F450433

General Info

Members Datasets Scaffolds Average Seq Length
470 213 940 124

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_101086705|Ga0307408_1010867051
Length 146
Sequence MEAKSEPGAVATGFRPGEPEDLVMRRNLALKNTEVPARALRIEKAAETVSGELDKVIHERMRLGIISALAANEKVSFTDLKKLLNTTDGNISVHARKLEDAGYVTCEKSFRGRTPLTEYAITKDGKKALERYLNHMEALIRAMKNV

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
148 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
162 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
163 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
164 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
165 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
166 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
197 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
198 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
199 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.43
Rhizosphere 99.15
Stem 0
Stem Tuber 0
Unclassified 33.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_101086705 3300031548 Bacteria 741
2 JGI24751J29686_10003408 3300002459 Bacteria 3204
3 Ga0065715_10269993 3300005293 Bacteria 1114
4 Ga0065715_10425440 3300005293 Unclassified 853
5 Ga0065715_10499754 3300005293 Unclassified 781
6 Ga0070658_10005497 3300005327 Bacteria 10286
7 Ga0070683_100682221 3300005329 Bacteria 984
8 Ga0070690_100152369 3300005330 Bacteria 1578
9 Ga0070690_100396546 3300005330 Bacteria 1012
10 Ga0070690_101284263 3300005330 Unclassified 586
11 Ga0070670_100008609 3300005331 Bacteria 8707
12 Ga0070670_100021378 3300005331 Bacteria 5567
13 Ga0070670_100170481 3300005331 Unclassified 1888
14 Ga0070677_10100339 3300005333 Unclassified 1275
15 Ga0070677_10167834 3300005333 Bacteria 1035
16 Ga0070677_10225377 3300005333 Bacteria 918
17 Ga0068869_100239798 3300005334 Unclassified 1444
18 Ga0068869_100880129 3300005334 Bacteria 774
19 Ga0070666_10019946 3300005335 Bacteria 4331
20 Ga0070666_10089678 3300005335 Bacteria 2111
21 Ga0070666_10493596 3300005335 Bacteria 887
22 Ga0070682_100320771 3300005337 Unclassified 1144
23 Ga0070682_100784852 3300005337 Unclassified 772
24 Ga0070682_101953373 3300005337 Bacteria 515
25 Ga0070660_101245577 3300005339 Unclassified 631
26 Ga0070689_100039237 3300005340 Bacteria 3626
27 Ga0070689_100411847 3300005340 Bacteria 1144
28 Ga0070687_100824615 3300005343 Bacteria 659
29 Ga0070687_101433762 3300005343 Bacteria 517
30 Ga0070661_100126819 3300005344 Bacteria 1915
31 Ga0070661_100234134 3300005344 Unclassified 1412
32 Ga0070661_100615516 3300005344 Bacteria 879
33 Ga0070668_100272030 3300005347 Unclassified 1412
34 Ga0070668_101066344 3300005347 Bacteria 728
35 Ga0070669_101028260 3300005353 Bacteria 708
36 Ga0070675_100235644 3300005354 Unclassified 1598
37 Ga0070675_100434118 3300005354 Bacteria 1176
38 Ga0070675_101686740 3300005354 Bacteria 585
39 Ga0070671_100201197 3300005355 Bacteria 1689
40 Ga0070671_100351655 3300005355 Unclassified 1258
41 Ga0070671_101421460 3300005355 Unclassified 613
42 Ga0070674_100102779 3300005356 Unclassified 2085
43 Ga0070674_100739664 3300005356 Bacteria 844
44 Ga0070674_101172444 3300005356 Unclassified 681
45 Ga0070673_100083368 3300005364 Bacteria 2597
46 Ga0070673_101119724 3300005364 Bacteria 736
47 Ga0070659_100037438 3300005366 Unclassified 3782
48 Ga0070659_100917071 3300005366 Bacteria 766
49 Ga0070659_101126111 3300005366 Bacteria 692
50 Ga0070667_100787123 3300005367 Bacteria 883
51 Ga0070667_101612794 3300005367 Bacteria 610
52 Ga0070667_102261381 3300005367 Unclassified 512
53 Ga0070711_101319645 3300005439 Bacteria 626
54 Ga0070700_100281407 3300005441 Bacteria 1206
55 Ga0070700_100358851 3300005441 Bacteria 1083
56 Ga0070663_100565274 3300005455 Unclassified 952
57 Ga0070678_100700958 3300005456 Unclassified 912
58 Ga0070678_101943573 3300005456 Unclassified 556
59 Ga0070662_100018102 3300005457 Unclassified 4761
60 Ga0070662_100139130 3300005457 Bacteria 1880
61 Ga0070681_10032278 3300005458 Bacteria 5254
62 Ga0070681_10079612 3300005458 Bacteria 3233
63 Ga0070681_10153546 3300005458 Unclassified 2228
64 Ga0070681_11337739 3300005458 Unclassified 639
65 Ga0068867_100361061 3300005459 Bacteria 1215
66 Ga0068867_100609507 3300005459 Unclassified 953
67 Ga0068867_101292029 3300005459 Unclassified 673
68 Ga0070685_10014320 3300005466 Bacteria 4199
69 Ga0070698_100747044 3300005471 Bacteria 921
70 Ga0070698_100767128 3300005471 Unclassified 908
71 Ga0070699_101458044 3300005518 Unclassified 628
72 Ga0070679_100117371 3300005530 Unclassified 2646
73 Ga0070679_100173496 3300005530 Bacteria 2129
74 Ga0070679_100352710 3300005530 Bacteria 1419
75 Ga0070684_100133472 3300005535 Unclassified 2241
76 Ga0070684_100449288 3300005535 Bacteria 1191
77 Ga0068853_100002825 3300005539 Bacteria 13153
78 Ga0068853_100055831 3300005539 Unclassified 3404
79 Ga0068853_100360454 3300005539 Viruses 1354
80 Ga0068853_100386506 3300005539 Bacteria 1308
81 Ga0070686_100210248 3300005544 Bacteria 1400
82 Ga0070695_100328569 3300005545 Bacteria 1139
