F450434

General Info

Members Datasets Scaffolds Average Seq Length
470 183 469 114

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10514183|Ga0307405_105141832
Length 116
Sequence MEKSDVISALAALAQETRLDIFRILIQAGNEGRPVGYIGEKLGLPSATLSFHLSQLKQAGLVTFHREGRSLIYSAAFDAMNGLMGFLTENCCGGDTAACDIDTRACAPLPPAKPGR

Samples

Sample ID Description Type Environment
1 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
170 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
171 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
172 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
173 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
174 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
175 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
176 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 0.64
Rhizosphere 98.51
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1006376 3300001904 Bacteria 1985
2 JGI24741J21665_1000956 3300001915 Bacteria 8693
3 JGI24747J21853_1034477 3300001978 Bacteria 586
4 JGI24740J21852_10001530 3300001979 Bacteria 10629
5 JGI24740J21852_10012366 3300001979 Bacteria 3219
6 JGI24739J22299_10000816 3300001989 Bacteria 11417
7 JGI24739J22299_10002425 3300001989 Bacteria 7194
8 JGI24739J22299_10061696 3300001989 Bacteria 1183
9 JGI24737J22298_10000296 3300001990 Bacteria 16530
10 JGI24737J22298_10000516 3300001990 Bacteria 13557
11 JGI24737J22298_10001986 3300001990 Bacteria 7310
12 JGI24737J22298_10023327 3300001990 Bacteria 1963
13 JGI24743J22301_10059537 3300001991 Bacteria 785
14 JGI24735J21928_10002525 3300002067 Bacteria 6328
15 JGI24735J21928_10010173 3300002067 Bacteria 3005
16 JGI24745J21846_1022015 3300002073 Bacteria 751
17 JGI24748J21848_1028416 3300002074 Bacteria 687
18 JGI24738J21930_10000065 3300002075 Bacteria 21949
19 JGI24738J21930_10078726 3300002075 Bacteria 688
20 JGI24744J21845_10024131 3300002077 Bacteria 1189
21 JGI24035J26624_1015384 3300002126 Bacteria 784
22 JGI24034J26672_10001309 3300002239 Bacteria 3281
23 JGI24742J22300_10022430 3300002244 Bacteria 1082
24 Ga0065704_10486354 3300005289 Bacteria 663
25 Ga0065712_10469202 3300005290 Bacteria 672
26 Ga0065715_10105120 3300005293 Bacteria 2913
27 Ga0065715_10155685 3300005293 Bacteria 1680
28 Ga0070658_10007080 3300005327 Bacteria 9052
29 Ga0070658_10019611 3300005327 Bacteria 5414
30 Ga0070676_10002241 3300005328 Bacteria 9869
31 Ga0070676_10004904 3300005328 Bacteria 7089
32 Ga0070690_100004600 3300005330 Bacteria 7674
33 Ga0070690_100461716 3300005330 Bacteria 943
34 Ga0070670_100008638 3300005331 Bacteria 8695
35 Ga0070670_100296615 3300005331 Bacteria 1413
36 Ga0070677_10000855 3300005333 Bacteria 10030
37 Ga0070677_10026805 3300005333 Bacteria 2164
38 Ga0070677_10063263 3300005333 Bacteria 1533
39 Ga0068869_100000215 3300005334 Bacteria 30140
40 Ga0068869_100010224 3300005334 Bacteria 6111
41 Ga0068869_100362595 3300005334 Bacteria 1184
42 Ga0068869_101694906 3300005334 Bacteria 564
43 Ga0070666_10024347 3300005335 Bacteria 3943
44 Ga0070666_10362114 3300005335 Bacteria 1039
45 Ga0070666_11417062 3300005335 Bacteria 519
46 Ga0070680_100021313 3300005336 Bacteria 5149
47 Ga0068868_100000001 3300005338 Bacteria 282170
48 Ga0068868_100000041 3300005338 Bacteria 69601
49 Ga0068868_100554491 3300005338 Bacteria 1013
50 Ga0070660_100003237 3300005339 Bacteria 11177
51 Ga0070660_100005221 3300005339 Bacteria 8982
52 Ga0070660_100006747 3300005339 Bacteria 7963
53 Ga0070660_100030312 3300005339 Bacteria 4058
54 Ga0070660_100080142 3300005339 Bacteria 2562
55 Ga0070660_100279392 3300005339 Bacteria 1366
56 Ga0070660_100281298 3300005339 Bacteria 1361
57 Ga0070660_100831092 3300005339 Bacteria 777
58 Ga0070689_100024057 3300005340 Bacteria 4567
59 Ga0070661_100011049 3300005344 Bacteria 6290
60 Ga0070661_100025208 3300005344 Bacteria 4273
61 Ga0070661_100716718 3300005344 Bacteria 816
62 Ga0070661_101304900 3300005344 Bacteria 609
63 Ga0070692_10014846 3300005345 Bacteria 3669
64 Ga0070692_10282526 3300005345 Bacteria 1006
65 Ga0070668_100003957 3300005347 Bacteria 10951
66 Ga0070668_100017983 3300005347 Bacteria 5303
67 Ga0070668_100018834 3300005347 Bacteria 5186
68 Ga0070668_100049227 3300005347 Bacteria 3242
69 Ga0070669_100009536 3300005353 Bacteria 6912
70 Ga0070669_100023162 3300005353 Bacteria 4445
71 Ga0070669_100090685 3300005353 Bacteria 2291
72 Ga0070675_100003261 3300005354 Bacteria 12301
73 Ga0070675_100199953 3300005354 Bacteria 1734
74 Ga0070675_100785581 3300005354 Bacteria 870
75 Ga0070671_100000790 3300005355 Bacteria 22794
76 Ga0070671_100191035 3300005355 Bacteria 1736
77 Ga0070674_100003988 3300005356 Bacteria 8365
78 Ga0070674_100139342 3300005356 Bacteria 1819
79 Ga0070673_100000242 3300005364 Bacteria 27415
80 Ga0070673_100025546 3300005364 Bacteria 4350
81 Ga0070673_100278983 3300005364 Bacteria 1465
82 Ga0070673_100814273 3300005364 Bacteria 863
83 Ga0070673_101754594 3300005364 Bacteria 588
84 Ga0070659_100000001 3300005366 Bacteria 576390
85 Ga0070659_100001924 3300005366 Bacteria 14833
86 Ga0070659_100020999 3300005366 Bacteria 4966
87 Ga0070659_100029038 3300005366 Bacteria 4274
88 Ga0070659_100199020 3300005366 Bacteria 1648
89 Ga0070659_100590648 3300005366 Bacteria 953
90 Ga0070659_100836321 3300005366 Bacteria 802
91 Ga0070667_100001538 3300005367 Bacteria 20662
92 Ga0070667_100026415 3300005367 Bacteria 4829
93 Ga0070667_100835216 3300005367 Bacteria 856
94 Ga0070694_100015173 3300005444 Bacteria 4832
95 Ga0070663_100005330 3300005455 Bacteria 7630
96 Ga0070663_100291177 3300005455 Bacteria 1304
97 Ga0070678_100028880 3300005456 Bacteria 3789
98 Ga0070678_100474036 3300005456 Bacteria 1100
99 Ga0070662_100002998 3300005457 Bacteria 10500
100 Ga0070662_100021755 3300005457 Bacteria 4382
101 Ga0070662_100038505 3300005457 Bacteria 3396
102 Ga0070662_100377520 3300005457 Bacteria 1166
103 Ga0070681_10654649 3300005458 Bacteria 965
104 Ga0068867_100022803 3300005459 Bacteria 4479
105 Ga0068867_100041281 3300005459 Bacteria 3371
106 Ga0068867_101533121 3300005459 Bacteria 621
107 Ga0070685_10347448 3300005466 Bacteria 1013
108 Ga0070679_100032691 3300005530 Bacteria 5148
109 Ga0070684_101925815 3300005535 Bacteria 558
110 Ga0068853_100000281 3300005539 Bacteria 35996
111 Ga0068853_100043393 3300005539 Bacteria 3846
112 Ga0068853_100080618 3300005539 Bacteria 2848
113 Ga0068853_100299481 3300005539 Bacteria 1486
114 Ga0068853_100347057 3300005539 Bacteria 1380
115 Ga0070672_100004276 3300005543 Bacteria 9334
116 Ga0070672_100020270 3300005543 Bacteria 4846
117 Ga0070672_100068141 3300005543 Bacteria 2822
118 Ga0070686_100956347 3300005544 Bacteria 700
119 Ga0070693_100111115 3300005547 Bacteria 1686
120 Ga0070693_100158561 3300005547 Bacteria 1439
121 Ga0068855_100005738 3300005563 Bacteria 15155
122 Ga0068855_100031277 3300005563 Bacteria 6357
123 Ga0068855_100108004 3300005563 Bacteria 3197
124 Ga0068855_100175206 3300005563 Bacteria 2427
125 Ga0070664_100040759 3300005564 Bacteria 3916
126 Ga0070664_100051756 3300005564 Bacteria 3477
127 Ga0070664_100099669 3300005564 Bacteria 2525
128 Ga0068857_100000686 3300005577 Bacteria 25194
129 Ga0068857_100018052 3300005577 Bacteria 6189
130 Ga0068857_100047076 3300005577 Bacteria 3828
131 Ga0068857_101107939 3300005577 Bacteria 765
132 Ga0068857_101208858 3300005577 Unclassified 732
133 Ga0068854_100001510 3300005578 Bacteria 14092
134 Ga0068854_100094692 3300005578 Bacteria 2228
135 Ga0068854_100805003 3300005578 Bacteria 819
136 Ga0070702_100050228 3300005615 Bacteria 2381
137 Ga0070702_100774891 3300005615 Bacteria 739
138 Ga0068852_100018863 3300005616 Bacteria 5445
139 Ga0068852_100037585 3300005616 Bacteria 4061
140 Ga0068852_102866709 3300005616 Bacteria 500
141 Ga0068859_100000281 3300005617 Bacteria 50775
142 Ga0068859_100092689 3300005617 Bacteria 3072
143 Ga0068859_100154149 3300005617 Bacteria 2374
