F450250

General Info

Members Datasets Scaffolds Average Seq Length
469 240 938 68

Family's Representative Sequence

Representative Sequence 3300025918|Ga0207662_10255250|Ga0207662_102552502
Length 83
Sequence VPERGAPRSLIVMPAASPPNRRIVTCPTCGGESVYSPENPFRPFCSERCKNVDFGAWASESYRVGAPPSTEDRADGDESPPAH

Samples

Sample ID Description Type Environment
1 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
147 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
155 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
156 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
170 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
171 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
172 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
173 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
174 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
175 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
176 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
190 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
191 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
192 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
193 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
197 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
216 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
217 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
230 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
231 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
236 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
237 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
238 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
239 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
240 2585428062 Methylibium sp. CF059 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.48
Nodule 0
Rhizoplane 3.62
Rhizosphere 88.06
Stem 0
Stem Tuber 0
Unclassified 11.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207662_10255250 3300025918 Bacteria 1152
2 JGI26145J50221_1010118 3300003371 Bacteria 827
3 Ga0065715_10592907 3300005293 Unclassified 712
4 Ga0070658_10491342 3300005327 Bacteria 1059
5 Ga0070658_10996014 3300005327 Bacteria 729
6 Ga0070676_10340963 3300005328 Bacteria 1028
7 Ga0070676_11584854 3300005328 Unclassified 506
8 Ga0070683_100023598 3300005329 Bacteria 5503
9 Ga0070683_100175955 3300005329 Bacteria 2031
10 Ga0070683_102142835 3300005329 Bacteria 537
11 Ga0070690_100977960 3300005330 Bacteria 666
12 Ga0070670_100030610 3300005331 Bacteria 4634
13 Ga0070670_100120585 3300005331 Bacteria 2262
14 Ga0070670_100209535 3300005331 Bacteria 1694
15 Ga0070670_100320775 3300005331 Bacteria 1357
16 Ga0070677_10042112 3300005333 Bacteria 1806
17 Ga0070677_10378434 3300005333 Bacteria 740
18 Ga0070677_10743973 3300005333 Bacteria 555
19 Ga0070666_10170778 3300005335 Unclassified 1523
20 Ga0070666_10266383 3300005335 Bacteria 1215
21 Ga0070666_10568386 3300005335 Bacteria 826
22 Ga0070682_101369546 3300005337 Bacteria 604
23 Ga0068868_101354223 3300005338 Bacteria 663
24 Ga0068868_101367163 3300005338 Unclassified 660
25 Ga0068868_101705539 3300005338 Unclassified 594
26 Ga0070660_100430780 3300005339 Bacteria 1093
27 Ga0070660_100521419 3300005339 Bacteria 990
28 Ga0070660_101374564 3300005339 Bacteria 600
29 Ga0070687_100258898 3300005343 Bacteria 1085
30 Ga0070687_100711149 3300005343 Bacteria 703
31 Ga0070661_100078096 3300005344 Bacteria 2441
32 Ga0070661_100290372 3300005344 Bacteria 1270
33 Ga0070661_100832149 3300005344 Unclassified 759
34 Ga0070661_100919345 3300005344 Bacteria 723
35 Ga0070668_100399982 3300005347 Bacteria 1172
36 Ga0070668_100934178 3300005347 Unclassified 777
37 Ga0070668_101289802 3300005347 Bacteria 664
38 Ga0070669_100006722 3300005353 Bacteria 8280
39 Ga0070669_100105646 3300005353 Bacteria 2130
40 Ga0070669_100478172 3300005353 Bacteria 1030
41 Ga0070669_101895446 3300005353 Unclassified 520
42 Ga0070671_100009294 3300005355 Bacteria 7895
43 Ga0070671_100370559 3300005355 Bacteria 1223
44 Ga0070671_100393603 3300005355 Bacteria 1185
45 Ga0070671_100774313 3300005355 Bacteria 835
46 Ga0070674_100055146 3300005356 Bacteria 2751
47 Ga0070674_101771429 3300005356 Unclassified 559
48 Ga0070674_101989840 3300005356 Unclassified 529
49 Ga0070673_100187415 3300005364 Bacteria 1775
50 Ga0070673_100719708 3300005364 Bacteria 918
51 Ga0070688_100612435 3300005365 Bacteria 835
52 Ga0070659_100048077 3300005366 Bacteria 3349