83 Ga0070693_100381656 3300005547 Bacteria 972
84 Ga0070665_100243244 3300005548 Bacteria 1800
85 Ga0070665_102008802 3300005548 Bacteria 583
86 Ga0070704_102086739 3300005549 Unclassified 527
87 Ga0068855_100069628 3300005563 Bacteria 4094
88 Ga0068855_100177265 3300005563 Unclassified 2411
89 Ga0070664_100014884 3300005564 Bacteria 6345
90 Ga0070664_100287099 3300005564 Bacteria 1485
91 Ga0070664_100707315 3300005564 Bacteria 939
92 Ga0070664_101292625 3300005564 Bacteria 689
93 Ga0068857_100053686 3300005577 Bacteria 3575
94 Ga0068857_100063636 3300005577 Unclassified 3279
95 Ga0068857_100250723 3300005577 Unclassified 1623
96 Ga0068857_100816897 3300005577 Bacteria 891
97 Ga0068857_101120941 3300005577 Bacteria 760
98 Ga0068854_100083944 3300005578 Unclassified 2356
99 Ga0068854_100596915 3300005578 Bacteria 942
100 Ga0068854_100693048 3300005578 Bacteria 878
101 Ga0068856_100018706 3300005614 Bacteria 6715
102 Ga0068852_100586737 3300005616 Unclassified 1118
103 Ga0068852_102557764 3300005616 Bacteria 530
104 Ga0068859_100020602 3300005617 Bacteria 6617
105 Ga0068859_100183376 3300005617 Bacteria 2176
106 Ga0068859_100200690 3300005617 Unclassified 2079
107 Ga0068859_100308181 3300005617 Bacteria 1677
108 Ga0068859_102024965 3300005617 Bacteria 636
109 Ga0068859_102582777 3300005617 Bacteria 559
110 Ga0068864_100006093 3300005618 Bacteria 9891
111 Ga0068864_100109393 3300005618 Bacteria 2460
112 Ga0068864_100155500 3300005618 Bacteria 2075
113 Ga0068864_100512202 3300005618 Viruses 1156
114 Ga0068864_100587665 3300005618 Bacteria 1079
115 Ga0068864_101590691 3300005618 Bacteria 657
116 Ga0068864_101773862 3300005618 Bacteria 622
117 Ga0068861_100108046 3300005719 Unclassified 2225
118 Ga0068861_100387478 3300005719 Unclassified 1236
119 Ga0068851_10361466 3300005834 Unclassified 847
120 Ga0068870_10537440 3300005840 Unclassified 785
121 Ga0068870_10690872 3300005840 Unclassified 703
122 Ga0068863_100119730 3300005841 Unclassified 2509
123 Ga0068863_100322206 3300005841 Bacteria 1501
124 Ga0068863_100722116 3300005841 Unclassified 991
125 Ga0068863_101521265 3300005841 Bacteria 678
126 Ga0068860_100380099 3300005843 Unclassified 1394
127 Ga0068860_100722677 3300005843 Bacteria 1006
128 Ga0068860_101284100 3300005843 Bacteria 753
129 Ga0068860_102087039 3300005843 Bacteria 588
130 Ga0068862_100181640 3300005844 Bacteria 1888
131 Ga0068862_101030272 3300005844 Unclassified 815
132 Ga0068862_101734262 3300005844 Unclassified 633
133 Ga0097621_100259714 3300006237 Bacteria 1523
134 Ga0097621_101079444 3300006237 Bacteria 753
135 Ga0097621_101312799 3300006237 Bacteria 683
136 Ga0068871_100255523 3300006358 Bacteria 1527
137 Ga0068871_100499197 3300006358 Bacteria 1096
138 Ga0068871_101117774 3300006358 Unclassified 737
139 Ga0075428_100777900 3300006844 Unclassified 1018
140 Ga0075428_100957088 3300006844 Bacteria 907
141 Ga0075430_100162204 3300006846 Bacteria 1861
142 Ga0075431_100297236 3300006847 Unclassified 1632
143 Ga0075431_100778732 3300006847 Bacteria 931
144 Ga0075434_101453455 3300006871 Unclassified 695
145 Ga0097620_100020602 3300006931 Bacteria 6617
146 Ga0097620_100183395 3300006931 Bacteria 2176
147 Ga0097620_100200686 3300006931 Unclassified 2079
148 Ga0097620_100308170 3300006931 Bacteria 1677
149 Ga0097620_102025010 3300006931 Bacteria 636
150 Ga0097620_102581853 3300006931 Bacteria 559
151 Ga0099794_10017871 3300007265 Unclassified 3169
152 Ga0105251_10132631 3300009011 Bacteria 1129
153 Ga0105240_10125689 3300009093 Bacteria 3082
154 Ga0105240_10160855 3300009093 Bacteria 2667
155 Ga0105240_10372997 3300009093 Unclassified 1613
156 Ga0111539_10027807 3300009094 Bacteria 6907
157 Ga0111539_10208832 3300009094 Bacteria 2275
158 Ga0111539_10281020 3300009094 Bacteria 1937
159 Ga0111539_10537215 3300009094 Bacteria 1362
160 Ga0111539_10713612 3300009094 Bacteria 1167
161 Ga0111539_11000840 3300009094 Unclassified 972
162 Ga0105247_10402285 3300009101 Bacteria 976
163 Ga0105247_11675783 3300009101 Bacteria 525
164 Ga0114129_11394421 3300009147 Bacteria 865
165 Ga0114129_13003471 3300009147 Bacteria 555
166 Ga0114129_13409723 3300009147 Unclassified 511
167 Ga0105242_10227005 3300009176 Bacteria 1672
168 Ga0105242_11507667 3300009176 Bacteria 703
169 Ga0105242_11539361 3300009176 Bacteria 697
170 Ga0105242_12596076 3300009176 Bacteria 556
171 Ga0105248_10033530 3300009177 Bacteria 5737
172 Ga0105248_10146306 3300009177 Viruses 2666
173 Ga0105248_10374698 3300009177 Bacteria 1602
174 Ga0105237_10070789 3300009545 Unclassified 3483
175 Ga0105237_10306781 3300009545 Unclassified 1590
176 Ga0105238_10054990 3300009551 Bacteria 3996
177 Ga0105249_10011220 3300009553 Bacteria 7868
178 Ga0105249_10020238 3300009553 Bacteria 5948
179 Ga0105249_10122822 3300009553 Bacteria 2470
180 Ga0105249_10627389 3300009553 Bacteria 1131
181 Ga0105249_10812985 3300009553 Bacteria 999
182 Ga0105239_10700344 3300010375 Unclassified 1158
183 Ga0105246_10420432 3300011119 Bacteria 1115
184 Ga0105246_10732298 3300011119 Unclassified 870