144 Ga0068859_100954306 3300005617 Bacteria 941
145 Ga0068864_100000261 3300005618 Bacteria 47015
146 Ga0068866_10011347 3300005718 Bacteria 3852
147 Ga0068866_10427137 3300005718 Bacteria 861
148 Ga0068861_100142586 3300005719 Bacteria 1957
149 Ga0068861_100838218 3300005719 Bacteria 866
150 Ga0068851_10193397 3300005834 Bacteria 1132
151 Ga0068851_10291600 3300005834 Bacteria 936
152 Ga0068870_10073998 3300005840 Bacteria 1865
153 Ga0068863_100000807 3300005841 Bacteria 31405
154 Ga0068863_100007285 3300005841 Bacteria 10834
155 Ga0068858_100002051 3300005842 Bacteria 20516
156 Ga0068858_100386381 3300005842 Bacteria 1343
157 Ga0068860_100000867 3300005843 Bacteria 33656
158 Ga0068860_100021722 3300005843 Bacteria 6211
159 Ga0068860_101099192 3300005843 Bacteria 814
160 Ga0068862_100007953 3300005844 Bacteria 8771
161 Ga0068862_100179790 3300005844 Bacteria 1898
162 Ga0068862_100465816 3300005844 Bacteria 1194
163 Ga0068862_101039310 3300005844 Bacteria 812
164 Ga0075366_11029299 3300006195 Bacteria 514
165 Ga0097621_100141616 3300006237 Bacteria 2055
166 Ga0068871_100034420 3300006358 Bacteria 4020
167 Ga0068871_101458005 3300006358 Bacteria 646
168 Ga0075433_10466422 3300006852 Unclassified 1113
169 Ga0068865_100000790 3300006881 Bacteria 17803
170 Ga0068865_100014327 3300006881 Bacteria 5037
171 Ga0068865_100460882 3300006881 Bacteria 1053
172 Ga0097620_100000281 3300006931 Bacteria 50775
173 Ga0097620_100092684 3300006931 Bacteria 3072
174 Ga0097620_100154153 3300006931 Bacteria 2374
175 Ga0097620_100954399 3300006931 Bacteria 941
176 Ga0105245_10000433 3300009098 Bacteria 38731
177 Ga0105245_10257276 3300009098 Bacteria 1698
178 Ga0105245_11622554 3300009098 Bacteria 699
179 Ga0105243_10954273 3300009148 Bacteria 857
180 Ga0105241_10005737 3300009174 Bacteria 9168
181 Ga0105242_12112954 3300009176 Unclassified 607
182 Ga0105248_10000313 3300009177 Bacteria 57777
183 Ga0105237_11261641 3300009545 Bacteria 745
184 Ga0105238_10049340 3300009551 Bacteria 4240
185 Ga0105238_10409481 3300009551 Bacteria 1350
186 Ga0105249_10381311 3300009553 Bacteria 1436
187 Ga0105239_10083996 3300010375 Bacteria 3507
188 Ga0105246_10002636 3300011119 Bacteria 10863
189 Ga0105246_10038764 3300011119 Bacteria 3206
190 Ga0105246_10342842 3300011119 Bacteria 1222
191 Ga0105246_10582765 3300011119 Bacteria 964
192 Ga0157373_10001179 3300013100 Bacteria 19984
193 Ga0157373_10072003 3300013100 Bacteria 2440
194 Ga0157373_10132203 3300013100 Bacteria 1755
195 Ga0157373_10890886 3300013100 Bacteria 660
196 Ga0157371_10001574 3300013102 Bacteria 23422
197 Ga0157371_10062082 3300013102 Bacteria 2649
198 Ga0157370_10346720 3300013104 Bacteria 1369
199 Ga0157369_10002919 3300013105 Bacteria 20442
200 Ga0157369_10021165 3300013105 Bacteria 7271
201 Ga0157369_11412875 3300013105 Bacteria 708
202 Ga0157378_10004425 3300013297 Bacteria 12364
203 Ga0157378_10389203 3300013297 Bacteria 1371
204 Ga0163162_10008879 3300013306 Bacteria 9774
205 Ga0163162_10543359 3300013306 Bacteria 1290
206 Ga0157372_10009526 3300013307 Bacteria 10325
207 Ga0157372_10168279 3300013307 Bacteria 2535
208 Ga0157375_10008102 3300013308 Bacteria 9194
209 Ga0157375_10039115 3300013308 Bacteria 4561
210 Ga0157375_10312088 3300013308 Bacteria 1737
211 Ga0157375_10314337 3300013308 Bacteria 1731
212 Ga0163163_10010877 3300014325 Bacteria 8219
213 Ga0157380_12752467 3300014326 Bacteria 558
214 Ga0157377_10137210 3300014745 Bacteria 1500
215 Ga0157379_11088368 3300014968 Bacteria 765
216 Ga0157376_13001273 3300014969 Bacteria 511
217 Ga0207697_10000157 3300025315 Bacteria 33854
218 Ga0207697_10058040 3300025315 Bacteria 1607
219 Ga0207682_10000868 3300025893 Bacteria 14041
220 Ga0207682_10028209 3300025893 Bacteria 2240
221 Ga0207682_10215361 3300025893 Bacteria 887
222 Ga0207642_10034332 3300025899 Bacteria 2156
223 Ga0207642_10516664 3300025899 Bacteria 733
224 Ga0207688_10000953 3300025901 Bacteria 14689
225 Ga0207688_10659339 3300025901 Bacteria 661
226 Ga0207688_10728445 3300025901 Bacteria 628
227 Ga0207680_10046147 3300025903 Bacteria 2574
228 Ga0207680_10204281 3300025903 Bacteria 1348
229 Ga0207647_10000047 3300025904 Bacteria 89112
230 Ga0207647_10005300 3300025904 Bacteria 9478
231 Ga0207645_10008285 3300025907 Bacteria 7264
232 Ga0207645_10015768 3300025907 Bacteria 5011
233 Ga0207645_10025419 3300025907 Bacteria 3831
234 Ga0207645_10276593 3300025907 Bacteria 1114
235 Ga0207643_10013980 3300025908 Bacteria 4354
236 Ga0207643_10091101 3300025908 Bacteria 1778
237 Ga0207705_10013983 3300025909 Bacteria 5787
238 Ga0207705_10124324 3300025909 Bacteria 1916
239 Ga0207707_10067045 3300025912 Bacteria 3126
240 Ga0207660_10004209 3300025917 Bacteria 9367
241 Ga0207657_10000826 3300025919 Bacteria 32744
242 Ga0207657_10002437 3300025919 Bacteria 20086
243 Ga0207657_10004171 3300025919 Bacteria 15315
244 Ga0207657_10010150 3300025919 Bacteria 9412
245 Ga0207657_10053736 3300025919 Bacteria 3488
246 Ga0207657_10192366 3300025919 Bacteria 1645
247 Ga0207657_10281507 3300025919 Bacteria 1320
248 Ga0207657_10371893 3300025919 Bacteria 1126
249 Ga0207649_10005872 3300025920 Bacteria 6653
250 Ga0207649_10048199 3300025920 Bacteria 2627
251 Ga0207652_10004131 3300025921 Bacteria 11848
252 Ga0207681_10010855 3300025923 Bacteria 5596
253 Ga0207681_10056807 3300025923 Bacteria 2671
254 Ga0207694_10038889 3300025924 Bacteria 3659
255 Ga0207694_10289928 3300025924 Bacteria 1346
256 Ga0207650_10008191 3300025925 Bacteria 7131
257 Ga0207659_10003443 3300025926 Bacteria 9486
258 Ga0207659_10005106 3300025926 Bacteria 7955
259 Ga0207659_10224819 3300025926 Bacteria 1511
260 Ga0207687_10001801 3300025927 Bacteria 14760
261 Ga0207687_10084471 3300025927 Bacteria 2301
262 Ga0207644_10000430 3300025931 Bacteria 27277
263 Ga0207690_10000018 3300025932 Bacteria 238992
264 Ga0207690_10000680 3300025932 Bacteria 21791
265 Ga0207690_10003199 3300025932 Bacteria 9832
266 Ga0207690_10009628 3300025932 Bacteria 5735
267 Ga0207690_10064947 3300025932 Bacteria 2494
268 Ga0207690_10103221 3300025932 Bacteria 2040
269 Ga0207690_10606483 3300025932 Bacteria 894
270 Ga0207706_10000103 3300025933 Bacteria 89756
271 Ga0207706_10005585 3300025933 Bacteria 11719
272 Ga0207706_10014063 3300025933 Bacteria 7257
273 Ga0207706_10020563 3300025933 Bacteria 5933
274 Ga0207706_10373975 3300025933 Bacteria 1237
275 Ga0207706_10526072 3300025933 Bacteria 1019
276 Ga0207709_10187524 3300025935 Bacteria 1466
277 Ga0207709_10330798 3300025935 Bacteria 1143
278 Ga0207670_10014163 3300025936 Bacteria 4725
279 Ga0207669_10062133 3300025937 Bacteria 2299
280 Ga0207669_10111387 3300025937 Bacteria 1835
281 Ga0207704_10005465 3300025938 Bacteria 5859
282 Ga0207704_10022804 3300025938 Bacteria 3362
283 Ga0207704_10156861 3300025938 Bacteria 1614
284 Ga0207691_10000586 3300025940 Bacteria 36317
285 Ga0207691_10025895 3300025940 Bacteria 5505
286 Ga0207691_10034401 3300025940 Bacteria 4711
287 Ga0207711_10001081 3300025941 Bacteria 26051
288 Ga0207689_10000242 3300025942 Bacteria 48659
289 Ga0207689_10005615 3300025942 Bacteria 11174
290 Ga0207689_10290166 3300025942 Bacteria 1355
291 Ga0207689_10877121 3300025942 Bacteria 757
292 Ga0207679_10009996 3300025945 Bacteria 6096
293 Ga0207679_10197424 3300025945 Bacteria 1678
294 Ga0207667_10002726 3300025949 Bacteria 21834
295 Ga0207667_10046246 3300025949 Bacteria 4608
296 Ga0207667_10085821 3300025949 Bacteria 3258
297 Ga0207667_10716551 3300025949 Bacteria 1002
298 Ga0207651_10003302 3300025960 Bacteria 7902
299 Ga0207651_10023724 3300025960 Bacteria 3780
300 Ga0207651_10053312 3300025960 Bacteria 2764
301 Ga0207712_10247325 3300025961 Bacteria 1440
302 Ga0207712_10369972 3300025961 Bacteria 1196
303 Ga0207668_10000129 3300025972 Bacteria 53619
304 Ga0207668_10030404 3300025972 Bacteria 3549
305 Ga0207668_10034881 3300025972 Bacteria 3345