53 Ga0070659_100114286 3300005366 Bacteria 2181
54 Ga0070667_100002977 3300005367 Bacteria 14554
55 Ga0070667_100006409 3300005367 Bacteria 9779
56 Ga0070667_100051607 3300005367 Bacteria 3468
57 Ga0070667_100354613 3300005367 Bacteria 1329
58 Ga0070667_101510840 3300005367 Unclassified 631
59 Ga0070700_100606102 3300005441 Bacteria 859
60 Ga0070663_100000518 3300005455 Bacteria 20374
61 Ga0070678_100059117 3300005456 Bacteria 2816
62 Ga0070678_100062164 3300005456 Bacteria 2756
63 Ga0070678_100249971 3300005456 Bacteria 1486
64 Ga0070678_100265866 3300005456 Bacteria 1444
65 Ga0070662_100051593 3300005457 Bacteria 2971
66 Ga0070662_100113275 3300005457 Bacteria 2069
67 Ga0070662_100302038 3300005457 Unclassified 1301
68 Ga0070681_10566860 3300005458 Bacteria 1049
69 Ga0068867_100028931 3300005459 Bacteria 3990
70 Ga0068867_100260528 3300005459 Bacteria 1413
71 Ga0068867_100579293 3300005459 Unclassified 976
72 Ga0068867_100891255 3300005459 Unclassified 800
73 Ga0070685_11087115 3300005466 Unclassified 604
74 Ga0070706_100168065 3300005467 Bacteria 2048
75 Ga0070707_100597279 3300005468 Bacteria 1066
76 Ga0068853_100591276 3300005539 Bacteria 1054
77 Ga0068853_100699567 3300005539 Bacteria 967
78 Ga0068853_101104306 3300005539 Unclassified 765
79 Ga0070672_100028944 3300005543 Bacteria 4148
80 Ga0070672_100063064 3300005543 Bacteria 2926
81 Ga0070672_100105025 3300005543 Bacteria 2296
82 Ga0070672_100110547 3300005543 Bacteria 2239
83 Ga0070672_100263357 3300005543 Bacteria 1454
84 Ga0070672_101009474 3300005543 Bacteria 737
85 Ga0070693_100033298 3300005547 Bacteria 2843
86 Ga0070693_100201972 3300005547 Bacteria 1291
87 Ga0070693_100933711 3300005547 Bacteria 652
88 Ga0070665_100231076 3300005548 Bacteria 1849
89 Ga0070665_101174203 3300005548 Bacteria 779
90 Ga0070665_101810094 3300005548 Bacteria 617
91 Ga0068855_102289141 3300005563 Bacteria 541
92 Ga0070664_100060538 3300005564 Bacteria 3224
93 Ga0068857_100066363 3300005577 Bacteria 3210
94 Ga0068857_101405295 3300005577 Unclassified 679
95 Ga0068854_100067689 3300005578 Bacteria 2602
96 Ga0068854_100130459 3300005578 Bacteria 1918
97 Ga0068854_100248102 3300005578 Bacteria 1420
98 Ga0068854_100478956 3300005578 Bacteria 1045
99 Ga0068856_100012751 3300005614 Bacteria 8138
100 Ga0068856_100082275 3300005614 Bacteria 3195
101 Ga0068856_100248341 3300005614 Bacteria 1794
102 Ga0068852_100044868 3300005616 Bacteria 3757
103 Ga0068852_100095140 3300005616 Bacteria 2674
104 Ga0068852_100169054 3300005616 Bacteria 2048
105 Ga0068852_100246197 3300005616 Bacteria 1711
106 Ga0068852_100384376 3300005616 Bacteria 1378
107 Ga0068852_100583634 3300005616 Bacteria 1121
108 Ga0068852_100637057 3300005616 Bacteria 1072
109 Ga0068852_102386412 3300005616 Bacteria 549
110 Ga0068859_100219069 3300005617 Bacteria 1991
111 Ga0068859_100459870 3300005617 Bacteria 1369
112 Ga0068864_100217008 3300005618 Bacteria 1763
113 Ga0068864_100456980 3300005618 Bacteria 1222
114 Ga0068864_102154442 3300005618 Bacteria 564
115 Ga0068866_10007309 3300005718 Bacteria 4622
116 Ga0068866_10748633 3300005718 Bacteria 675
117 Ga0068861_100075382 3300005719 Bacteria 2625
118 Ga0068870_10172524 3300005840 Bacteria 1292
119 Ga0068863_100021842 3300005841 Bacteria 6108
120 Ga0068863_100394507 3300005841 Bacteria 1353
121 Ga0068858_100004761 3300005842 Bacteria 13288
122 Ga0068858_100036688 3300005842 Bacteria 4545
123 Ga0068858_100283170 3300005842 Unclassified 1579
124 Ga0068858_100652526 3300005842 Bacteria 1022
125 Ga0068860_100010883 3300005843 Bacteria 8971
126 Ga0068860_100039820 3300005843 Bacteria 4494
127 Ga0068860_101232656 3300005843 Unclassified 768
128 Ga0068860_101273388 3300005843 Bacteria 756
129 Ga0070717_11779557 3300006028 Bacteria 557
130 Ga0075364_10547859 3300006051 Bacteria 791
131 Ga0075362_10083323 3300006177 Bacteria 1476
132 Ga0075362_10310834 3300006177 Bacteria 783
133 Ga0075367_10527718 3300006178 Bacteria 749
134 Ga0075369_10106365 3300006186 Bacteria 1262
135 Ga0075366_10002213 3300006195 Bacteria 9920
136 Ga0075366_10089304 3300006195 Bacteria 1846
137 Ga0075366_10234484 3300006195 Bacteria 1118
138 Ga0097621_100084601 3300006237 Bacteria 2645
139 Ga0097621_100299636 3300006237 Bacteria 1419
140 Ga0097621_101147798 3300006237 Unclassified 731
141 Ga0075370_10001248 3300006353 Bacteria 10822
142 Ga0075370_10754463 3300006353 Bacteria 592
143 Ga0068871_100093991 3300006358 Bacteria 2502