185 Ga0157373_10413527 3300013100 Bacteria 968
186 Ga0157373_11400271 3300013100 Unclassified 532
187 Ga0157370_10625205 3300013104 Bacteria 985
188 Ga0157370_10950473 3300013104 Unclassified 779
189 Ga0157369_10120738 3300013105 Unclassified 2781
190 Ga0157369_10153948 3300013105 Bacteria 2429
191 Ga0157369_10557210 3300013105 Bacteria 1184
192 Ga0157374_10105779 3300013296 Unclassified 2703
193 Ga0157374_10140471 3300013296 Bacteria 2344
194 Ga0157378_10136499 3300013297 Bacteria 2275
195 Ga0157378_10385378 3300013297 Bacteria 1377
196 Ga0157378_10557122 3300013297 Bacteria 1152
197 Ga0157378_10903617 3300013297 Unclassified 914
198 Ga0163162_10089716 3300013306 Bacteria 3155
199 Ga0163162_10139668 3300013306 Viruses 2535
200 Ga0163162_10316053 3300013306 Bacteria 1694
201 Ga0163162_10332913 3300013306 Bacteria 1651
202 Ga0163162_10659054 3300013306 Unclassified 1170
203 Ga0163162_10746279 3300013306 Bacteria 1098
204 Ga0163162_12212376 3300013306 Unclassified 631
205 Ga0163162_12683449 3300013306 Bacteria 573
206 Ga0157372_10114789 3300013307 Bacteria 3087
207 Ga0157372_10146656 3300013307 Unclassified 2721
208 Ga0157372_10237046 3300013307 Unclassified 2116
209 Ga0157372_10302473 3300013307 Unclassified 1860
210 Ga0157372_10405042 3300013307 Bacteria 1589
211 Ga0157375_10080583 3300013308 Unclassified 3294
212 Ga0157375_10172774 3300013308 Bacteria 2309
213 Ga0157375_10206091 3300013308 Bacteria 2123
214 Ga0157375_11112607 3300013308 Bacteria 925
215 Ga0163163_10012383 3300014325 Bacteria 7770
216 Ga0163163_10147797 3300014325 Bacteria 2394
217 Ga0163163_11136453 3300014325 Bacteria 844
218 Ga0163163_11976282 3300014325 Bacteria 643
219 Ga0157380_10017679 3300014326 Bacteria 5280
220 Ga0157380_10259881 3300014326 Bacteria 1576
221 Ga0157380_10713452 3300014326 Unclassified 1009
222 Ga0157377_10935536 3300014745 Bacteria 651
223 Ga0157376_10142344 3300014969 Bacteria 2153
224 Ga0157376_10212406 3300014969 Bacteria 1787
225 Ga0157376_10275224 3300014969 Bacteria 1583
226 Ga0157376_11689588 3300014969 Bacteria 668
227 Ga0163161_10001884 3300017792 Bacteria 15300
228 Ga0163161_10119265 3300017792 Bacteria 1981
229 Ga0163161_10184802 3300017792 Bacteria 1600
230 Ga0163161_10797560 3300017792 Unclassified 793
231 Ga0207682_10180128 3300025893 Unclassified 965
232 Ga0207710_10179339 3300025900 Bacteria 1039
233 Ga0207688_10070846 3300025901 Unclassified 1978
234 Ga0207680_10107116 3300025903 Bacteria 1806
235 Ga0207645_11003495 3300025907 Bacteria 565
236 Ga0207643_10026896 3300025908 Bacteria 3188
237 Ga0207643_10538451 3300025908 Bacteria 748
238 Ga0207705_10117195 3300025909 Unclassified 1972
239 Ga0207707_10006100 3300025912 Bacteria 10539
240 Ga0207707_10157093 3300025912 Unclassified 1989
241 Ga0207695_10453848 3300025913 Bacteria 1165
242 Ga0207695_10469890 3300025913 Unclassified 1140
243 Ga0207695_10895704 3300025913 Bacteria 767
244 Ga0207671_10474673 3300025914 Unclassified 997
245 Ga0207660_10231138 3300025917 Unclassified 1454
246 Ga0207657_10027104 3300025919 Bacteria 5253
247 Ga0207649_10312432 3300025920 Unclassified 1152
248 Ga0207649_10314547 3300025920 Bacteria 1149
249 Ga0207649_10876352 3300025920 Bacteria 703
250 Ga0207652_10144667 3300025921 Bacteria 2127
251 Ga0207652_10148150 3300025921 Unclassified 2101
252 Ga0207681_10379735 3300025923 Bacteria 1137
253 Ga0207681_10446498 3300025923 Unclassified 1052
254 Ga0207694_10118792 3300025924 Bacteria 2109
255 Ga0207650_10242353 3300025925 Unclassified 1457
256 Ga0207650_10598458 3300025925 Unclassified 927
257 Ga0207650_10701200 3300025925 Unclassified 855
258 Ga0207659_10138654 3300025926 Bacteria 1886
259 Ga0207659_10226111 3300025926 Unclassified 1507
260 Ga0207659_10466341 3300025926 Unclassified 1065
261 Ga0207659_11289431 3300025926 Unclassified 627
262 Ga0207687_10999808 3300025927 Unclassified 717
263 Ga0207644_10990967 3300025931 Bacteria 705
264 Ga0207706_10142422 3300025933 Unclassified 2109
265 Ga0207706_10147020 3300025933 Unclassified 2073
266 Ga0207706_10981765 3300025933 Bacteria 710
267 Ga0207669_10306455 3300025937 Unclassified 1209
268 Ga0207691_10104474 3300025940 Bacteria 2525
269 Ga0207691_10175796 3300025940 Unclassified 1873
270 Ga0207711_10024006 3300025941 Bacteria 5103
271 Ga0207711_10253867 3300025941 Bacteria 1615
272 Ga0207711_10447409 3300025941 Viruses 1202
273 Ga0207689_10816933 3300025942 Unclassified 787
274 Ga0207661_11242312 3300025944 Unclassified 685
275 Ga0207679_10006240 3300025945 Bacteria 7522
276 Ga0207679_10366070 3300025945 Unclassified 1260
277 Ga0207679_10502170 3300025945 Bacteria 1082
278 Ga0207679_10755401 3300025945 Bacteria 885
279 Ga0207679_11366062 3300025945 Unclassified 650
280 Ga0207651_10793801 3300025960 Bacteria 839
281 Ga0207712_10081198 3300025961 Bacteria 2360
282 Ga0207712_10114031 3300025961 Bacteria 2032
283 Ga0207668_10373329 3300025972 Unclassified 1198
284 Ga0207668_11111321 3300025972 Bacteria 709
285 Ga0207640_10138878 3300025981 Unclassified 1768