306 Ga0207668_10050910 3300025972 Bacteria 2857
307 Ga0207640_10000173 3300025981 Bacteria 46801
308 Ga0207640_10006227 3300025981 Bacteria 6538
309 Ga0207640_11547680 3300025981 Bacteria 597
310 Ga0207658_10011114 3300025986 Bacteria 6132
311 Ga0207658_10046760 3300025986 Bacteria 3162
312 Ga0207658_11016682 3300025986 Bacteria 756
313 Ga0207677_10000024 3300026023 Bacteria 127407
314 Ga0207677_10000606 3300026023 Bacteria 22113
315 Ga0207703_10003929 3300026035 Bacteria 12332
316 Ga0207703_10349645 3300026035 Bacteria 1360
317 Ga0207639_10058572 3300026041 Bacteria 2963
318 Ga0207639_10255233 3300026041 Bacteria 1531
319 Ga0207678_10012675 3300026067 Bacteria 7408
320 Ga0207678_10787742 3300026067 Bacteria 839
321 Ga0207678_11373642 3300026067 Bacteria 625
322 Ga0207641_10004167 3300026088 Bacteria 12599
323 Ga0207641_10256209 3300026088 Bacteria 1636
324 Ga0207648_10000838 3300026089 Bacteria 34648
325 Ga0207648_10036826 3300026089 Bacteria 4310
326 Ga0207676_10001202 3300026095 Bacteria 19413
327 Ga0207674_10000308 3300026116 Bacteria 62120
328 Ga0207674_10000899 3300026116 Bacteria 38882
329 Ga0207674_10019349 3300026116 Bacteria 7376
330 Ga0207674_10024788 3300026116 Bacteria 6403
331 Ga0207674_10340423 3300026116 Bacteria 1450
332 Ga0207674_10999727 3300026116 Unclassified 806
333 Ga0207675_100072458 3300026118 Bacteria 3222
334 Ga0207675_101311553 3300026118 Bacteria 744
335 Ga0207683_10034323 3300026121 Bacteria 4408
336 Ga0207698_10000760 3300026142 Bacteria 18747
337 Ga0207698_10218291 3300026142 Bacteria 1721
338 Ga0207698_11949247 3300026142 Bacteria 602
339 Ga0209995_1051649 3300027471 Bacteria 698
340 Ga0209974_10001653 3300027876 Bacteria 8065
341 Ga0268266_10000315 3300028379 Bacteria 76532
342 Ga0268266_10044185 3300028379 Bacteria 3808
343 Ga0268266_10051783 3300028379 Bacteria 3525
344 Ga0268265_10109706 3300028380 Bacteria 2250
345 Ga0268265_10142184 3300028380 Bacteria 2010
346 Ga0268265_10181178 3300028380 Bacteria 1810
347 Ga0268265_10767125 3300028380 Bacteria 937
348 Ga0268264_10006123 3300028381 Bacteria 10163
349 Ga0268264_10007677 3300028381 Bacteria 8991
350 Ga0268264_10683527 3300028381 Bacteria 1018
351 Ga0268264_10979992 3300028381 Bacteria 851
352 Ga0307408_100044872 3300031548 Bacteria 3153
353 Ga0307408_100064767 3300031548 Bacteria 2678
354 Ga0307408_100313754 3300031548 Bacteria 1318
355 Ga0307408_100403622 3300031548 Bacteria 1174
356 Ga0307408_100987635 3300031548 Bacteria 775
357 Ga0307408_101012025 3300031548 Bacteria 766
358 Ga0307405_10015446 3300031731 Bacteria 4137
359 Ga0307405_10058800 3300031731 Bacteria 2421
360 Ga0307405_10161465 3300031731 Bacteria 1588
361 Ga0307405_10259920 3300031731 Bacteria 1296
362 Ga0307405_10514183 3300031731 Unclassified 962
363 Ga0307413_10004731 3300031824 Bacteria 5976
364 Ga0307413_10030161 3300031824 Bacteria 3043
365 Ga0307413_10206867 3300031824 Bacteria 1422
366 Ga0307413_10214863 3300031824 Bacteria 1400
367 Ga0307413_10243021 3300031824 Bacteria 1330
368 Ga0307413_10330131 3300031824 Bacteria 1169
369 Ga0307413_10725959 3300031824 Bacteria 828
370 Ga0307413_11200665 3300031824 Bacteria 660
371 Ga0307413_11508586 3300031824 Bacteria 594
372 Ga0307410_10014964 3300031852 Bacteria 4586
373 Ga0307410_10059045 3300031852 Bacteria 2617
374 Ga0307410_10108246 3300031852 Bacteria 2006
375 Ga0307410_10142860 3300031852 Bacteria 1773
376 Ga0307410_10982189 3300031852 Bacteria 727
377 Ga0307406_10014750 3300031901 Bacteria 4502
378 Ga0307406_10054163 3300031901 Bacteria 2559
379 Ga0307406_10094196 3300031901 Bacteria 2024
380 Ga0307406_10099873 3300031901 Bacteria 1974
381 Ga0307406_10129365 3300031901 Bacteria 1770
382 Ga0307406_10527027 3300031901 Bacteria 962
383 Ga0307406_10662408 3300031901 Bacteria 867
384 Ga0307406_11188414 3300031901 Bacteria 662
385 Ga0307406_11760407 3300031901 Bacteria 550
386 Ga0307407_10004272 3300031903 Bacteria 6031
387 Ga0307407_10043439 3300031903 Bacteria 2527
388 Ga0307407_10192540 3300031903 Bacteria 1360
389 Ga0307412_10133545 3300031911 Bacteria 1807
390 Ga0307412_10169174 3300031911 Bacteria 1632
391 Ga0307412_10438203 3300031911 Bacteria 1073
392 Ga0307412_11282208 3300031911 Bacteria 659
393 Ga0307412_11623012 3300031911 Unclassified 591
394 Ga0307409_100008505 3300031995 Bacteria 6235
395 Ga0307409_100011473 3300031995 Bacteria 5591
396 Ga0307409_100026353 3300031995 Bacteria 4098
397 Ga0307409_100055674 3300031995 Bacteria 3055
398 Ga0307409_100098685 3300031995 Bacteria 2416
399 Ga0307409_100811370 3300031995 Bacteria 944
400 Ga0307416_100008529 3300032002 Bacteria 6624
401 Ga0307416_100042481 3300032002 Bacteria 3549
402 Ga0307416_100054472 3300032002 Bacteria 3215
403 Ga0307416_100134943 3300032002 Bacteria 2230
404 Ga0307416_100238014 3300032002 Bacteria 1761
405 Ga0307416_100268813 3300032002 Bacteria 1672
406 Ga0307416_100513640 3300032002 Bacteria 1265
407 Ga0307414_10044109 3300032004 Bacteria 3042
408 Ga0307414_10055807 3300032004 Bacteria 2767
409 Ga0307414_10075708 3300032004 Bacteria 2443
410 Ga0307414_10151242 3300032004 Bacteria 1831
411 Ga0307414_10362825 3300032004 Bacteria 1247
412 Ga0307414_10618993 3300032004 Bacteria 973
413 Ga0307414_11071888 3300032004 Bacteria 743
414 Ga0307414_11656544 3300032004 Bacteria 596
415 Ga0307411_10023919 3300032005 Bacteria 3630
416 Ga0307411_10025972 3300032005 Bacteria 3518
417 Ga0307411_10044420 3300032005 Bacteria 2850
418 Ga0307411_10073141 3300032005 Bacteria 2330
419 Ga0307411_10089472 3300032005 Bacteria 2144
420 Ga0307411_10119947 3300032005 Bacteria 1901
421 Ga0307411_10449116 3300032005 Bacteria 1078
422 Ga0307411_10857181 3300032005 Bacteria 804
423 Ga0307411_11826970 3300032005 Bacteria 564
424 Ga0307415_100005203 3300032126 Bacteria 6873
425 Ga0307415_100033799 3300032126 Bacteria 3321
426 Ga0307415_100039698 3300032126 Bacteria 3113
427 Ga0307415_100210268 3300032126 Bacteria 1551
428 Ga0307415_100486950 3300032126 Bacteria 1075
429 Ga0395899_0062096 3300037312 Bacteria 2751
430 Ga0395899_0325202 3300037312 Bacteria 1035
431 Ga0395900_0011557 3300037418 Bacteria 9034
432 Ga0395900_0045518 3300037418 Bacteria 4519
433 Ga0395900_0084615 3300037418 Bacteria 3259
434 Ga0395900_0142421 3300037418 Bacteria 2454
435 Ga0395900_0818525 3300037418 Bacteria 858
436 Ga0395898_0004993 3300037466 Bacteria 14389
437 Ga0395898_0056828 3300037466 Bacteria 3813
438 Ga0395898_0483334 3300037466 Bacteria 1178
439 Ga0395905_0013658 3300037471 Bacteria 7778
440 Ga0395905_0017889 3300037471 Bacteria 6734
441 Ga0395905_0091320 3300037471 Bacteria 2855
442 Ga0395905_0139472 3300037471 Bacteria 2281
443 Ga0395905_0148042 3300037471 Bacteria 2209
444 Ga0395905_0206607 3300037471 Bacteria 1840
445 Ga0395905_0279283 3300037471 Bacteria 1556
446 Ga0395905_0731194 3300037471 Bacteria 892
447 Ga0395905_1334595 3300037471 Bacteria 621
448 Ga0395901_0040376 3300038443 Bacteria 4832
449 Ga0395901_0059472 3300038443 Bacteria 3976
450 Ga0395901_0075162 3300038443 Bacteria 3524
451 Ga0395901_0208699 3300038443 Bacteria 2045
452 Ga0395901_0311589 3300038443 Bacteria 1630
453 Ga0395901_1499536 3300038443 Bacteria 630
454 Ga0436365_0332274 3300039437 Bacteria 662
455 Ga0439436_0114307 3300041404 Bacteria 754
456 Ga0439439_0101842 3300041406 Bacteria 791
457 Ga0439453_0161050 3300041408 Bacteria 537
458 Ga0439437_020195 3300042000 Bacteria 803
459 Ga0450923_020943 3300042125 Bacteria 1271
460 Ga0450898_074229 3300042134 Bacteria 685
461 Ga0450909_040789 3300042185 Bacteria 714
462 Ga0439434_0122246 3300042435 Bacteria 850
463 Ga0466967_0043531 3300045976 Bacteria 3888
464 Ga0496105_1061753 3300048908 Bacteria 603
465 Ga0496111_0915146 3300048914 Bacteria 631
466 Ga0496115_0535718 3300048918 Bacteria 937
467 Ga0501039_0295810 3300049575 Bacteria 1273
468 nmdc:mga0k408_880712_c1 3300050493 Bacteria 520
469 nmdc:mga0a205_25213_c1 3300050515 Bacteria 5663