144 Ga0068871_100137793 3300006358 Bacteria 2073
145 Ga0068865_100028208 3300006881 Bacteria 3716
146 Ga0068865_100082835 3300006881 Bacteria 2307
147 Ga0068865_101677228 3300006881 Bacteria 572
148 Ga0097620_100219070 3300006931 Bacteria 1991
149 Ga0097620_100459875 3300006931 Bacteria 1369
150 Ga0105240_11523809 3300009093 Bacteria 701
151 Ga0111539_10714092 3300009094 Bacteria 1167
152 Ga0111539_11600333 3300009094 Bacteria 756
153 Ga0105245_10309916 3300009098 Bacteria 1552
154 Ga0105243_10001054 3300009148 Bacteria 25232
155 Ga0105241_10647374 3300009174 Bacteria 959
156 Ga0105242_10686171 3300009176 Unclassified 1000
157 Ga0105248_10033741 3300009177 Bacteria 5720
158 Ga0105248_10532971 3300009177 Bacteria 1324
159 Ga0105248_10537455 3300009177 Bacteria 1318
160 Ga0105248_10654553 3300009177 Bacteria 1185
161 Ga0105248_10839570 3300009177 Bacteria 1037
162 Ga0105238_10044173 3300009551 Bacteria 4506
163 Ga0105238_11413533 3300009551 Bacteria 723
164 Ga0105238_12386619 3300009551 Unclassified 564
165 Ga0105238_12959856 3300009551 Bacteria 511
166 Ga0105249_10119704 3300009553 Bacteria 2501
167 Ga0105249_12943862 3300009553 Bacteria 547
168 Ga0157324_1053878 3300012506 Bacteria 531
169 Ga0157371_10066293 3300013102 Bacteria 2556
170 Ga0157371_10163541 3300013102 Bacteria 1589
171 Ga0157370_10289011 3300013104 Bacteria 1514
172 Ga0157369_10040174 3300013105 Bacteria 5108
173 Ga0157369_10200175 3300013105 Bacteria 2097
174 Ga0157374_10133087 3300013296 Bacteria 2408
175 Ga0157374_10358811 3300013296 Bacteria 1449
176 Ga0157374_10809416 3300013296 Bacteria 953
177 Ga0163162_10076701 3300013306 Unclassified 3405
178 Ga0163162_10988403 3300013306 Unclassified 951
179 Ga0163162_12018983 3300013306 Bacteria 661
180 Ga0163162_13195245 3300013306 Bacteria 526
181 Ga0157372_10041911 3300013307 Bacteria 5062
182 Ga0157372_12231148 3300013307 Bacteria 629
183 Ga0157375_10010026 3300013308 Bacteria 8328
184 Ga0157375_10038391 3300013308 Bacteria 4598
185 Ga0157375_10081080 3300013308 Bacteria 3284
186 Ga0157375_10389641 3300013308 Bacteria 1560
187 Ga0157375_10995821 3300013308 Bacteria 978
188 Ga0157375_12392660 3300013308 Bacteria 630
189 Ga0163163_10142949 3300014325 Bacteria 2435
190 Ga0157380_10007872 3300014326 Bacteria 7583
191 Ga0157380_10009971 3300014326 Bacteria 6818
192 Ga0157380_10213623 3300014326 Bacteria 1721
193 Ga0157380_11007773 3300014326 Bacteria 867
194 Ga0157380_13188656 3300014326 Unclassified 524
195 Ga0157377_10000032 3300014745 Bacteria 121003
196 Ga0157379_10005037 3300014968 Bacteria 11332
197 Ga0157379_10016463 3300014968 Bacteria 6503
198 Ga0157379_10070802 3300014968 Bacteria 3120
199 Ga0157376_10247556 3300014969 Bacteria 1663
200 Ga0157376_10667897 3300014969 Unclassified 1041
201 Ga0182005_1045312 3300015265 Bacteria 1195
202 Ga0163161_10643282 3300017792 Bacteria 878
203 Ga0163161_10647889 3300017792 Bacteria 875
204 Ga0163161_10920621 3300017792 Bacteria 742
205 Ga0207697_10012143 3300025315 Bacteria 3622
206 Ga0207656_10240965 3300025321 Bacteria 884
207 Ga0207656_10255916 3300025321 Bacteria 859
208 Ga0207682_10007971 3300025893 Bacteria 4204
209 Ga0207642_10144932 3300025899 Bacteria 1257
210 Ga0207642_10809471 3300025899 Bacteria 596
211 Ga0207688_10110578 3300025901 Bacteria 1595
212 Ga0207680_10041256 3300025903 Bacteria 2691
213 Ga0207680_10223204 3300025903 Bacteria 1293
214 Ga0207680_10555410 3300025903 Unclassified 820
215 Ga0207645_10111639 3300025907 Bacteria 1770
216 Ga0207645_10348361 3300025907 Bacteria 991
217 Ga0207645_10352764 3300025907 Bacteria 985
218 Ga0207643_10815631 3300025908 Bacteria 605
219 Ga0207705_11002771 3300025909 Bacteria 645
220 Ga0207684_10207890 3300025910 Bacteria 1688
221 Ga0207654_10218719 3300025911 Bacteria 1262
222 Ga0207707_10961808 3300025912 Bacteria 703
223 Ga0207695_10098096 3300025913 Bacteria 2930
224 Ga0207662_10119778 3300025918 Bacteria 1650
225 Ga0207657_10025234 3300025919 Bacteria 5485
226 Ga0207657_10312970 3300025919 Bacteria 1242
227 Ga0207649_10010478 3300025920 Bacteria 5095
228 Ga0207649_10117407 3300025920 Bacteria 1788
229 Ga0207649_10333630 3300025920 Bacteria 1118
230 Ga0207649_10606310 3300025920 Bacteria 842
231 Ga0207652_11012983 3300025921 Bacteria 730
232 Ga0207681_10035984 3300025923 Bacteria 3264
233 Ga0207681_10101338 3300025923 Bacteria 2077
234 Ga0207681_10161081 3300025923 Bacteria 1691
235 Ga0207694_10068083 3300025924 Bacteria 2779