286 Ga0207640_10542176 3300025981 Bacteria 976
287 Ga0207640_10570789 3300025981 Bacteria 953
288 Ga0207658_10029438 3300025986 Bacteria 3879
289 Ga0207658_11657823 3300025986 Bacteria 584
290 Ga0207658_12090024 3300025986 Unclassified 515
291 Ga0207677_12045633 3300026023 Unclassified 532
292 Ga0207703_10118201 3300026035 Bacteria 2272
293 Ga0207703_10225414 3300026035 Bacteria 1678
294 Ga0207639_10003157 3300026041 Bacteria 11082
295 Ga0207639_10113584 3300026041 Bacteria 2212
296 Ga0207639_11312766 3300026041 Unclassified 679
297 Ga0207639_11681397 3300026041 Bacteria 595
298 Ga0207678_10701095 3300026067 Unclassified 891
299 Ga0207678_11443016 3300026067 Unclassified 608
300 Ga0207678_11583409 3300026067 Unclassified 577
301 Ga0207708_11283515 3300026075 Bacteria 641
302 Ga0207702_10057529 3300026078 Bacteria 3305
303 Ga0207641_10093860 3300026088 Bacteria 2630
304 Ga0207641_11257129 3300026088 Bacteria 740
305 Ga0207641_11507843 3300026088 Bacteria 674
306 Ga0207648_10077581 3300026089 Bacteria 2896
307 Ga0207648_11133952 3300026089 Unclassified 734
308 Ga0207676_10014888 3300026095 Bacteria 5602
309 Ga0207676_10343896 3300026095 Bacteria 1377
310 Ga0207676_10618142 3300026095 Bacteria 1042
311 Ga0207676_11210066 3300026095 Unclassified 749
312 Ga0207674_10011650 3300026116 Bacteria 9872
313 Ga0207674_10059239 3300026116 Bacteria 3875
314 Ga0207674_10533358 3300026116 Unclassified 1134
315 Ga0207674_10590878 3300026116 Bacteria 1072
316 Ga0207675_100125349 3300026118 Bacteria 2433
317 Ga0207675_100143950 3300026118 Bacteria 2266
318 Ga0207675_100165040 3300026118 Unclassified 2115
319 Ga0207675_100974759 3300026118 Bacteria 866
320 Ga0207675_101180909 3300026118 Unclassified 785
321 Ga0207675_101996218 3300026118 Unclassified 598
322 Ga0207683_10032647 3300026121 Unclassified 4523
323 Ga0207683_10383441 3300026121 Unclassified 1292
324 Ga0207683_10456023 3300026121 Unclassified 1179
325 Ga0268266_11144406 3300028379 Bacteria 753
326 Ga0268265_10158715 3300028380 Bacteria 1918
327 Ga0268265_12254640 3300028380 Unclassified 551
328 Ga0268264_11230466 3300028381 Bacteria 758
329 Ga0307408_100041068 3300031548 Unclassified 3278
330 Ga0307408_100373232 3300031548 Bacteria 1217
331 Ga0307408_101437386 3300031548 Bacteria 650
332 Ga0307408_101438817 3300031548 Bacteria 650
333 Ga0307405_10015233 3300031731 Bacteria 4159
334 Ga0307405_10269894 3300031731 Bacteria 1275
335 Ga0307405_10971838 3300031731 Bacteria 723
336 Ga0307413_10013822 3300031824 Bacteria 4077
337 Ga0307413_10026228 3300031824 Bacteria 3208
338 Ga0307413_10046973 3300031824 Unclassified 2571
339 Ga0307410_10022639 3300031852 Unclassified 3888
340 Ga0307410_10027719 3300031852 Bacteria 3583
341 Ga0307410_10057440 3300031852 Bacteria 2650
342 Ga0307410_10194587 3300031852 Bacteria 1544
343 Ga0307410_11261983 3300031852 Bacteria 645
344 Ga0307406_10054985 3300031901 Unclassified 2543
345 Ga0307406_10351466 3300031901 Bacteria 1152
346 Ga0307406_11058973 3300031901 Bacteria 698
347 Ga0307406_11759852 3300031901 Bacteria 550
348 Ga0307407_10002996 3300031903 Bacteria 6785
349 Ga0307407_10079429 3300031903 Bacteria 1979
350 Ga0307407_10087506 3300031903 Bacteria 1901
351 Ga0307407_10308161 3300031903 Bacteria 1107
352 Ga0307412_10499339 3300031911 Unclassified 1012
353 Ga0307412_10502960 3300031911 Bacteria 1009
354 Ga0307412_11020517 3300031911 Bacteria 732
355 Ga0307409_100004161 3300031995 Bacteria 8058
356 Ga0307409_100004989 3300031995 Bacteria 7555
357 Ga0307409_100051428 3300031995 Bacteria 3153
358 Ga0307409_100284939 3300031995 Bacteria 1529
359 Ga0307409_100320008 3300031995 Bacteria 1451
360 Ga0307409_100706208 3300031995 Bacteria 1008
361 Ga0307409_100789624 3300031995 Bacteria 956
362 Ga0307409_101230823 3300031995 Bacteria 772
363 Ga0307409_102694081 3300031995 Unclassified 525
364 Ga0307416_100092610 3300032002 Bacteria 2600
365 Ga0307416_100100839 3300032002 Unclassified 2512
366 Ga0307416_100101112 3300032002 Bacteria 2510
367 Ga0307416_100632308 3300032002 Bacteria 1153
368 Ga0307416_100741688 3300032002 Unclassified 1074
369 Ga0307416_100800037 3300032002 Bacteria 1038
370 Ga0307416_102463529 3300032002 Unclassified 619
371 Ga0307414_10009698 3300032004 Bacteria 5547
372 Ga0307414_10446478 3300032004 Bacteria 1133
373 Ga0307414_10866827 3300032004 Bacteria 826
374 Ga0307414_11055987 3300032004 Bacteria 749
375 Ga0307411_10005790 3300032005 Bacteria 6118
376 Ga0307411_10038954 3300032005 Bacteria 3003
377 Ga0307411_10313486 3300032005 Bacteria 1263
378 Ga0307411_10531629 3300032005 Unclassified 1000
379 Ga0307415_100003050 3300032126 Bacteria 8448
380 Ga0307415_100020405 3300032126 Bacteria 4047
381 Ga0307415_100075207 3300032126 Bacteria 2390
382 Ga0307415_100329176 3300032126 Bacteria 1277
383 Ga0307415_101432413 3300032126 Unclassified 659
384 Ga0307415_101534930 3300032126 Unclassified 638
385 Ga0307415_101815611 3300032126 Bacteria 590
386 Ga0373926_0214371 3300035083 Bacteria 743
387 Ga0373945_0117180 3300035116 Bacteria 1056