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005457 Ga0070662_100377520 Ga0070662_1003775202 101
2 3300025933 Ga0207706_10526072 Ga0207706_105260722 101
3 3300005335 Ga0070666_11417062 Ga0070666_114170621 102
4 3300031731 Ga0307405_10058800 Ga0307405_100588002 102
5 3300031824 Ga0307413_11508586 Ga0307413_115085862 102
6 3300032002 Ga0307416_100513640 Ga0307416_1005136402 102
7 3300009176 Ga0105242_12112954 Ga0105242_121129541 103
8 3300031548 Ga0307408_100064767 Ga0307408_1000647674 103
9 3300031852 Ga0307410_10142860 Ga0307410_101428602 103
10 3300031901 Ga0307406_10014750 Ga0307406_100147508 103
11 3300032002 Ga0307416_100008529 Ga0307416_10000852910 103
12 3300032005 Ga0307411_10119947 Ga0307411_101199473 103
13 3300032126 Ga0307415_100486950 Ga0307415_1004869502 103
14 3300009098 Ga0105245_11622554 Ga0105245_116225542 105
15 3300032005 Ga0307411_10449116 Ga0307411_104491162 105
16 3300042134 Ga0450898_074229 Ga0450898_074229_195_518 105
17 3300005331 Ga0070670_100296615 Ga0070670_1002966151 107
18 3300005333 Ga0070677_10000855 Ga0070677_100008554 107
19 3300005344 Ga0070661_101304900 Ga0070661_1013049002 107
20 3300005366 Ga0070659_100029038 Ga0070659_1000290386 107
21 3300005841 Ga0068863_100007285 Ga0068863_1000072852 107
22 3300005843 Ga0068860_100021722 Ga0068860_1000217227 107
23 3300005844 Ga0068862_101039310 Ga0068862_1010393101 107
24 3300014325 Ga0163163_10010877 Ga0163163_100108772 107
25 3300025893 Ga0207682_10000868 Ga0207682_100008686 107
26 3300025932 Ga0207690_10064947 Ga0207690_100649474 107
27 3300025961 Ga0207712_10369972 Ga0207712_103699723 107
28 3300026088 Ga0207641_10256209 Ga0207641_102562091 107
29 3300026116 Ga0207674_10000308 Ga0207674_1000030845 107
30 3300028380 Ga0268265_10767125 Ga0268265_107671251 107
31 3300028381 Ga0268264_10006123 Ga0268264_100061239 107
32 3300038443 Ga0395901_0059472 Ga0395901_0059472_1173_1514 107
33 3300005354 Ga0070675_100003261 Ga0070675_10000326113 108
34 3300005843 Ga0068860_101099192 Ga0068860_1010991922 108
35 3300025926 Ga0207659_10005106 Ga0207659_100051064 108
36 3300028381 Ga0268264_10979992 Ga0268264_109799922 108
37 3300037471 Ga0395905_0279283 Ga0395905_0279283_1118_1477 108
38 3300045976 Ga0466967_0043531 Ga0466967_0043531_202_546 109
39 3300049575 Ga0501039_0295810 Ga0501039_0295810_193_576 109
40 iso_pu_bacteria 2643221588 2643950715 109
41 3300031731 Ga0307405_10514183 Ga0307405_105141832 110
42 3300032004 Ga0307414_10075708 Ga0307414_100757083 110
43 3300032005 Ga0307411_10025972 Ga0307411_100259724 110
44 3300042125 Ga0450923_020943 Ga0450923_020943_711_1061 110
45 3300005289 Ga0065704_10486354 Ga0065704_104863541 111
46 3300005334 Ga0068869_101694906 Ga0068869_1016949061 111
47 3300005577 Ga0068857_101208858 Ga0068857_1012088582 111
48 3300005615 Ga0070702_100774891 Ga0070702_1007748912 111
49 3300005844 Ga0068862_100179790 Ga0068862_1001797904 111
50 3300006195 Ga0075366_11029299 Ga0075366_110292991 111
51 3300006852 Ga0075433_10466422 Ga0075433_104664222 111
52 3300011119 Ga0105246_10582765 Ga0105246_105827652 111
53 3300025942 Ga0207689_10877121 Ga0207689_108771211 111
54 3300026116 Ga0207674_10999727 Ga0207674_109997272 111
55 3300028380 Ga0268265_10109706 Ga0268265_101097062 111
56 3300031901 Ga0307406_11760407 Ga0307406_117604072 111
57 3300031911 Ga0307412_10133545 Ga0307412_101335452 111
58 3300032004 Ga0307414_10618993 Ga0307414_106189932 111
59 3300041408 Ga0439453_0161050 Ga0439453_0161050_184_519 111
60 3300050493 nmdc:mga0k408_880712_c1 nmdc:mga0k408_880712_c1_60_407 111
61 3300050515 nmdc:mga0a205_25213_c1 nmdc:mga0a205_25213_c1_5084_5425 111
62 3300001915 JGI24741J21665_1000956 JGI24741J21665_10009565 112
63 3300001979 JGI24740J21852_10012366 JGI24740J21852_100123661 112
64 3300001989 JGI24739J22299_10002425 JGI24739J22299_100024255 112
65 3300001990 JGI24737J22298_10023327 JGI24737J22298_100233273 112
66 3300002067 JGI24735J21928_10002525 JGI24735J21928_100025253 112
67 3300005327 Ga0070658_10007080 Ga0070658_100070807 112
68 3300005327 Ga0070658_10019611 Ga0070658_100196113 112
69 3300005336 Ga0070680_100021313 Ga0070680_1000213136 112
70 3300005339 Ga0070660_100030312 Ga0070660_1000303127 112
71 3300005344 Ga0070661_100011049 Ga0070661_1000110497 112
72 3300005345 Ga0070692_10282526 Ga0070692_102825262 112
73 3300005366 Ga0070659_100590648 Ga0070659_1005906482 112
74 3300005455 Ga0070663_100005330 Ga0070663_1000053304 112
75 3300005457 Ga0070662_100038505 Ga0070662_1000385057 112
76 3300005458 Ga0070681_10654649 Ga0070681_106546492 112
77 3300005530 Ga0070679_100032691 Ga0070679_1000326917 112
78 3300005539 Ga0068853_100043393 Ga0068853_1000433936 112
79 3300005547 Ga0070693_100158561 Ga0070693_1001585612 112
80 3300005563 Ga0068855_100031277 Ga0068855_1000312777 112
81 3300005563 Ga0068855_100108004 Ga0068855_1001080043 112
82 3300005564 Ga0070664_100051756 Ga0070664_1000517562 112
83 3300005577 Ga0068857_100018052 Ga0068857_1000180526 112
84 3300005578 Ga0068854_100094692 Ga0068854_1000946923 112
85 3300005834 Ga0068851_10193397 Ga0068851_101933973 112
86 3300013100 Ga0157373_10072003 Ga0157373_100720032 112
87 3300013102 Ga0157371_10062082 Ga0157371_100620822 112
88 3300013307 Ga0157372_10168279 Ga0157372_101682795 112
89 3300025909 Ga0207705_10013983 Ga0207705_100139835 112
90 3300025909 Ga0207705_10124324 Ga0207705_101243243 112
91 3300025912 Ga0207707_10067045 Ga0207707_100670456 112
92 3300025917 Ga0207660_10004209 Ga0207660_100042096 112
93 3300025919 Ga0207657_10002437 Ga0207657_100024373 112
94 3300025920 Ga0207649_10005872 Ga0207649_100058725 112
95 3300025921 Ga0207652_10004131 Ga0207652_100041315 112
96 3300025932 Ga0207690_10003199 Ga0207690_100031996 112
97 3300025933 Ga0207706_10005585 Ga0207706_100055855 112
98 3300025945 Ga0207679_10197424 Ga0207679_101974243 112
99 3300025949 Ga0207667_10046246 Ga0207667_100462464 112
100 3300025981 Ga0207640_10006227 Ga0207640_100062275 112
101 3300026067 Ga0207678_10012675 Ga0207678_100126755 112
102 3300026116 Ga0207674_10019349 Ga0207674_100193493 112
103 3300001904 JGI24736J21556_1006376 JGI24736J21556_10063764 113
104 3300001978 JGI24747J21853_1034477 JGI24747J21853_10344772 113
105 3300001979 JGI24740J21852_10001530 JGI24740J21852_100015303 113
106 3300001989 JGI24739J22299_10000816 JGI24739J22299_1000081613 113
107 3300001989 JGI24739J22299_10061696 JGI24739J22299_100616962 113
108 3300001990 JGI24737J22298_10000296 JGI24737J22298_1000029614 113
109 3300001990 JGI24737J22298_10000516 JGI24737J22298_100005169 113
110 3300001990 JGI24737J22298_10001986 JGI24737J22298_1000198611 113
111 3300001991 JGI24743J22301_10059537 JGI24743J22301_100595373 113
112 3300002067 JGI24735J21928_10010173 JGI24735J21928_100101733 113
113 3300002073 JGI24745J21846_1022015 JGI24745J21846_10220152 113
114 3300002074 JGI24748J21848_1028416 JGI24748J21848_10284162 113
115 3300002075 JGI24738J21930_10000065 JGI24738J21930_1000006521 113
116 3300002075 JGI24738J21930_10078726 JGI24738J21930_100787261 113