236 Ga0207694_10551941 3300025924 Bacteria 967
237 Ga0207650_10020673 3300025925 Bacteria 4645
238 Ga0207650_10022128 3300025925 Bacteria 4499
239 Ga0207650_10073756 3300025925 Bacteria 2571
240 Ga0207650_10098985 3300025925 Bacteria 2241
241 Ga0207650_11699324 3300025925 Bacteria 535
242 Ga0207659_10673142 3300025926 Bacteria 885
243 Ga0207659_11030429 3300025926 Bacteria 708
244 Ga0207659_11752850 3300025926 Bacteria 528
245 Ga0207644_10009711 3300025931 Bacteria 6325
246 Ga0207644_10365123 3300025931 Bacteria 1175
247 Ga0207644_10444794 3300025931 Bacteria 1064
248 Ga0207690_10151468 3300025932 Bacteria 1720
249 Ga0207690_11239421 3300025932 Unclassified 623
250 Ga0207706_10052728 3300025933 Bacteria 3591
251 Ga0207706_10494814 3300025933 Bacteria 1056
252 Ga0207706_11418375 3300025933 Bacteria 569
253 Ga0207686_11024079 3300025934 Bacteria 671
254 Ga0207709_10000641 3300025935 Bacteria 28524
255 Ga0207709_10495209 3300025935 Bacteria 953
256 Ga0207669_10259329 3300025937 Bacteria 1299
257 Ga0207669_11667495 3300025937 Unclassified 544
258 Ga0207704_10152702 3300025938 Bacteria 1632
259 Ga0207704_10672348 3300025938 Bacteria 855
260 Ga0207665_10373796 3300025939 Bacteria 1080
261 Ga0207691_10004347 3300025940 Bacteria 13745
262 Ga0207691_10035883 3300025940 Bacteria 4597
263 Ga0207691_10043344 3300025940 Bacteria 4147
264 Ga0207691_10073968 3300025940 Bacteria 3073
265 Ga0207691_10298050 3300025940 Bacteria 1385
266 Ga0207711_10064652 3300025941 Bacteria 3160
267 Ga0207711_10161989 3300025941 Bacteria 2026
268 Ga0207711_10399502 3300025941 Bacteria 1277
269 Ga0207711_10618013 3300025941 Unclassified 1011
270 Ga0207661_10093016 3300025944 Bacteria 2515
271 Ga0207679_10019919 3300025945 Bacteria 4518
272 Ga0207679_10039594 3300025945 Bacteria 3367
273 Ga0207667_10154262 3300025949 Bacteria 2363
274 Ga0207667_10330665 3300025949 Bacteria 1556
275 Ga0207667_10737444 3300025949 Bacteria 985
276 Ga0207651_10362816 3300025960 Bacteria 1223
277 Ga0207651_10737362 3300025960 Bacteria 870
278 Ga0207651_10769252 3300025960 Bacteria 852
279 Ga0207651_10866675 3300025960 Unclassified 803
280 Ga0207712_10420133 3300025961 Bacteria 1128
281 Ga0207668_10352221 3300025972 Bacteria 1231
282 Ga0207640_10011577 3300025981 Bacteria 4999
283 Ga0207640_10089331 3300025981 Bacteria 2129
284 Ga0207640_10157444 3300025981 Bacteria 1676
285 Ga0207640_10908610 3300025981 Bacteria 769
286 Ga0207658_10067307 3300025986 Unclassified 2697
287 Ga0207658_10096745 3300025986 Bacteria 2303
288 Ga0207658_10787301 3300025986 Bacteria 863
289 Ga0207658_11905510 3300025986 Unclassified 541
290 Ga0207677_11162275 3300026023 Unclassified 705
291 Ga0207703_10018448 3300026035 Bacteria 5448
292 Ga0207703_10046772 3300026035 Bacteria 3487
293 Ga0207639_10081726 3300026041 Bacteria 2560
294 Ga0207639_10083221 3300026041 Bacteria 2539
295 Ga0207639_10573494 3300026041 Bacteria 1038
296 Ga0207678_10000837 3300026067 Bacteria 28213
297 Ga0207678_10570403 3300026067 Unclassified 991
298 Ga0207678_10663871 3300026067 Bacteria 916
299 Ga0207708_10155685 3300026075 Bacteria 1802
300 Ga0207702_10048251 3300026078 Bacteria 3591
301 Ga0207702_10122998 3300026078 Bacteria 2325
302 Ga0207702_10832246 3300026078 Bacteria 913
303 Ga0207641_10017732 3300026088 Bacteria 5832
304 Ga0207641_10073069 3300026088 Bacteria 2955
305 Ga0207641_10458989 3300026088 Bacteria 1232
306 Ga0207641_10790530 3300026088 Bacteria 938
307 Ga0207641_12180380 3300026088 Unclassified 554
308 Ga0207648_10000172 3300026089 Bacteria 66986
309 Ga0207648_10028524 3300026089 Bacteria 4947
310 Ga0207648_10031636 3300026089 Bacteria 4678
311 Ga0207648_10329628 3300026089 Bacteria 1373
312 Ga0207648_10537752 3300026089 Unclassified 1072
313 Ga0207648_10592836 3300026089 Unclassified 1021
314 Ga0207676_10626342 3300026095 Unclassified 1036
315 Ga0207674_10017562 3300026116 Bacteria 7805
316 Ga0207674_10095092 3300026116 Bacteria 2966
317 Ga0207674_11076216 3300026116 Bacteria 773
318 Ga0207683_10056561 3300026121 Bacteria 3441
319 Ga0207683_10108581 3300026121 Bacteria 2483
320 Ga0207683_10377061 3300026121 Bacteria 1303
321 Ga0207683_10981667 3300026121 Bacteria 784
322 Ga0207683_11472530 3300026121 Unclassified 629
323 Ga0207683_11920019 3300026121 Bacteria 541
324 Ga0207698_10096596 3300026142 Bacteria 2436
325 Ga0207698_10197766 3300026142 Bacteria 1797
326 Ga0207698_10241659 3300026142 Bacteria 1646
327 Ga0207698_10278847 3300026142 Bacteria 1545