388 Ga0373945_0558242 3300035116 Unclassified 514
389 Ga0373956_0334262 3300035119 Bacteria 722
390 Ga0373957_0523847 3300035120 Unclassified 517
391 Ga0373943_0203557 3300035170 Bacteria 1096
392 Ga0316574_0146324 3300035398 Bacteria 1523
393 Ga0373935_0743666 3300035692 Unclassified 722
394 Ga0373927_0387882 3300035695 Bacteria 921
395 Ga0373947_0467113 3300035725 Bacteria 855
396 Ga0373937_0035023 3300036401 Bacteria 4567
397 Ga0373925_0246858 3300037068 Unclassified 1431
398 Ga0395905_0135711 3300037471 Unclassified 2314
399 Ga0451837_1373532 3300041494 Unclassified 1100
400 Ga0451853_2712576 3300041512 Bacteria 702
401 Ga0439432_122271 3300042006 Unclassified 770
402 Ga0439449_0231715 3300042007 Bacteria 693
403 Ga0439449_0309421 3300042007 Unclassified 597
404 Ga0450889_030557 3300042144 Bacteria 629
405 Ga0439446_0248037 3300042156 Bacteria 613
406 Ga0439434_0274752 3300042435 Unclassified 579
407 Ga0439434_0373958 3300042435 Bacteria 500
408 Ga0439464_0230811 3300042439 Unclassified 595
409 Ga0466957_0830145 3300044842 Unclassified 658
410 Ga0495592_0723181 3300046454 Unclassified 597
411 Ga0495651_0179476 3300046462 Unclassified 1500
412 Ga0495582_0693677 3300046473 Unclassified 589
413 Ga0495628_0544198 3300046516 Bacteria 834
414 Ga0495630_0499051 3300046517 Bacteria 933
415 Ga0495674_0325732 3300047319 Bacteria 1251
416 Ga0495672_0271403 3300047320 Unclassified 814
417 Ga0496101_1386224 3300048904 Bacteria 549
418 Ga0496114_0272243 3300048917 Bacteria 1492
419 Ga0501031_0588405 3300049568 Unclassified 716
420 Ga0501032_0019131 3300049569 Bacteria 4791
421 Ga0501033_0007146 3300049570 Bacteria 8713
422 Ga0501034_0609522 3300049571 Bacteria 996
423 Ga0501036_0015330 3300049572 Bacteria 6401
424 Ga0501037_0096093 3300049573 Bacteria 2141
425 Ga0501038_0015386 3300049574 Bacteria 6955
426 Ga0501043_0008461 3300049579 Bacteria 8099
427 Ga0501046_0037463 3300049580 Bacteria 3896
428 Ga0501047_0022816 3300049581 Bacteria 6008
429 Ga0501048_0077107 3300049582 Bacteria 2352
430 Ga0501067_0054510 3300049583 Bacteria 2215
431 Ga0501068_0258068 3300049584 Bacteria 1111
432 Ga0501069_0075215 3300049585 Bacteria 1897
433 Ga0501070_0027081 3300049586 Bacteria 4808
434 Ga0501070_0157482 3300049586 Unclassified 1873
435 Ga0501072_0035548 3300049588 Bacteria 3903
436 Ga0501072_0108762 3300049588 Bacteria 2206
437 Ga0501073_0061276 3300049589 Bacteria 2625
438 Ga0501074_0010069 3300049590 Bacteria 6864
439 Ga0501076_0019159 3300049592 Bacteria 5225
440 Ga0501207_051339 3300049654 Bacteria 737
441 Ga0501230_126587 3300049667 Unclassified 569
442 Ga0501250_041532 3300049680 Bacteria 677
443 Ga0501225_0226380 3300049705 Bacteria 604
444 Ga0501079_0002413 3300049741 Bacteria 13556
445 Ga0501079_0924313 3300049741 Unclassified 687
446 Ga0501080_0719556 3300049742 Bacteria 879
447 Ga0501080_1849824 3300049742 Unclassified 506
448 Ga0501083_0090149 3300049744 Bacteria 2025
449 Ga0501035_0808278 3300049822 Bacteria 748
450 Ga0501044_0155137 3300049823 Bacteria 2269
451 nmdc:mga05p37_2180016_c1 3300050507 Unclassified 515
452 nmdc:mga09592_570114_c1 3300050508 Bacteria 971
453 nmdc:mga06r32_342972_c1 3300050510 Unclassified 1478
454 nmdc:mga06r32_669082_c1 3300050510 Bacteria 1005
455 nmdc:mga08y16_1854868_c1 3300050511 Unclassified 555
456 nmdc:mga08y16_416920_c1 3300050511 Bacteria 1373
457 nmdc:mga08y16_474165_c1 3300050511 Unclassified 1274
458 nmdc:mga08y16_607377_c1 3300050511 Unclassified 1102
459 nmdc:mga08y16_857703_c1 3300050511 Bacteria 897
460 nmdc:mga08y16_97638_c1 3300050511 Bacteria 3059
461 nmdc:mga0n895_1683225_c1 3300050512 Unclassified 597
462 nmdc:mga0n895_2012374_c1 3300050512 Unclassified 535
463 nmdc:mga0a205_981399_c1 3300050515 Bacteria 692
464 Ga0495601_0141954 3300053077 Bacteria 1567
465 Ga0495601_0300435 3300053077 Bacteria 1046
466 Ga0501084_0004582 3300054114 Bacteria 11301
467 Ga0501084_0127860 3300054114 Unclassified 2139
468 Ga0501082_0014566 3300060353 Bacteria 6772
469 Ga0501082_0231245 3300060353 Unclassified 1609
470 Ga0501082_1871403 3300060353 Unclassified 523
471 Ga0307408_101086705
472 JGI24751J29686_10003408
473 Ga0065715_10269993
474 Ga0065715_10425440
475 Ga0065715_10499754
476 Ga0070658_10005497
477 Ga0070683_100682221
478 Ga0070690_100152369
479 Ga0070690_100396546
480 Ga0070690_101284263
481 Ga0070670_100008609
482 Ga0070670_100021378
483 Ga0070670_100170481
484 Ga0070677_10100339
485 Ga0070677_10167834
486 Ga0070677_10225377
487 Ga0068869_100239798
488 Ga0068869_100880129
489 Ga0070666_10019946
490 Ga0070666_10089678
491 Ga0070666_10493596
492 Ga0070682_100320771
493 Ga0070682_100784852
494 Ga0070682_101953373
495 Ga0070660_101245577
496 Ga0070689_100039237
497 Ga0070689_100411847
498 Ga0070687_100824615
499 Ga0070687_101433762
500 Ga0070661_100126819
501 Ga0070661_100234134
502 Ga0070661_100615516
503 Ga0070668_100272030
504 Ga0070668_101066344
505 Ga0070669_101028260
506 Ga0070675_100235644
507 Ga0070675_100434118
508 Ga0070675_101686740
509 Ga0070671_100201197
510 Ga0070671_100351655