117 3300002077 JGI24744J21845_10024131 JGI24744J21845_100241312 113
118 3300002126 JGI24035J26624_1015384 JGI24035J26624_10153841 113
119 3300002239 JGI24034J26672_10001309 JGI24034J26672_100013093 113
120 3300002244 JGI24742J22300_10022430 JGI24742J22300_100224302 113
121 3300005290 Ga0065712_10469202 Ga0065712_104692021 113
122 3300005293 Ga0065715_10105120 Ga0065715_101051204 113
123 3300005293 Ga0065715_10155685 Ga0065715_101556853 113
124 3300005328 Ga0070676_10002241 Ga0070676_100022419 113
125 3300005328 Ga0070676_10004904 Ga0070676_100049043 113
126 3300005330 Ga0070690_100004600 Ga0070690_10000460012 113
127 3300005330 Ga0070690_100461716 Ga0070690_1004617162 113
128 3300005331 Ga0070670_100008638 Ga0070670_1000086387 113
129 3300005333 Ga0070677_10026805 Ga0070677_100268054 113
130 3300005333 Ga0070677_10063263 Ga0070677_100632632 113
131 3300005334 Ga0068869_100000215 Ga0068869_10000021526 113
132 3300005334 Ga0068869_100010224 Ga0068869_1000102244 113
133 3300005334 Ga0068869_100362595 Ga0068869_1003625951 113
134 3300005335 Ga0070666_10024347 Ga0070666_100243477 113
135 3300005335 Ga0070666_10362114 Ga0070666_103621141 113
136 3300005338 Ga0068868_100000001 Ga0068868_100000001205 113
137 3300005338 Ga0068868_100000041 Ga0068868_10000004139 113
138 3300005338 Ga0068868_100554491 Ga0068868_1005544912 113
139 3300005339 Ga0070660_100003237 Ga0070660_10000323718 113
140 3300005339 Ga0070660_100005221 Ga0070660_1000052213 113
141 3300005339 Ga0070660_100006747 Ga0070660_10000674712 113
142 3300005339 Ga0070660_100080142 Ga0070660_1000801424 113
143 3300005339 Ga0070660_100279392 Ga0070660_1002793921 113
144 3300005339 Ga0070660_100281298 Ga0070660_1002812981 113
145 3300005339 Ga0070660_100831092 Ga0070660_1008310922 113
146 3300005340 Ga0070689_100024057 Ga0070689_1000240578 113
147 3300005344 Ga0070661_100025208 Ga0070661_1000252086 113
148 3300005344 Ga0070661_100716718 Ga0070661_1007167182 113
149 3300005345 Ga0070692_10014846 Ga0070692_100148464 113
150 3300005347 Ga0070668_100003957 Ga0070668_10000395711 113
151 3300005347 Ga0070668_100017983 Ga0070668_1000179835 113
152 3300005347 Ga0070668_100018834 Ga0070668_1000188346 113
153 3300005347 Ga0070668_100049227 Ga0070668_1000492276 113
154 3300005353 Ga0070669_100009536 Ga0070669_1000095366 113
155 3300005353 Ga0070669_100023162 Ga0070669_1000231624 113
156 3300005353 Ga0070669_100090685 Ga0070669_1000906853 113
157 3300005354 Ga0070675_100199953 Ga0070675_1001999531 113
158 3300005354 Ga0070675_100785581 Ga0070675_1007855811 113
159 3300005355 Ga0070671_100000790 Ga0070671_10000079019 113
160 3300005355 Ga0070671_100191035 Ga0070671_1001910352 113
161 3300005356 Ga0070674_100003988 Ga0070674_10000398815 113
162 3300005356 Ga0070674_100139342 Ga0070674_1001393423 113
163 3300005364 Ga0070673_100000242 Ga0070673_10000024218 113
164 3300005364 Ga0070673_100025546 Ga0070673_1000255462 113
165 3300005364 Ga0070673_100278983 Ga0070673_1002789832 113
166 3300005364 Ga0070673_100814273 Ga0070673_1008142732 113
167 3300005364 Ga0070673_101754594 Ga0070673_1017545941 113
168 3300005366 Ga0070659_100000001 Ga0070659_100000001149 113
169 3300005366 Ga0070659_100001924 Ga0070659_1000019248 113
170 3300005366 Ga0070659_100020999 Ga0070659_1000209994 113
171 3300005366 Ga0070659_100199020 Ga0070659_1001990203 113
172 3300005366 Ga0070659_100836321 Ga0070659_1008363211 113
173 3300005367 Ga0070667_100001538 Ga0070667_1000015387 113
174 3300005367 Ga0070667_100026415 Ga0070667_1000264154 113
175 3300005367 Ga0070667_100835216 Ga0070667_1008352161 113
176 3300005444 Ga0070694_100015173 Ga0070694_1000151735 113
177 3300005455 Ga0070663_100291177 Ga0070663_1002911773 113
178 3300005456 Ga0070678_100028880 Ga0070678_1000288802 113
179 3300005456 Ga0070678_100474036 Ga0070678_1004740362 113
180 3300005457 Ga0070662_100002998 Ga0070662_1000029987 113
181 3300005457 Ga0070662_100021755 Ga0070662_1000217555 113
182 3300005459 Ga0068867_100022803 Ga0068867_1000228036 113
183 3300005459 Ga0068867_100041281 Ga0068867_1000412812 113
184 3300005459 Ga0068867_101533121 Ga0068867_1015331211 113
185 3300005466 Ga0070685_10347448 Ga0070685_103474482 113
186 3300005535 Ga0070684_101925815 Ga0070684_1019258152 113
187 3300005539 Ga0068853_100000281 Ga0068853_1000002816 113
188 3300005539 Ga0068853_100080618 Ga0068853_1000806182 113
189 3300005539 Ga0068853_100299481 Ga0068853_1002994811 113
190 3300005539 Ga0068853_100347057 Ga0068853_1003470572 113
191 3300005543 Ga0070672_100004276 Ga0070672_1000042768 113
192 3300005543 Ga0070672_100020270 Ga0070672_1000202706 113
193 3300005543 Ga0070672_100068141 Ga0070672_1000681413 113
194 3300005544 Ga0070686_100956347 Ga0070686_1009563472 113
195 3300005547 Ga0070693_100111115 Ga0070693_1001111152 113
196 3300005563 Ga0068855_100005738 Ga0068855_1000057385 113
197 3300005563 Ga0068855_100175206 Ga0068855_1001752064 113
198 3300005564 Ga0070664_100040759 Ga0070664_1000407592 113
199 3300005564 Ga0070664_100099669 Ga0070664_1000996693 113
200 3300005577 Ga0068857_100000686 Ga0068857_1000006863 113
201 3300005577 Ga0068857_100047076 Ga0068857_1000470761 113
202 3300005577 Ga0068857_101107939 Ga0068857_1011079392 113
203 3300005578 Ga0068854_100001510 Ga0068854_1000015106 113
204 3300005578 Ga0068854_100805003 Ga0068854_1008050031 113
205 3300005615 Ga0070702_100050228 Ga0070702_1000502284 113
206 3300005616 Ga0068852_100018863 Ga0068852_1000188636 113
207 3300005616 Ga0068852_100037585 Ga0068852_1000375853 113
208 3300005616 Ga0068852_102866709 Ga0068852_1028667092 113
209 3300005617 Ga0068859_100000281 Ga0068859_10000028134 113
210 3300005617 Ga0068859_100092689 Ga0068859_1000926893 113
211 3300005617 Ga0068859_100154149 Ga0068859_1001541494 113
212 3300005617 Ga0068859_100954306 Ga0068859_1009543062 113
213 3300005618 Ga0068864_100000261 Ga0068864_10000026114 113
214 3300005718 Ga0068866_10011347 Ga0068866_100113476 113
215 3300005718 Ga0068866_10427137 Ga0068866_104271372 113
216 3300005719 Ga0068861_100142586 Ga0068861_1001425863 113
217 3300005719 Ga0068861_100838218 Ga0068861_1008382182 113
218 3300005834 Ga0068851_10291600 Ga0068851_102916001 113
219 3300005840 Ga0068870_10073998 Ga0068870_100739982 113
220 3300005841 Ga0068863_100000807 Ga0068863_10000080722 113
221 3300005842 Ga0068858_100002051 Ga0068858_10000205115 113
222 3300005842 Ga0068858_100386381 Ga0068858_1003863812 113
223 3300005843 Ga0068860_100000867 Ga0068860_10000086735 113
224 3300005844 Ga0068862_100007953 Ga0068862_1000079532 113
225 3300005844 Ga0068862_100465816 Ga0068862_1004658162 113
226 3300006237 Ga0097621_100141616 Ga0097621_1001416162 113
227 3300006358 Ga0068871_100034420 Ga0068871_1000344204 113
228 3300006358 Ga0068871_101458005 Ga0068871_1014580051 113
229 3300006881 Ga0068865_100000790 Ga0068865_10000079014 113
230 3300006881 Ga0068865_100014327 Ga0068865_1000143275 113
231 3300006881 Ga0068865_100460882 Ga0068865_1004608823 113
232 3300006931 Ga0097620_100000281 Ga0097620_10000028134 113
233 3300006931 Ga0097620_100092684 Ga0097620_1000926843 113