328 Ga0207698_11154296 3300026142 Bacteria 788
329 Ga0207698_11306953 3300026142 Bacteria 740
330 Ga0209998_10017241 3300027717 Bacteria 1525
331 Ga0209813_10390413 3300027866 Bacteria 559
332 Ga0209974_10000240 3300027876 Bacteria 17737
333 Ga0268266_10046025 3300028379 Bacteria 3735
334 Ga0268266_10141336 3300028379 Bacteria 2161
335 Ga0268265_10421995 3300028380 Bacteria 1239
336 Ga0268264_10056899 3300028381 Bacteria 3269
337 Ga0268264_10908384 3300028381 Bacteria 884
338 Ga0268264_12462094 3300028381 Unclassified 526
339 Ga0307515_10022668 3300028794 Bacteria 11052
340 Ga0307513_10054387 3300031456 Bacteria 4293
341 Ga0307513_10171055 3300031456 Bacteria 2050
342 Ga0307513_10244789 3300031456 Bacteria 1595
343 Ga0307513_10946000 3300031456 Bacteria 570
344 Ga0307509_10068585 3300031507 Bacteria 3711
345 Ga0307408_101543726 3300031548 Bacteria 629
346 Ga0307508_10000043 3300031616 Bacteria 143889
347 Ga0307514_10147655 3300031649 Bacteria 1585
348 Ga0307514_10374811 3300031649 Bacteria 743
349 Ga0307516_10016330 3300031730 Bacteria 7769
350 Ga0307516_10957291 3300031730 Bacteria 526
351 Ga0307407_10669880 3300031903 Bacteria 779
352 Ga0307412_10199892 3300031911 Bacteria 1517
353 Ga0307412_11864068 3300031911 Bacteria 554
354 Ga0307416_100332696 3300032002 Bacteria 1527
355 Ga0307416_102076770 3300032002 Bacteria 670
356 Ga0307411_10499038 3300032005 Bacteria 1028
357 Ga0307411_11306549 3300032005 Bacteria 661
358 Ga0307415_101776096 3300032126 Bacteria 596
359 Ga0373938_0030175 3300034957 Bacteria 1155
360 Ga0373926_0125547 3300035083 Bacteria 969
361 Ga0373936_0457197 3300035113 Unclassified 591
362 Ga0373945_0313750 3300035116 Unclassified 674
363 Ga0373954_0621731 3300035118 Bacteria 535
364 Ga0373956_0156286 3300035119 Bacteria 1074
365 Ga0373957_0372768 3300035120 Archaea 612
366 Ga0373924_0486017 3300035410 Unclassified 554
367 Ga0373935_0250853 3300035692 Bacteria 1238
368 Ga0373927_0812254 3300035695 Unclassified 618
369 Ga0373933_0056999 3300035724 Bacteria 2347
370 Ga0373947_0055941 3300035725 Bacteria 2384
371 Ga0373937_0149550 3300036401 Bacteria 2187
372 Ga0373925_0217569 3300037068 Bacteria 1524
373 Ga0373925_0311036 3300037068 Bacteria 1273
374 Ga0373925_0896176 3300037068 Unclassified 731
375 Ga0373925_1637150 3300037068 Unclassified 526
376 Ga0395905_0000088 3300037471 Bacteria 152506
377 Ga0395905_0613566 3300037471 Bacteria 990
378 Ga0395905_0833321 3300037471 Bacteria 825
379 Ga0439436_0092216 3300041404 Bacteria 844
380 Ga0451797_1589693 3300041453 Bacteria 533
381 Ga0451800_0723993 3300041459 Bacteria 584
382 Ga0451800_1430321 3300041459 Bacteria 1678
383 Ga0451804_0275479 3300041463 Bacteria 747
384 Ga0451807_1455768 3300041486 Bacteria 1259
385 Ga0451841_0934315 3300041498 Bacteria 650
386 Ga0451841_0954724 3300041498 Bacteria 1162
387 Ga0451845_0077978 3300041501 Bacteria 594
388 Ga0451843_1508595 3300041509 Bacteria 718
389 Ga0451853_1693137 3300041512 Bacteria 2498
390 Ga0451853_2172502 3300041512 Unclassified 996
391 Ga0451853_3028918 3300041512 Unclassified 690
392 Ga0451577_1961708 3300042876 Bacteria 512
393 Ga0466966_0178003 3300044684 Bacteria 1291
394 Ga0466961_0807438 3300044693 Bacteria 560
395 Ga0466957_0017735 3300044842 Bacteria 4175
396 Ga0466959_0123839 3300045049 Bacteria 1836
397 Ga0451576_0154163 3300045051 Bacteria 2396
398 Ga0466958_0773113 3300045836 Bacteria 626
399 Ga0495592_0884936 3300046454 Unclassified 526
400 Ga0495603_0270934 3300046455 Bacteria 977
401 Ga0495629_0389386 3300046459 Bacteria 948
402 Ga0495580_0325678 3300046472 Bacteria 1044
403 Ga0495580_0416110 3300046472 Bacteria 905
404 Ga0495610_0063579 3300046512 Bacteria 1747
405 Ga0495620_0084332 3300046515 Bacteria 1282
406 Ga0495632_0095069 3300046519 Bacteria 1409
407 Ga0495643_0159143 3300046522 Bacteria 1112
408 Ga0495598_0057606 3300046537 Bacteria 1190
409 Ga0495621_0347745 3300046539 Bacteria 621
410 Ga0495645_0114962 3300046543 Bacteria 1901
411 Ga0495633_0179165 3300046558 Bacteria 976
412 Ga0495625_0005002 3300046660 Bacteria 12301
413 Ga0495635_0237954 3300046663 Bacteria 1229
414 Ga0495599_0787692 3300046678 Unclassified 544
415 Ga0495647_0044123 3300046681 Bacteria 1709
416 Ga0495647_0072926 3300046681 Bacteria 1378
417 Ga0495658_0043830 3300046683 Bacteria 2504
418 Ga0495658_0119253 3300046683 Bacteria 1594
419 Ga0495658_0539120 3300046683 Bacteria 747
420 Ga0495658_0840483 3300046683 Bacteria 587