511 Ga0070671_101421460
512 Ga0070674_100102779
513 Ga0070674_100739664
514 Ga0070674_101172444
515 Ga0070673_100083368
516 Ga0070673_101119724
517 Ga0070659_100037438
518 Ga0070659_100917071
519 Ga0070659_101126111
520 Ga0070667_100787123
521 Ga0070667_101612794
522 Ga0070667_102261381
523 Ga0070711_101319645
524 Ga0070700_100281407
525 Ga0070700_100358851
526 Ga0070663_100565274
527 Ga0070678_100700958
528 Ga0070678_101943573
529 Ga0070662_100018102
530 Ga0070662_100139130
531 Ga0070681_10032278
532 Ga0070681_10079612
533 Ga0070681_10153546
534 Ga0070681_11337739
535 Ga0068867_100361061
536 Ga0068867_100609507
537 Ga0068867_101292029
538 Ga0070685_10014320
539 Ga0070698_100747044
540 Ga0070698_100767128
541 Ga0070699_101458044
542 Ga0070679_100117371
543 Ga0070679_100173496
544 Ga0070679_100352710
545 Ga0070684_100133472
546 Ga0070684_100449288
547 Ga0068853_100002825
548 Ga0068853_100055831
549 Ga0068853_100360454
550 Ga0068853_100386506
551 Ga0070686_100210248
552 Ga0070695_100328569
553 Ga0070693_100381656
554 Ga0070665_100243244
555 Ga0070665_102008802
556 Ga0070704_102086739
557 Ga0068855_100069628
558 Ga0068855_100177265
559 Ga0070664_100014884
560 Ga0070664_100287099
561 Ga0070664_100707315
562 Ga0070664_101292625
563 Ga0068857_100053686
564 Ga0068857_100063636
565 Ga0068857_100250723
566 Ga0068857_100816897
567 Ga0068857_101120941
568 Ga0068854_100083944
569 Ga0068854_100596915
570 Ga0068854_100693048
571 Ga0068856_100018706
572 Ga0068852_100586737
573 Ga0068852_102557764
574 Ga0068859_100020602
575 Ga0068859_100183376
576 Ga0068859_100200690
577 Ga0068859_100308181
578 Ga0068859_102024965
579 Ga0068859_102582777
580 Ga0068864_100006093
581 Ga0068864_100109393
582 Ga0068864_100155500
583 Ga0068864_100512202
584 Ga0068864_100587665
585 Ga0068864_101590691
586 Ga0068864_101773862
587 Ga0068861_100108046
588 Ga0068861_100387478
589 Ga0068851_10361466
590 Ga0068870_10537440
591 Ga0068870_10690872
592 Ga0068863_100119730
593 Ga0068863_100322206
594 Ga0068863_100722116
595 Ga0068863_101521265
596 Ga0068860_100380099
597 Ga0068860_100722677
598 Ga0068860_101284100
599 Ga0068860_102087039
600 Ga0068862_100181640
601 Ga0068862_101030272
602 Ga0068862_101734262
603 Ga0097621_100259714
604 Ga0097621_101079444
605 Ga0097621_101312799
606 Ga0068871_100255523
607 Ga0068871_100499197
608 Ga0068871_101117774
609 Ga0075428_100777900
610 Ga0075428_100957088
611 Ga0075430_100162204
612 Ga0075431_100297236
613 Ga0075431_100778732
614 Ga0075434_101453455
615 Ga0097620_100020602
616 Ga0097620_100183395
617 Ga0097620_100200686
618 Ga0097620_100308170
619 Ga0097620_102025010
620 Ga0097620_102581853
621 Ga0099794_10017871
622 Ga0105251_10132631
623 Ga0105240_10125689
624 Ga0105240_10160855
625 Ga0105240_10372997
626 Ga0111539_10027807
627 Ga0111539_10208832
628 Ga0111539_10281020
629 Ga0111539_10537215
630 Ga0111539_10713612
631 Ga0111539_11000840
632 Ga0105247_10402285
633 Ga0105247_11675783
634 Ga0114129_11394421
635 Ga0114129_13003471
636 Ga0114129_13409723
637 Ga0105242_10227005
638 Ga0105242_11507667
639 Ga0105242_11539361
640 Ga0105242_12596076
641 Ga0105248_10033530
642 Ga0105248_10146306
643 Ga0105248_10374698
644 Ga0105237_10070789
645 Ga0105237_10306781
646 Ga0105238_10054990
647 Ga0105249_10011220
648 Ga0105249_10020238
649 Ga0105249_10122822
650 Ga0105249_10627389
651 Ga0105249_10812985
652 Ga0105239_10700344
653 Ga0105246_10420432
654 Ga0105246_10732298
655 Ga0157373_10413527
656 Ga0157373_11400271
657 Ga0157370_10625205
658 Ga0157370_10950473
659 Ga0157369_10120738
660 Ga0157369_10153948
661 Ga0157369_10557210
662 Ga0157374_10105779
663 Ga0157374_10140471
664 Ga0157378_10136499
665 Ga0157378_10385378
666 Ga0157378_10557122
667 Ga0157378_10903617
668 Ga0163162_10089716
669 Ga0163162_10139668
670 Ga0163162_10316053
671 Ga0163162_10332913
672 Ga0163162_10659054
673 Ga0163162_10746279
674 Ga0163162_12212376
675 Ga0163162_12683449
676 Ga0157372_10114789
677 Ga0157372_10146656
678 Ga0157372_10237046
679 Ga0157372_10302473
680 Ga0157372_10405042
681 Ga0157375_10080583
682 Ga0157375_10172774
683 Ga0157375_10206091
684 Ga0157375_11112607
685 Ga0163163_10012383
686 Ga0163163_10147797
687 Ga0163163_11136453
688 Ga0163163_11976282
689 Ga0157380_10017679
690 Ga0157380_10259881
691 Ga0157380_10713452
692 Ga0157377_10935536
693 Ga0157376_10142344
694 Ga0157376_10212406
695 Ga0157376_10275224
696 Ga0157376_11689588
697 Ga0163161_10001884
698 Ga0163161_10119265
699 Ga0163161_10184802
700 Ga0163161_10797560
701 Ga0207682_10180128
702 Ga0207710_10179339
703 Ga0207688_10070846
704 Ga0207680_10107116
705 Ga0207645_11003495
706 Ga0207643_10026896
707 Ga0207643_10538451
708 Ga0207705_10117195
709 Ga0207707_10006100
710 Ga0207707_10157093
711 Ga0207695_10453848
712 Ga0207695_10469890
713 Ga0207695_10895704
714 Ga0207671_10474673
715 Ga0207660_10231138
716 Ga0207657_10027104
717 Ga0207649_10312432
718 Ga0207649_10314547
719 Ga0207649_10876352
720 Ga0207652_10144667
721 Ga0207652_10148150
722 Ga0207681_10379735
723 Ga0207681_10446498