234 3300006931 Ga0097620_100154153 Ga0097620_1001541534 113
235 3300006931 Ga0097620_100954399 Ga0097620_1009543992 113
236 3300009098 Ga0105245_10000433 Ga0105245_1000043311 113
237 3300009098 Ga0105245_10257276 Ga0105245_102572764 113
238 3300009148 Ga0105243_10954273 Ga0105243_109542731 113
239 3300009174 Ga0105241_10005737 Ga0105241_1000573712 113
240 3300009177 Ga0105248_10000313 Ga0105248_1000031350 113
241 3300009545 Ga0105237_11261641 Ga0105237_112616412 113
242 3300009551 Ga0105238_10049340 Ga0105238_100493406 113
243 3300009551 Ga0105238_10409481 Ga0105238_104094813 113
244 3300009553 Ga0105249_10381311 Ga0105249_103813114 113
245 3300010375 Ga0105239_10083996 Ga0105239_100839963 113
246 3300011119 Ga0105246_10002636 Ga0105246_1000263614 113
247 3300011119 Ga0105246_10038764 Ga0105246_100387641 113
248 3300011119 Ga0105246_10342842 Ga0105246_103428424 113
249 3300013100 Ga0157373_10001179 Ga0157373_1000117917 113
250 3300013100 Ga0157373_10132203 Ga0157373_101322032 113
251 3300013100 Ga0157373_10890886 Ga0157373_108908861 113
252 3300013102 Ga0157371_10001574 Ga0157371_100015745 113
253 3300013104 Ga0157370_10346720 Ga0157370_103467202 113
254 3300013105 Ga0157369_10002919 Ga0157369_1000291919 113
255 3300013105 Ga0157369_10021165 Ga0157369_100211656 113
256 3300013105 Ga0157369_11412875 Ga0157369_114128752 113
257 3300013297 Ga0157378_10004425 Ga0157378_100044255 113
258 3300013297 Ga0157378_10389203 Ga0157378_103892033 113
259 3300013306 Ga0163162_10008879 Ga0163162_100088794 113
260 3300013306 Ga0163162_10543359 Ga0163162_105433592 113
261 3300013307 Ga0157372_10009526 Ga0157372_1000952614 113
262 3300013308 Ga0157375_10008102 Ga0157375_1000810211 113
263 3300013308 Ga0157375_10039115 Ga0157375_100391152 113
264 3300013308 Ga0157375_10312088 Ga0157375_103120882 113
265 3300013308 Ga0157375_10314337 Ga0157375_103143372 113
266 3300014326 Ga0157380_12752467 Ga0157380_127524672 113
267 3300014745 Ga0157377_10137210 Ga0157377_101372102 113
268 3300014968 Ga0157379_11088368 Ga0157379_110883681 113
269 3300014969 Ga0157376_13001273 Ga0157376_130012732 113
270 3300025315 Ga0207697_10000157 Ga0207697_1000015716 113
271 3300025315 Ga0207697_10058040 Ga0207697_100580403 113
272 3300025893 Ga0207682_10028209 Ga0207682_100282093 113
273 3300025893 Ga0207682_10215361 Ga0207682_102153612 113
274 3300025899 Ga0207642_10034332 Ga0207642_100343324 113
275 3300025899 Ga0207642_10516664 Ga0207642_105166641 113
276 3300025901 Ga0207688_10000953 Ga0207688_1000095313 113
277 3300025901 Ga0207688_10659339 Ga0207688_106593392 113
278 3300025901 Ga0207688_10728445 Ga0207688_107284452 113
279 3300025903 Ga0207680_10046147 Ga0207680_100461472 113
280 3300025903 Ga0207680_10204281 Ga0207680_102042812 113
281 3300025904 Ga0207647_10000047 Ga0207647_1000004729 113
282 3300025904 Ga0207647_10005300 Ga0207647_1000530011 113
283 3300025907 Ga0207645_10008285 Ga0207645_100082856 113
284 3300025907 Ga0207645_10015768 Ga0207645_100157687 113
285 3300025907 Ga0207645_10025419 Ga0207645_100254195 113
286 3300025907 Ga0207645_10276593 Ga0207645_102765931 113
287 3300025908 Ga0207643_10013980 Ga0207643_100139804 113
288 3300025908 Ga0207643_10091101 Ga0207643_100911012 113
289 3300025919 Ga0207657_10000826 Ga0207657_1000082624 113
290 3300025919 Ga0207657_10004171 Ga0207657_1000417116 113
291 3300025919 Ga0207657_10010150 Ga0207657_100101508 113
292 3300025919 Ga0207657_10053736 Ga0207657_100537363 113
293 3300025919 Ga0207657_10192366 Ga0207657_101923662 113
294 3300025919 Ga0207657_10281507 Ga0207657_102815071 113
295 3300025919 Ga0207657_10371893 Ga0207657_103718933 113
296 3300025920 Ga0207649_10048199 Ga0207649_100481992 113
297 3300025923 Ga0207681_10010855 Ga0207681_100108557 113
298 3300025923 Ga0207681_10056807 Ga0207681_100568075 113
299 3300025924 Ga0207694_10038889 Ga0207694_100388894 113
300 3300025924 Ga0207694_10289928 Ga0207694_102899281 113
301 3300025925 Ga0207650_10008191 Ga0207650_100081916 113
302 3300025926 Ga0207659_10003443 Ga0207659_100034432 113
303 3300025926 Ga0207659_10224819 Ga0207659_102248191 113
304 3300025927 Ga0207687_10001801 Ga0207687_1000180113 113
305 3300025927 Ga0207687_10084471 Ga0207687_100844713 113
306 3300025931 Ga0207644_10000430 Ga0207644_1000043017 113
307 3300025932 Ga0207690_10000018 Ga0207690_10000018116 113
308 3300025932 Ga0207690_10000680 Ga0207690_1000068023 113
309 3300025932 Ga0207690_10009628 Ga0207690_100096287 113
310 3300025932 Ga0207690_10103221 Ga0207690_101032212 113
311 3300025932 Ga0207690_10606483 Ga0207690_106064832 113
312 3300025933 Ga0207706_10000103 Ga0207706_1000010338 113
313 3300025933 Ga0207706_10014063 Ga0207706_100140639 113
314 3300025933 Ga0207706_10020563 Ga0207706_100205638 113
315 3300025933 Ga0207706_10373975 Ga0207706_103739751 113
316 3300025935 Ga0207709_10187524 Ga0207709_101875243 113
317 3300025935 Ga0207709_10330798 Ga0207709_103307983 113
318 3300025936 Ga0207670_10014163 Ga0207670_100141633 113
319 3300025937 Ga0207669_10062133 Ga0207669_100621334 113
320 3300025937 Ga0207669_10111387 Ga0207669_101113872 113
321 3300025938 Ga0207704_10005465 Ga0207704_100054657 113
322 3300025938 Ga0207704_10022804 Ga0207704_100228044 113
323 3300025938 Ga0207704_10156861 Ga0207704_101568611 113
324 3300025940 Ga0207691_10000586 Ga0207691_1000058625 113
325 3300025940 Ga0207691_10025895 Ga0207691_100258955 113
326 3300025940 Ga0207691_10034401 Ga0207691_100344016 113
327 3300025941 Ga0207711_10001081 Ga0207711_1000108130 113
328 3300025942 Ga0207689_10000242 Ga0207689_1000024230 113
329 3300025942 Ga0207689_10005615 Ga0207689_100056156 113
330 3300025942 Ga0207689_10290166 Ga0207689_102901662 113
331 3300025945 Ga0207679_10009996 Ga0207679_1000999613 113
332 3300025949 Ga0207667_10002726 Ga0207667_1000272613 113
333 3300025949 Ga0207667_10085821 Ga0207667_100858213 113
334 3300025949 Ga0207667_10716551 Ga0207667_107165512 113
335 3300025960 Ga0207651_10003302 Ga0207651_1000330210 113
336 3300025960 Ga0207651_10023724 Ga0207651_100237242 113
337 3300025960 Ga0207651_10053312 Ga0207651_100533125 113
338 3300025961 Ga0207712_10247325 Ga0207712_102473254 113
339 3300025972 Ga0207668_10000129 Ga0207668_1000012957 113
340 3300025972 Ga0207668_10030404 Ga0207668_100304044 113
341 3300025972 Ga0207668_10034881 Ga0207668_100348816 113
342 3300025972 Ga0207668_10050910 Ga0207668_100509106 113
343 3300025981 Ga0207640_10000173 Ga0207640_1000017328 113
344 3300025981 Ga0207640_11547680 Ga0207640_115476802 113
345 3300025986 Ga0207658_10011114 Ga0207658_100111147 113
346 3300025986 Ga0207658_10046760 Ga0207658_100467602 113
347 3300025986 Ga0207658_11016682 Ga0207658_110166821 113
348 3300026023 Ga0207677_10000024 Ga0207677_10000024127 113
349 3300026023 Ga0207677_10000606 Ga0207677_1000060625 113
350 3300026035 Ga0207703_10003929 Ga0207703_1000392913 113
351 3300026035 Ga0207703_10349645 Ga0207703_103496452 113
352 3300026041 Ga0207639_10058572 Ga0207639_100585722 113
353 3300026041 Ga0207639_10255233 Ga0207639_102552331 113