421 Ga0495613_0161981 3300046689 Bacteria 1591
422 Ga0495680_0715584 3300047322 Bacteria 660
423 Ga0495684_0160565 3300047471 Bacteria 1677
424 Ga0495593_0210681 3300047673 Bacteria 976
425 Ga0495614_0278446 3300048089 Bacteria 770
426 Ga0496101_0867015 3300048904 Bacteria 711
427 Ga0496101_1484062 3300048904 Unclassified 528
428 Ga0496102_0007992 3300048905 Bacteria 9039
429 Ga0496102_1371888 3300048905 Unclassified 626
430 Ga0496104_0163897 3300048907 Bacteria 2132
431 Ga0496105_0191729 3300048908 Bacteria 1671
432 Ga0496108_0966011 3300048911 Bacteria 729
433 Ga0496109_0409600 3300048912 Bacteria 1281
434 Ga0496110_0228106 3300048913 Bacteria 1694
435 Ga0496110_0327350 3300048913 Bacteria 1396
436 Ga0496114_0127227 3300048917 Bacteria 2197
437 Ga0496114_1222862 3300048917 Bacteria 637
438 Ga0501292_002021 3300049515 Bacteria 2570
439 Ga0501301_008083 3300049524 Bacteria 823
440 Ga0501303_000792 3300049526 Bacteria 2382
441 Ga0501031_0232058 3300049568 Bacteria 1201
442 Ga0501032_0381504 3300049569 Bacteria 906
443 Ga0501034_0659348 3300049571 Bacteria 947
444 Ga0501034_0795206 3300049571 Bacteria 839
445 Ga0501043_0000180 3300049579 Bacteria 56892
446 Ga0501046_0000226 3300049580 Bacteria 58757
447 Ga0501046_0219698 3300049580 Bacteria 1407
448 Ga0501047_0000302 3300049581 Bacteria 56851
449 Ga0501048_0002019 3300049582 Bacteria 15408
450 Ga0501074_0198842 3300049590 Bacteria 1429
451 Ga0501080_0849034 3300049742 Bacteria 798
452 Ga0501265_001585 3300049762 Bacteria 2558
453 Ga0501045_0019744 3300049824 Bacteria 4808
454 nmdc:mga0k408_1099_c1 3300050493 Bacteria 14817
455 nmdc:mga0k408_380137_c1 3300050493 Bacteria 841
456 nmdc:mga0k408_4964_c1 3300050493 Bacteria 7051
457 nmdc:mga0k408_85779_c1 3300050493 Bacteria 1848
458 nmdc:mga06z11_171018_c1 3300050494 Bacteria 1248
459 nmdc:mga07m45_216974_c1 3300050496 Bacteria 1113
460 nmdc:mga07m45_44355_c1 3300050496 Bacteria 2496
461 nmdc:mga0qj67_1553467_c1 3300050509 Bacteria 508
462 Ga0495601_0261567 3300053077 Bacteria 1129
463 Ga0495619_0186517 3300053085 Bacteria 1435
464 Ga0500555_175145 3300053103 Bacteria 520
465 Ga0500658_0269243 3300053134 Bacteria 783
466 Ga0500587_000142 3300053739 Bacteria 6857
467 Ga0590075_214443 3300059424 Bacteria 510
468 Ga0466962_0116804 3300061719 Bacteria 1286
469 2587754062 2585428062 Bacteria 6842168
470 Ga0207662_10255250
471 JGI26145J50221_1010118
472 Ga0065715_10592907
473 Ga0070658_10491342
474 Ga0070658_10996014
475 Ga0070676_10340963
476 Ga0070676_11584854
477 Ga0070683_100023598
478 Ga0070683_100175955
479 Ga0070683_102142835
480 Ga0070690_100977960
481 Ga0070670_100030610
482 Ga0070670_100120585
483 Ga0070670_100209535
484 Ga0070670_100320775
485 Ga0070677_10042112
486 Ga0070677_10378434
487 Ga0070677_10743973
488 Ga0070666_10170778
489 Ga0070666_10266383
490 Ga0070666_10568386
491 Ga0070682_101369546
492 Ga0068868_101354223
493 Ga0068868_101367163
494 Ga0068868_101705539
495 Ga0070660_100430780
496 Ga0070660_100521419
497 Ga0070660_101374564
498 Ga0070687_100258898
499 Ga0070687_100711149
500 Ga0070661_100078096
501 Ga0070661_100290372
502 Ga0070661_100832149
503 Ga0070661_100919345
504 Ga0070668_100399982
505 Ga0070668_100934178
506 Ga0070668_101289802
507 Ga0070669_100006722
508 Ga0070669_100105646
509 Ga0070669_100478172
510 Ga0070669_101895446
511 Ga0070671_100009294
512 Ga0070671_100370559
513 Ga0070671_100393603
514 Ga0070671_100774313
515 Ga0070674_100055146
516 Ga0070674_101771429
517 Ga0070674_101989840
518 Ga0070673_100187415
519 Ga0070673_100719708
520 Ga0070688_100612435
521 Ga0070659_100048077
522 Ga0070659_100114286
523 Ga0070667_100002977
524 Ga0070667_100006409
525 Ga0070667_100051607
526 Ga0070667_100354613
527 Ga0070667_101510840
528 Ga0070700_100606102
529 Ga0070663_100000518
530 Ga0070678_100059117
531 Ga0070678_100062164
532 Ga0070678_100249971
533 Ga0070678_100265866
534 Ga0070662_100051593
535 Ga0070662_100113275
536 Ga0070662_100302038
537 Ga0070681_10566860
538 Ga0068867_100028931
539 Ga0068867_100260528
540 Ga0068867_100579293
541 Ga0068867_100891255
542 Ga0070685_11087115
543 Ga0070706_100168065
544 Ga0070707_100597279
545 Ga0068853_100591276
546 Ga0068853_100699567
547 Ga0068853_101104306
548 Ga0070672_100028944
549 Ga0070672_100063064
550 Ga0070672_100105025
551 Ga0070672_100110547
552 Ga0070672_100263357
553 Ga0070672_101009474
554 Ga0070693_100033298
555 Ga0070693_100201972
556 Ga0070693_100933711
557 Ga0070665_100231076