724 Ga0207694_10118792
725 Ga0207650_10242353
726 Ga0207650_10598458
727 Ga0207650_10701200
728 Ga0207659_10138654
729 Ga0207659_10226111
730 Ga0207659_10466341
731 Ga0207659_11289431
732 Ga0207687_10999808
733 Ga0207644_10990967
734 Ga0207706_10142422
735 Ga0207706_10147020
736 Ga0207706_10981765
737 Ga0207669_10306455
738 Ga0207691_10104474
739 Ga0207691_10175796
740 Ga0207711_10024006
741 Ga0207711_10253867
742 Ga0207711_10447409
743 Ga0207689_10816933
744 Ga0207661_11242312
745 Ga0207679_10006240
746 Ga0207679_10366070
747 Ga0207679_10502170
748 Ga0207679_10755401
749 Ga0207679_11366062
750 Ga0207651_10793801
751 Ga0207712_10081198
752 Ga0207712_10114031
753 Ga0207668_10373329
754 Ga0207668_11111321
755 Ga0207640_10138878
756 Ga0207640_10542176
757 Ga0207640_10570789
758 Ga0207658_10029438
759 Ga0207658_11657823
760 Ga0207658_12090024
761 Ga0207677_12045633
762 Ga0207703_10118201
763 Ga0207703_10225414
764 Ga0207639_10003157
765 Ga0207639_10113584
766 Ga0207639_11312766
767 Ga0207639_11681397
768 Ga0207678_10701095
769 Ga0207678_11443016
770 Ga0207678_11583409
771 Ga0207708_11283515
772 Ga0207702_10057529
773 Ga0207641_10093860
774 Ga0207641_11257129
775 Ga0207641_11507843
776 Ga0207648_10077581
777 Ga0207648_11133952
778 Ga0207676_10014888
779 Ga0207676_10343896
780 Ga0207676_10618142
781 Ga0207676_11210066
782 Ga0207674_10011650
783 Ga0207674_10059239
784 Ga0207674_10533358
785 Ga0207674_10590878
786 Ga0207675_100125349
787 Ga0207675_100143950
788 Ga0207675_100165040
789 Ga0207675_100974759
790 Ga0207675_101180909
791 Ga0207675_101996218
792 Ga0207683_10032647
793 Ga0207683_10383441
794 Ga0207683_10456023
795 Ga0268266_11144406
796 Ga0268265_10158715
797 Ga0268265_12254640
798 Ga0268264_11230466
799 Ga0307408_100041068
800 Ga0307408_100373232
801 Ga0307408_101437386
802 Ga0307408_101438817
803 Ga0307405_10015233
804 Ga0307405_10269894
805 Ga0307405_10971838
806 Ga0307413_10013822
807 Ga0307413_10026228
808 Ga0307413_10046973
809 Ga0307410_10022639
810 Ga0307410_10027719
811 Ga0307410_10057440
812 Ga0307410_10194587
813 Ga0307410_11261983
814 Ga0307406_10054985
815 Ga0307406_10351466
816 Ga0307406_11058973
817 Ga0307406_11759852
818 Ga0307407_10002996
819 Ga0307407_10079429
820 Ga0307407_10087506
821 Ga0307407_10308161
822 Ga0307412_10499339
823 Ga0307412_10502960
824 Ga0307412_11020517
825 Ga0307409_100004161
826 Ga0307409_100004989
827 Ga0307409_100051428
828 Ga0307409_100284939
829 Ga0307409_100320008
830 Ga0307409_100706208
831 Ga0307409_100789624
832 Ga0307409_101230823
833 Ga0307409_102694081
834 Ga0307416_100092610
835 Ga0307416_100100839
836 Ga0307416_100101112
837 Ga0307416_100632308
838 Ga0307416_100741688
839 Ga0307416_100800037
840 Ga0307416_102463529
841 Ga0307414_10009698
842 Ga0307414_10446478
843 Ga0307414_10866827
844 Ga0307414_11055987
845 Ga0307411_10005790
846 Ga0307411_10038954
847 Ga0307411_10313486
848 Ga0307411_10531629
849 Ga0307415_100003050
850 Ga0307415_100020405
851 Ga0307415_100075207
852 Ga0307415_100329176
853 Ga0307415_101432413
854 Ga0307415_101534930
855 Ga0307415_101815611
856 Ga0373926_0214371
857 Ga0373945_0117180
858 Ga0373945_0558242
859 Ga0373956_0334262
860 Ga0373957_0523847
861 Ga0373943_0203557
862 Ga0316574_0146324
863 Ga0373935_0743666
864 Ga0373927_0387882
865 Ga0373947_0467113
866 Ga0373937_0035023
867 Ga0373925_0246858
868 Ga0395905_0135711
869 Ga0451837_1373532
870 Ga0451853_2712576
871 Ga0439432_122271
872 Ga0439449_0231715
873 Ga0439449_0309421
874 Ga0450889_030557
875 Ga0439446_0248037
876 Ga0439434_0274752
877 Ga0439434_0373958
878 Ga0439464_0230811
879 Ga0466957_0830145
880 Ga0495592_0723181
881 Ga0495651_0179476
882 Ga0495582_0693677
883 Ga0495628_0544198
884 Ga0495630_0499051
885 Ga0495674_0325732
886 Ga0495672_0271403
887 Ga0496101_1386224
888 Ga0496114_0272243
889 Ga0501031_0588405
890 Ga0501032_0019131
891 Ga0501033_0007146
892 Ga0501034_0609522
893 Ga0501036_0015330
894 Ga0501037_0096093
895 Ga0501038_0015386
896 Ga0501043_0008461
897 Ga0501046_0037463
898 Ga0501047_0022816
899 Ga0501048_0077107
900 Ga0501067_0054510
901 Ga0501068_0258068
902 Ga0501069_0075215
903 Ga0501070_0027081
904 Ga0501070_0157482
905 Ga0501072_0035548
906 Ga0501072_0108762
907 Ga0501073_0061276
908 Ga0501074_0010069
909 Ga0501076_0019159
910 Ga0501207_051339
911 Ga0501230_126587
912 Ga0501250_041532
913 Ga0501225_0226380
914 Ga0501079_0002413
915 Ga0501079_0924313
916 Ga0501080_0719556
917 Ga0501080_1849824
918 Ga0501083_0090149
919 Ga0501035_0808278
920 Ga0501044_0155137
921 nmdc:mga05p37_2180016_c1
922 nmdc:mga09592_570114_c1
923 nmdc:mga06r32_342972_c1
924 nmdc:mga06r32_669082_c1
925 nmdc:mga08y16_1854868_c1
926 nmdc:mga08y16_416920_c1
927 nmdc:mga08y16_474165_c1
928 nmdc:mga08y16_607377_c1
929 nmdc:mga08y16_857703_c1
930 nmdc:mga08y16_97638_c1
931 nmdc:mga0n895_1683225_c1
932 nmdc:mga0n895_2012374_c1
933 nmdc:mga0a205_981399_c1
934 Ga0495601_0141954
935 Ga0495601_0300435
936 Ga0501084_0004582
937 Ga0501084_0127860
938 Ga0501082_0014566
939 Ga0501082_0231245
940 Ga0501082_1871403

