836271 179
299 3300026088 Ga0207641_10023102 Ga0207641_100231026 179
300 3300026088 Ga0207641_10848095 Ga0207641_108480951 179
301 3300026088 Ga0207641_11725184 Ga0207641_117251841 179
302 3300026116 Ga0207674_10727608 Ga0207674_107276081 179
303 3300026118 Ga0207675_100020892 Ga0207675_1000208922 179
304 3300026118 Ga0207675_101194221 Ga0207675_1011942211 179
305 3300026121 Ga0207683_10137141 Ga0207683_101371411 179
306 3300026121 Ga0207683_10230677 Ga0207683_102306771 179
307 3300026142 Ga0207698_10580077 Ga0207698_105800772 179
308 3300027907 Ga0207428_10145231 Ga0207428_101452311 179
309 3300028380 Ga0268265_10091305 Ga0268265_100913053 179
310 3300028380 Ga0268265_10301884 Ga0268265_103018842 179
311 3300028381 Ga0268264_10696496 Ga0268264_106964962 179
312 3300041496 Ga0451839_0634014 Ga0451839_0634014_215_757 179
313 3300042001 Ga0439441_072500 Ga0439441_072500_141_683 179
314 3300046499 Ga0495594_0070596 Ga0495594_0070596_969_1511 179
315 3300046539 Ga0495621_0042690 Ga0495621_0042690_440_982 179
316 3300046683 Ga0495658_0166106 Ga0495658_0166106_635_1177 179
317 3300050508 nmdc:mga09592_141298_c1 nmdc:mga09592_141298_c1_1144_1686 179
318 3300050508 nmdc:mga09592_84060_c1 nmdc:mga09592_84060_c1_58_600 179
319 3300050509 nmdc:mga0qj67_342495_c1 nmdc:mga0qj67_342495_c1_74_616 179
320 3300050509 nmdc:mga0qj67_508059_c1 nmdc:mga0qj67_508059_c1_390_932 179
321 3300050510 nmdc:mga06r32_93200_c1 nmdc:mga06r32_93200_c1_2101_2643 179
322 3300050511 nmdc:mga08y16_311490_c1 nmdc:mga08y16_311490_c1_882_1424 179
323 3300005327 Ga0070658_10242927 Ga0070658_102429272 180
324 3300005329 Ga0070683_101113958 Ga0070683_1011139581 180
325 3300005334 Ga0068869_100207353 Ga0068869_1002073532 180
326 3300005336 Ga0070680_100107735 Ga0070680_1001077353 180
327 3300005337 Ga0070682_100010328 Ga0070682_1000103283 180
328 3300005337 Ga0070682_100023486 Ga0070682_1000234864 180
329 3300005339 Ga0070660_100241032 Ga0070660_1002410322 180
330 3300005344 Ga0070661_100217290 Ga0070661_1002172902 180
331 3300005347 Ga0070668_100052593 Ga0070668_1000525933 180
332 3300005458 Ga0070681_10351971 Ga0070681_103519712 180
333 3300005458 Ga0070681_10759712 Ga0070681_107597122 180
334 3300005530 Ga0070679_100001843 Ga0070679_10000184310 180
335 3300005530 Ga0070679_100112459 Ga0070679_1001124593 180
336 3300005535 Ga0070684_100181359 Ga0070684_1001813593 180
337 3300005535 Ga0070684_100540113 Ga0070684_1005401132 180
338 3300005539 Ga0068853_100032600 Ga0068853_1000326004 180
339 3300005563 Ga0068855_100252555 Ga0068855_1002525552 180
340 3300005563 Ga0068855_100431322 Ga0068855_1004313222 180
341 3300005578 Ga0068854_100102963 Ga0068854_1001029632 180
342 3300005578 Ga0068854_100284622 Ga0068854_1002846222 180
343 3300005614 Ga0068856_100021551 Ga0068856_1000215513 180
344 3300005616 Ga0068852_100000563 Ga0068852_10000056321 180
345 3300005616 Ga0068852_100014576 Ga0068852_1000145762 180
346 3300005843 Ga0068860_100061503 Ga0068860_1000615033 180
347 3300009174 Ga0105241_10012438 Ga0105241_100124382 180
348 3300009545 Ga0105237_10066269 Ga0105237_100662691 180
349 3300010375 Ga0105239_10064401 Ga0105239_100644012 180
350 3300013100 Ga0157373_10021980 Ga0157373_100219804 180
351 3300013102 Ga0157371_10000932 Ga0157371_100009328 180
352 3300013102 Ga0157371_10022360 Ga0157371_100223604 180
353 3300013102 Ga0157371_10456722 Ga0157371_104567222 180
354 3300013104 Ga0157370_10151079 Ga0157370_101510792 180
355 3300013105 Ga0157369_10159172 Ga0157369_101591722 180
356 3300013105 Ga0157369_10201026 Ga0157369_102010262 180
357 3300013307 Ga0157372_10101571 Ga0157372_101015713 180
358 3300013307 Ga0157372_10311885 Ga0157372_103118852 180
359 3300014326 Ga0157380_10779692 Ga0157380_107796922 180
360 3300025893 Ga0207682_10119705 Ga0207682_101197051 180
361 3300025909 Ga0207705_10003539 Ga0207705_1000353910 180
362 3300025911 Ga0207654_10035846 Ga0207654_100358462 180
363 3300025912 Ga0207707_10176178 Ga0207707_101761782 180