558 Ga0070665_101174203
559 Ga0070665_101810094
560 Ga0068855_102289141
561 Ga0070664_100060538
562 Ga0068857_100066363
563 Ga0068857_101405295
564 Ga0068854_100067689
565 Ga0068854_100130459
566 Ga0068854_100248102
567 Ga0068854_100478956
568 Ga0068856_100012751
569 Ga0068856_100082275
570 Ga0068856_100248341
571 Ga0068852_100044868
572 Ga0068852_100095140
573 Ga0068852_100169054
574 Ga0068852_100246197
575 Ga0068852_100384376
576 Ga0068852_100583634
577 Ga0068852_100637057
578 Ga0068852_102386412
579 Ga0068859_100219069
580 Ga0068859_100459870
581 Ga0068864_100217008
582 Ga0068864_100456980
583 Ga0068864_102154442
584 Ga0068866_10007309
585 Ga0068866_10748633
586 Ga0068861_100075382
587 Ga0068870_10172524
588 Ga0068863_100021842
589 Ga0068863_100394507
590 Ga0068858_100004761
591 Ga0068858_100036688
592 Ga0068858_100283170
593 Ga0068858_100652526
594 Ga0068860_100010883
595 Ga0068860_100039820
596 Ga0068860_101232656
597 Ga0068860_101273388
598 Ga0070717_11779557
599 Ga0075364_10547859
600 Ga0075362_10083323
601 Ga0075362_10310834
602 Ga0075367_10527718
603 Ga0075369_10106365
604 Ga0075366_10002213
605 Ga0075366_10089304
606 Ga0075366_10234484
607 Ga0097621_100084601
608 Ga0097621_100299636
609 Ga0097621_101147798
610 Ga0075370_10001248
611 Ga0075370_10754463
612 Ga0068871_100093991
613 Ga0068871_100137793
614 Ga0068865_100028208
615 Ga0068865_100082835
616 Ga0068865_101677228
617 Ga0097620_100219070
618 Ga0097620_100459875
619 Ga0105240_11523809
620 Ga0111539_10714092
621 Ga0111539_11600333
622 Ga0105245_10309916
623 Ga0105243_10001054
624 Ga0105241_10647374
625 Ga0105242_10686171
626 Ga0105248_10033741
627 Ga0105248_10532971
628 Ga0105248_10537455
629 Ga0105248_10654553
630 Ga0105248_10839570
631 Ga0105238_10044173
632 Ga0105238_11413533
633 Ga0105238_12386619
634 Ga0105238_12959856
635 Ga0105249_10119704
636 Ga0105249_12943862
637 Ga0157324_1053878
638 Ga0157371_10066293
639 Ga0157371_10163541
640 Ga0157370_10289011
641 Ga0157369_10040174
642 Ga0157369_10200175
643 Ga0157374_10133087
644 Ga0157374_10358811
645 Ga0157374_10809416
646 Ga0163162_10076701
647 Ga0163162_10988403
648 Ga0163162_12018983
649 Ga0163162_13195245
650 Ga0157372_10041911
651 Ga0157372_12231148
652 Ga0157375_10010026
653 Ga0157375_10038391
654 Ga0157375_10081080
655 Ga0157375_10389641
656 Ga0157375_10995821
657 Ga0157375_12392660
658 Ga0163163_10142949
659 Ga0157380_10007872
660 Ga0157380_10009971
661 Ga0157380_10213623
662 Ga0157380_11007773
663 Ga0157380_13188656
664 Ga0157377_10000032
665 Ga0157379_10005037
666 Ga0157379_10016463
667 Ga0157379_10070802
668 Ga0157376_10247556
669 Ga0157376_10667897
670 Ga0182005_1045312
671 Ga0163161_10643282
672 Ga0163161_10647889
673 Ga0163161_10920621
674 Ga0207697_10012143
675 Ga0207656_10240965
676 Ga0207656_10255916
677 Ga0207682_10007971
678 Ga0207642_10144932
679 Ga0207642_10809471
680 Ga0207688_10110578
681 Ga0207680_10041256
682 Ga0207680_10223204
683 Ga0207680_10555410
684 Ga0207645_10111639
685 Ga0207645_10348361
686 Ga0207645_10352764
687 Ga0207643_10815631
688 Ga0207705_11002771
689 Ga0207684_10207890
690 Ga0207654_10218719
691 Ga0207707_10961808
692 Ga0207695_10098096
693 Ga0207662_10119778
694 Ga0207657_10025234
695 Ga0207657_10312970
696 Ga0207649_10010478
697 Ga0207649_10117407
698 Ga0207649_10333630
699 Ga0207649_10606310
700 Ga0207652_11012983
701 Ga0207681_10035984
702 Ga0207681_10101338
703 Ga0207681_10161081
704 Ga0207694_10068083
705 Ga0207694_10551941
706 Ga0207650_10020673
707 Ga0207650_10022128
708 Ga0207650_10073756
709 Ga0207650_10098985
710 Ga0207650_11699324
711 Ga0207659_10673142
712 Ga0207659_11030429
713 Ga0207659_11752850
714 Ga0207644_10009711
715 Ga0207644_10365123
716 Ga0207644_10444794
717 Ga0207690_10151468
718 Ga0207690_11239421
719 Ga0207706_10052728
720 Ga0207706_10494814
721 Ga0207706_11418375
722 Ga0207686_11024079
723 Ga0207709_10000641
724 Ga0207709_10495209
725 Ga0207669_10259329
726 Ga0207669_11667495
727 Ga0207704_10152702
728 Ga0207704_10672348
729 Ga0207665_10373796
730 Ga0207691_10004347
731 Ga0207691_10035883
732 Ga0207691_10043344
733 Ga0207691_10073968
734 Ga0207691_10298050
735 Ga0207711_10064652
736 Ga0207711_10161989
737 Ga0207711_10399502
738 Ga0207711_10618013
739 Ga0207661_10093016
740 Ga0207679_10019919
741 Ga0207679_10039594
742 Ga0207667_10154262
743 Ga0207667_10330665
744 Ga0207667_10737444
745 Ga0207651_10362816
746 Ga0207651_10737362
747 Ga0207651_10769252