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13601

HTH_34

Winged helix DNA-binding domain

61

140

0.98

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

59

105

0.95

PF01022

HTH_5

Bacterial regulatory protein, arsR family

60

105

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z6r-assembly1.cif.gz_A crystal structure of mlc from escherichia coli 0.9389 39 87
3bp8-assembly2.cif.gz_A crystal structure of mlc/eiib complex 0.9332 38 86
3bp8-assembly2.cif.gz_B crystal structure of mlc/eiib complex 0.9221 39 87
5l9t-assembly1.cif.gz_N model of human anaphase-promoting complex/cyclosome (apc/c-cdh1) with e2 ube2s poised for polyubiquitination where ube2s, apc2, and apc11 are modeled into low resolution density 0.9215 43 86
4hob-assembly2.cif.gz_C the crystal structure of the zalpha domain from cyprinid herpes virus 3 0.9184 41 84
ID Description Score Start End Superfamily
5dukB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9411 39 84 1.10.10.10
3bp8A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9332 38 86 1.10.10.10
af_Q4DZU8_467_618_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.9319 55 103 3.30.230.130
3bp8B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9221 39 87 1.10.10.10
4hobC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9184 41 84 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7L7LDY6-F1-model_v4 Transcriptional regulator 0.9908 42 127 GO:0005737
AF-E4TCX0-F1-model_v4 Transcriptional regulator 0.9907 42 123 GO:0005737
AF-A0A1H4BP91-F1-model_v4 Winged helix DNA-binding domain-containing protein 0.988 42 123 GO:0003677
GO:0005737
AF-A0A0H1A073-F1-model_v4 deleted 0.9872 43 123
AF-A0A543B215-F1-model_v4 Winged helix DNA-binding protein 0.9865 42 125 GO:0003677

Map