354 3300026067 Ga0207678_10787742 Ga0207678_107877422 113
355 3300026067 Ga0207678_11373642 Ga0207678_113736422 113
356 3300026088 Ga0207641_10004167 Ga0207641_1000416718 113
357 3300026089 Ga0207648_10000838 Ga0207648_1000083811 113
358 3300026089 Ga0207648_10036826 Ga0207648_100368264 113
359 3300026095 Ga0207676_10001202 Ga0207676_100012022 113
360 3300026116 Ga0207674_10000899 Ga0207674_100008993 113
361 3300026116 Ga0207674_10024788 Ga0207674_100247888 113
362 3300026116 Ga0207674_10340423 Ga0207674_103404234 113
363 3300026118 Ga0207675_100072458 Ga0207675_1000724583 113
364 3300026118 Ga0207675_101311553 Ga0207675_1013115532 113
365 3300026121 Ga0207683_10034323 Ga0207683_100343235 113
366 3300026142 Ga0207698_10000760 Ga0207698_100007606 113
367 3300026142 Ga0207698_10218291 Ga0207698_102182914 113
368 3300026142 Ga0207698_11949247 Ga0207698_119492471 113
369 3300027471 Ga0209995_1051649 Ga0209995_10516491 113
370 3300027876 Ga0209974_10001653 Ga0209974_100016537 113
371 3300028379 Ga0268266_10000315 Ga0268266_1000031579 113
372 3300028379 Ga0268266_10044185 Ga0268266_100441854 113
373 3300028379 Ga0268266_10051783 Ga0268266_100517834 113
374 3300028380 Ga0268265_10142184 Ga0268265_101421845 113
375 3300028380 Ga0268265_10181178 Ga0268265_101811783 113
376 3300028381 Ga0268264_10007677 Ga0268264_1000767712 113
377 3300028381 Ga0268264_10683527 Ga0268264_106835272 113
378 3300031548 Ga0307408_100044872 Ga0307408_1000448723 113
379 3300031548 Ga0307408_100313754 Ga0307408_1003137542 113
380 3300031548 Ga0307408_100403622 Ga0307408_1004036222 113
381 3300031548 Ga0307408_100987635 Ga0307408_1009876352 113
382 3300031548 Ga0307408_101012025 Ga0307408_1010120252 113
383 3300031731 Ga0307405_10015446 Ga0307405_100154465 113
384 3300031731 Ga0307405_10161465 Ga0307405_101614653 113
385 3300031731 Ga0307405_10259920 Ga0307405_102599202 113
386 3300031824 Ga0307413_10004731 Ga0307413_100047318 113
387 3300031824 Ga0307413_10030161 Ga0307413_100301615 113
388 3300031824 Ga0307413_10206867 Ga0307413_102068671 113
389 3300031824 Ga0307413_10214863 Ga0307413_102148633 113
390 3300031824 Ga0307413_10243021 Ga0307413_102430212 113
391 3300031824 Ga0307413_10330131 Ga0307413_103301313 113
392 3300031824 Ga0307413_10725959 Ga0307413_107259591 113
393 3300031824 Ga0307413_11200665 Ga0307413_112006651 113
394 3300031852 Ga0307410_10014964 Ga0307410_100149645 113
395 3300031852 Ga0307410_10059045 Ga0307410_100590452 113
396 3300031852 Ga0307410_10108246 Ga0307410_101082462 113
397 3300031852 Ga0307410_10982189 Ga0307410_109821891 113
398 3300031901 Ga0307406_10054163 Ga0307406_100541632 113
399 3300031901 Ga0307406_10094196 Ga0307406_100941963 113
400 3300031901 Ga0307406_10099873 Ga0307406_100998733 113
401 3300031901 Ga0307406_10129365 Ga0307406_101293654 113
402 3300031901 Ga0307406_10527027 Ga0307406_105270272 113
403 3300031901 Ga0307406_10662408 Ga0307406_106624081 113
404 3300031901 Ga0307406_11188414 Ga0307406_111884141 113
405 3300031903 Ga0307407_10004272 Ga0307407_100042725 113
406 3300031903 Ga0307407_10043439 Ga0307407_100434394 113
407 3300031903 Ga0307407_10192540 Ga0307407_101925402 113
408 3300031911 Ga0307412_10169174 Ga0307412_101691742 113
409 3300031911 Ga0307412_10438203 Ga0307412_104382032 113
410 3300031911 Ga0307412_11282208 Ga0307412_112822081 113
411 3300031911 Ga0307412_11623012 Ga0307412_116230121 113
412 3300031995 Ga0307409_100008505 Ga0307409_1000085059 113
413 3300031995 Ga0307409_100011473 Ga0307409_1000114738 113
414 3300031995 Ga0307409_100026353 Ga0307409_1000263537 113
415 3300031995 Ga0307409_100055674 Ga0307409_1000556745 113
416 3300031995 Ga0307409_100098685 Ga0307409_1000986855 113
417 3300031995 Ga0307409_100811370 Ga0307409_1008113702 113
418 3300032002 Ga0307416_100042481 Ga0307416_1000424812 113
419 3300032002 Ga0307416_100054472 Ga0307416_1000544723 113
420 3300032002 Ga0307416_100134943 Ga0307416_1001349434 113
421 3300032002 Ga0307416_100238014 Ga0307416_1002380143 113
422 3300032002 Ga0307416_100268813 Ga0307416_1002688133 113
423 3300032004 Ga0307414_10044109 Ga0307414_100441095 113
424 3300032004 Ga0307414_10055807 Ga0307414_100558072 113
425 3300032004 Ga0307414_10151242 Ga0307414_101512424 113
426 3300032004 Ga0307414_10362825 Ga0307414_103628253 113
427 3300032004 Ga0307414_11071888 Ga0307414_110718882 113
428 3300032004 Ga0307414_11656544 Ga0307414_116565442 113
429 3300032005 Ga0307411_10023919 Ga0307411_100239194 113
430 3300032005 Ga0307411_10044420 Ga0307411_100444205 113
431 3300032005 Ga0307411_10073141 Ga0307411_100731414 113
432 3300032005 Ga0307411_10089472 Ga0307411_100894724 113
433 3300032005 Ga0307411_10857181 Ga0307411_108571811 113
434 3300032005 Ga0307411_11826970 Ga0307411_118269702 113
435 3300032126 Ga0307415_100005203 Ga0307415_1000052036 113
436 3300032126 Ga0307415_100033799 Ga0307415_1000337994 113
437 3300032126 Ga0307415_100039698 Ga0307415_1000396983 113
438 3300032126 Ga0307415_100210268 Ga0307415_1002102682 113
439 3300037312 Ga0395899_0062096 Ga0395899_0062096_343_684 113
440 3300037312 Ga0395899_0325202 Ga0395899_0325202_476_817 113
441 3300037418 Ga0395900_0011557 Ga0395900_0011557_3857_4198 113
442 3300037418 Ga0395900_0045518 Ga0395900_0045518_854_1195 113
443 3300037418 Ga0395900_0084615 Ga0395900_0084615_2599_2982 113
444 3300037418 Ga0395900_0142421 Ga0395900_0142421_1133_1474 113
445 3300037418 Ga0395900_0818525 Ga0395900_0818525_495_836 113
446 3300037466 Ga0395898_0004993 Ga0395898_0004993_3813_4154 113
447 3300037466 Ga0395898_0056828 Ga0395898_0056828_2388_2771 113
448 3300037466 Ga0395898_0483334 Ga0395898_0483334_238_579 113
449 3300037471 Ga0395905_0013658 Ga0395905_0013658_3533_3874 113
450 3300037471 Ga0395905_0017889 Ga0395905_0017889_3653_4036 113
451 3300037471 Ga0395905_0091320 Ga0395905_0091320_879_1220 113
452 3300037471 Ga0395905_0139472 Ga0395905_0139472_871_1212 113
453 3300037471 Ga0395905_0148042 Ga0395905_0148042_265_624 113
454 3300037471 Ga0395905_0206607 Ga0395905_0206607_1419_1760 113
455 3300037471 Ga0395905_0731194 Ga0395905_0731194_41_382 113
456 3300037471 Ga0395905_1334595 Ga0395905_1334595_130_477 113
457 3300038443 Ga0395901_0040376 Ga0395901_0040376_446_829 113
458 3300038443 Ga0395901_0075162 Ga0395901_0075162_2310_2651 113
459 3300038443 Ga0395901_0208699 Ga0395901_0208699_610_951 113
460 3300038443 Ga0395901_0311589 Ga0395901_0311589_1119_1466 113
461 3300038443 Ga0395901_1499536 Ga0395901_1499536_93_434 113
462 3300039437 Ga0436365_0332274 Ga0436365_0332274_302_643 113
463 3300041404 Ga0439436_0114307 Ga0439436_0114307_163_504 113
464 3300041406 Ga0439439_0101842 Ga0439439_0101842_56_397 113
465 3300042000 Ga0439437_020195 Ga0439437_020195_154_495 113
466 3300042185 Ga0450909_040789 Ga0450909_040789_307_648 113
467 3300042435 Ga0439434_0122246 Ga0439434_0122246_237_578 113
468 3300048908 Ga0496105_1061753 Ga0496105_1061753_90_431 113
469 3300048914 Ga0496111_0915146 Ga0496111_0915146_215_556 113
470 3300048918 Ga0496115_0535718 Ga0496115_0535718_102_446 113