748 Ga0207651_10866675
749 Ga0207712_10420133
750 Ga0207668_10352221
751 Ga0207640_10011577
752 Ga0207640_10089331
753 Ga0207640_10157444
754 Ga0207640_10908610
755 Ga0207658_10067307
756 Ga0207658_10096745
757 Ga0207658_10787301
758 Ga0207658_11905510
759 Ga0207677_11162275
760 Ga0207703_10018448
761 Ga0207703_10046772
762 Ga0207639_10081726
763 Ga0207639_10083221
764 Ga0207639_10573494
765 Ga0207678_10000837
766 Ga0207678_10570403
767 Ga0207678_10663871
768 Ga0207708_10155685
769 Ga0207702_10048251
770 Ga0207702_10122998
771 Ga0207702_10832246
772 Ga0207641_10017732
773 Ga0207641_10073069
774 Ga0207641_10458989
775 Ga0207641_10790530
776 Ga0207641_12180380
777 Ga0207648_10000172
778 Ga0207648_10028524
779 Ga0207648_10031636
780 Ga0207648_10329628
781 Ga0207648_10537752
782 Ga0207648_10592836
783 Ga0207676_10626342
784 Ga0207674_10017562
785 Ga0207674_10095092
786 Ga0207674_11076216
787 Ga0207683_10056561
788 Ga0207683_10108581
789 Ga0207683_10377061
790 Ga0207683_10981667
791 Ga0207683_11472530
792 Ga0207683_11920019
793 Ga0207698_10096596
794 Ga0207698_10197766
795 Ga0207698_10241659
796 Ga0207698_10278847
797 Ga0207698_11154296
798 Ga0207698_11306953
799 Ga0209998_10017241
800 Ga0209813_10390413
801 Ga0209974_10000240
802 Ga0268266_10046025
803 Ga0268266_10141336
804 Ga0268265_10421995
805 Ga0268264_10056899
806 Ga0268264_10908384
807 Ga0268264_12462094
808 Ga0307515_10022668
809 Ga0307513_10054387
810 Ga0307513_10171055
811 Ga0307513_10244789
812 Ga0307513_10946000
813 Ga0307509_10068585
814 Ga0307408_101543726
815 Ga0307508_10000043
816 Ga0307514_10147655
817 Ga0307514_10374811
818 Ga0307516_10016330
819 Ga0307516_10957291
820 Ga0307407_10669880
821 Ga0307412_10199892
822 Ga0307412_11864068
823 Ga0307416_100332696
824 Ga0307416_102076770
825 Ga0307411_10499038
826 Ga0307411_11306549
827 Ga0307415_101776096
828 Ga0373938_0030175
829 Ga0373926_0125547
830 Ga0373936_0457197
831 Ga0373945_0313750
832 Ga0373954_0621731
833 Ga0373956_0156286
834 Ga0373957_0372768
835 Ga0373924_0486017
836 Ga0373935_0250853
837 Ga0373927_0812254
838 Ga0373933_0056999
839 Ga0373947_0055941
840 Ga0373937_0149550
841 Ga0373925_0217569
842 Ga0373925_0311036
843 Ga0373925_0896176
844 Ga0373925_1637150
845 Ga0395905_0000088
846 Ga0395905_0613566
847 Ga0395905_0833321
848 Ga0439436_0092216
849 Ga0451797_1589693
850 Ga0451800_0723993
851 Ga0451800_1430321
852 Ga0451804_0275479
853 Ga0451807_1455768
854 Ga0451841_0934315
855 Ga0451841_0954724
856 Ga0451845_0077978
857 Ga0451843_1508595
858 Ga0451853_1693137
859 Ga0451853_2172502
860 Ga0451853_3028918
861 Ga0451577_1961708
862 Ga0466966_0178003
863 Ga0466961_0807438
864 Ga0466957_0017735
865 Ga0466959_0123839
866 Ga0451576_0154163
867 Ga0466958_0773113
868 Ga0495592_0884936
869 Ga0495603_0270934
870 Ga0495629_0389386
871 Ga0495580_0325678
872 Ga0495580_0416110
873 Ga0495610_0063579
874 Ga0495620_0084332
875 Ga0495632_0095069
876 Ga0495643_0159143
877 Ga0495598_0057606
878 Ga0495621_0347745
879 Ga0495645_0114962
880 Ga0495633_0179165
881 Ga0495625_0005002
882 Ga0495635_0237954
883 Ga0495599_0787692
884 Ga0495647_0044123
885 Ga0495647_0072926
886 Ga0495658_0043830
887 Ga0495658_0119253
888 Ga0495658_0539120
889 Ga0495658_0840483
890 Ga0495613_0161981
891 Ga0495680_0715584
892 Ga0495684_0160565
893 Ga0495593_0210681
894 Ga0495614_0278446
895 Ga0496101_0867015
896 Ga0496101_1484062
897 Ga0496102_0007992
898 Ga0496102_1371888
899 Ga0496104_0163897
900 Ga0496105_0191729
901 Ga0496108_0966011
902 Ga0496109_0409600
903 Ga0496110_0228106
904 Ga0496110_0327350
905 Ga0496114_0127227
906 Ga0496114_1222862
907 Ga0501292_002021
908 Ga0501301_008083
909 Ga0501303_000792
910 Ga0501031_0232058
911 Ga0501032_0381504
912 Ga0501034_0659348
913 Ga0501034_0795206
914 Ga0501043_0000180
915 Ga0501046_0000226
916 Ga0501046_0219698
917 Ga0501047_0000302
918 Ga0501048_0002019
919 Ga0501074_0198842
920 Ga0501080_0849034
921 Ga0501265_001585
922 Ga0501045_0019744
923 nmdc:mga0k408_1099_c1
924 nmdc:mga0k408_380137_c1
925 nmdc:mga0k408_4964_c1
926 nmdc:mga0k408_85779_c1
927 nmdc:mga06z11_171018_c1
928 nmdc:mga07m45_216974_c1
929 nmdc:mga07m45_44355_c1
930 nmdc:mga0qj67_1553467_c1
931 Ga0495601_0261567
932 Ga0495619_0186517
933 Ga0500555_175145
934 Ga0500658_0269243
935 Ga0500587_000142
936 Ga0590075_214443
937 Ga0466962_0116804
938 2587754062

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03884

YacG

DNA gyrase inhibitor YacG

24

75

0.95

Map