364 3300025912 Ga0207707_10281061 Ga0207707_102810612 180
365 3300025913 Ga0207695_10042677 Ga0207695_100426773 180
366 3300025916 Ga0207663_10451170 Ga0207663_104511702 180
367 3300025917 Ga0207660_10252788 Ga0207660_102527882 180
368 3300025919 Ga0207657_10087157 Ga0207657_100871572 180
369 3300025920 Ga0207649_10138311 Ga0207649_101383112 180
370 3300025921 Ga0207652_10001189 Ga0207652_1000118912 180
371 3300025921 Ga0207652_11302505 Ga0207652_113025051 180
372 3300025942 Ga0207689_10064671 Ga0207689_100646713 180
373 3300025944 Ga0207661_11009531 Ga0207661_110095311 180
374 3300025949 Ga0207667_10330965 Ga0207667_103309652 180
375 3300025981 Ga0207640_10141488 Ga0207640_101414882 180
376 3300025981 Ga0207640_10328213 Ga0207640_103282131 180
377 3300025986 Ga0207658_10104504 Ga0207658_101045042 180
378 3300026041 Ga0207639_10082021 Ga0207639_100820213 180
379 3300026078 Ga0207702_10132760 Ga0207702_101327602 180
380 3300026142 Ga0207698_10036983 Ga0207698_100369834 180
381 3300026142 Ga0207698_10086896 Ga0207698_100868962 180
382 3300028380 Ga0268265_10099902 Ga0268265_100999022 180
383 3300028381 Ga0268264_10006791 Ga0268264_100067912 180
384 3300049574 Ga0501038_0069401 Ga0501038_0069401_968_1510 180
385 3300049822 Ga0501035_0071677 Ga0501035_0071677_332_874 180
386 3300005327 Ga0070658_10035406 Ga0070658_100354063 181
387 3300005339 Ga0070660_100036738 Ga0070660_1000367384 181
388 3300005345 Ga0070692_10199412 Ga0070692_101994121 181
389 3300005366 Ga0070659_100071881 Ga0070659_1000718813 181
390 3300005366 Ga0070659_100204944 Ga0070659_1002049442 181
391 3300005458 Ga0070681_10078835 Ga0070681_100788353 181
392 3300005530 Ga0070679_100000723 Ga0070679_10000072310 181
393 3300005530 Ga0070679_100192850 Ga0070679_1001928502 181
394 3300005539 Ga0068853_100604079 Ga0068853_1006040792 181
395 3300005563 Ga0068855_100004190 Ga0068855_10000419010 181
396 3300005577 Ga0068857_100028509 Ga0068857_1000285092 181
397 3300005577 Ga0068857_101750985 Ga0068857_1017509851 181
398 3300005614 Ga0068856_101105941 Ga0068856_1011059411 181
399 3300005841 Ga0068863_100377328 Ga0068863_1003773281 181
400 3300011119 Ga0105246_10150182 Ga0105246_101501822 181
401 3300013296 Ga0157374_10318678 Ga0157374_103186782 181
402 3300025909 Ga0207705_10068973 Ga0207705_100689733 181
403 3300025912 Ga0207707_10234179 Ga0207707_102341792 181
404 3300025912 Ga0207707_10554714 Ga0207707_105547142 181
405 3300025919 Ga0207657_10169888 Ga0207657_101698883 181
406 3300025921 Ga0207652_10000546 Ga0207652_1000054610 181
407 3300025932 Ga0207690_10005226 Ga0207690_100052262 181
408 3300025949 Ga0207667_10075413 Ga0207667_100754132 181
409 3300026116 Ga0207674_10024037 Ga0207674_100240374 181
410 3300026142 Ga0207698_10126464 Ga0207698_101264642 181
411 3300005339 Ga0070660_100046199 Ga0070660_1000461994 182
412 3300005563 Ga0068855_100165088 Ga0068855_1001650884 182
413 3300005834 Ga0068851_10499191 Ga0068851_104991912 182
414 3300013307 Ga0157372_11552885 Ga0157372_115528851 182
415 3300025919 Ga0207657_10061191 Ga0207657_100611915 182
416 3300025919 Ga0207657_10065191 Ga0207657_100651912 182
417 3300026118 Ga0207675_101118766 Ga0207675_1011187662 182
418 3300002067 JGI24735J21928_10106646 JGI24735J21928_101066462 183
419 3300005327 Ga0070658_10263734 Ga0070658_102637342 183
420 3300005327 Ga0070658_10666836 Ga0070658_106668362 183
421 3300005329 Ga0070683_100175638 Ga0070683_1001756382 183
422 3300005336 Ga0070680_100029490 Ga0070680_1000294904 183
423 3300005339 Ga0070660_100046555 Ga0070660_1000465552 183
424 3300005339 Ga0070660_100084642 Ga0070660_1000846422 183
425 3300005458 Ga0070681_10090375 Ga0070681_100903752 183
426 3300005530 Ga0070679_100011352 Ga0070679_1000113523 183
427 3300005539 Ga0068853_100040732 Ga0068853_1000407323 183
428 3300005563 Ga0068855_100053098 Ga0068855_1000530984 183
429 3300005577 Ga0068857_100269077 Ga0068857_1002690773 183
430 3300013100 Ga0157373_10005431 Ga0157373_100054317 183