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

13

63

0.98

PF01022

HTH_5

Bacterial regulatory protein, arsR family

15

63

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j05-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9625 1 87
8iuh-assembly1.cif.gz_P rna polymerase iii pre-initiation complex open complex 1 0.9495 18 75
2dk5-assembly1.cif.gz_A solution structure of winged-helix domain in rna polymerase iii 39kda polypeptide 0.9275 15 75
6j05-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9212 1 87
2oqg-assembly1.cif.gz_D arsr-like transcriptional regulator from rhodococcus sp. rha1 0.9209 4 89
ID Description Score Start End Superfamily
af_P91529_82_146_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9788 15 75 1.10.10.10
af_Q69XJ1_51_114_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9754 15 74 1.10.10.10
af_P32910_88_152_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9723 17 75 1.10.10.10
af_O94553_84_149_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9695 15 75 1.10.10.10
af_Q9VD25_77_142_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9678 15 75 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A530K0I7-F1-model_v4 Helix-turn-helix transcriptional regulator 1.002 1 84 GO:0003700
AF-A0A212JDE4-F1-model_v4 Transcriptional regulator, ArsR family, putative (Modular protein) 1 2 89 GO:0003700
AF-A0A1Q3KJB1-F1-model_v4 Transcriptional regulator 0.9977 1 89 GO:0003700
AF-A0A7R6ZWG1-F1-model_v4 Transcriptional regulator 0.9944 1 89 GO:0003700
AF-A0A7V6PBP3-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9912 1 86 GO:0003700

Feature Viewer

pLDDT pTM Quality
86.26 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map