431 3300013100 Ga0157373_10019799 Ga0157373_100197993 183
432 3300013100 Ga0157373_10121183 Ga0157373_101211832 183
433 3300013100 Ga0157373_10160310 Ga0157373_101603102 183
434 3300013102 Ga0157371_10003608 Ga0157371_100036082 183
435 3300013102 Ga0157371_10003924 Ga0157371_100039243 183
436 3300013102 Ga0157371_10098152 Ga0157371_100981521 183
437 3300013102 Ga0157371_10264417 Ga0157371_102644172 183
438 3300013102 Ga0157371_10266512 Ga0157371_102665122 183
439 3300013102 Ga0157371_10366576 Ga0157371_103665762 183
440 3300013104 Ga0157370_10003393 Ga0157370_1000339311 183
441 3300013104 Ga0157370_10095369 Ga0157370_100953692 183
442 3300013104 Ga0157370_10226329 Ga0157370_102263292 183
443 3300013105 Ga0157369_10084258 Ga0157369_100842584 183
444 3300013307 Ga0157372_10387796 Ga0157372_103877962 183
445 3300013307 Ga0157372_10413568 Ga0157372_104135682 183
446 3300013307 Ga0157372_11623859 Ga0157372_116238592 183
447 3300025909 Ga0207705_10666286 Ga0207705_106662862 183
448 3300025912 Ga0207707_10180504 Ga0207707_101805042 183
449 3300025917 Ga0207660_10084884 Ga0207660_100848842 183
450 3300025917 Ga0207660_10273574 Ga0207660_102735742 183
451 3300025919 Ga0207657_10078741 Ga0207657_100787412 183
452 3300025921 Ga0207652_10017232 Ga0207652_100172322 183
453 3300025949 Ga0207667_10058892 Ga0207667_100588923 183
454 3300026041 Ga0207639_10110375 Ga0207639_101103753 183
455 3300026116 Ga0207674_10048047 Ga0207674_100480474 183
456 3300026116 Ga0207674_10232372 Ga0207674_102323722 183
457 3300037312 Ga0395899_0001590 Ga0395899_0001590_12882_13433 183
458 3300037312 Ga0395899_0109957 Ga0395899_0109957_1075_1626 183
459 3300037312 Ga0395899_0274702 Ga0395899_0274702_58_609 183
460 3300037418 Ga0395900_0004139 Ga0395900_0004139_5525_6076 183
461 3300037418 Ga0395900_0005994 Ga0395900_0005994_876_1427 183
462 3300037418 Ga0395900_0847646 Ga0395900_0847646_213_764 183
463 3300037466 Ga0395898_0001279 Ga0395898_0001279_21574_22125 183
464 3300037466 Ga0395898_0432205 Ga0395898_0432205_560_1111 183
465 3300037466 Ga0395898_1134014 Ga0395898_1134014_114_665 183
466 3300037471 Ga0395905_0453179 Ga0395905_0453179_344_895 183
467 3300038443 Ga0395901_0004694 Ga0395901_0004694_5408_5959 183
468 3300038443 Ga0395901_0007368 Ga0395901_0007368_8057_8608 183
469 3300038443 Ga0395901_0082713 Ga0395901_0082713_560_1111 183
470 3300049586 Ga0501070_0052241 Ga0501070_0052241_170_745 183

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04264

YceI

YceI-like domain

40

196

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ixh-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcna 0.9221 25 179
5ixh-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcna 0.8945 25 179
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.8937 21 180
5w2d-assembly1.cif.gz_A crystal structure of mutant cj ycei protein (cj-g34c) for nanotechnology applications 0.872 41 180
5w39-assembly1.cif.gz_A crystal structure of mutant cj ycei protein (cj-n182c) with monobromobimane guest structure 0.8713 41 180
ID Description Score Start End Superfamily
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8827 21 180 2.40.128.110
5w2dA01 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.872 41 180 2.40.128.110
af_Q2FUS9_3_167_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8609 30 177 2.40.128.110
1wubA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8482 21 178 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8336 21 180 2.40.128.110
ID Description Score Start End GO Terms
AF-A0A5C9BVI6-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9708 11 180
AF-A0A7L9BJG8-F1-model_v4 YceI family protein 0.964 15 180
AF-A0A257HU49-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9635 10 180
AF-A0A1M7K1K0-F1-model_v4 Polyisoprenoid-binding protein YceI 0.9605 22 180
AF-A0A832F9F2-F1-model_v4 Polyisoprenoid-binding protein 0.9567 10 180

Feature Viewer

pLDDT pTM Quality
91.02 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map