F450244

General Info

Members Datasets Scaffolds Average Seq Length
469 312 938 229

Family's Representative Sequence

Representative Sequence 3300025297|Ga0209758_1025771|Ga0209758_10257712
Length 257
Sequence MNGTDKLEDTMKAGDVMTRRIIAIHDDAAVDEAARLMLQDDISALPVVDQAGKVLGVVSEGDLLRRVETGTEIRRPRWLELLVGPGRLAEEYVRTHARCVSEIMTRDLVSVTEDTDLSEVVRLMERRRVKRVLVMQGERLVGLISRSNLLHALAHLTPEAKPTPQSDQAIRDAIAAEMSKLKWAPRASVNPIVQDGIVDLHGTIFDDRERDALQVLCENIRGVKQVRDHLIWIEPYSGMPIGPLAGVEIITGNRPTT

Samples

Sample ID Description Type Environment
1 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
57 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
58 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
59 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
60 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
61 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
62 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
66 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
67 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
68 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
69 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
70 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
71 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
72 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
73 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
74 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
86 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
89 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
90 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
91 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
92 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
93 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
94 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
95 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
96 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
97 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
98 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
101 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
102 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
108 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
109 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
110 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
111 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
112 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
113 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
114 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
115 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
116 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
120 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
126 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
133 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
144 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
154 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
168 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
173 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
174 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
190 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
226 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
227 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
228 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
229 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
233 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
234 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
235 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
236 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
237 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
238 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
239 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
240 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
241 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
242 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
243 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
244 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
245 2643221599 Rhizobium sp. Root708 Isolate Unclassified
246 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
247 2738541293 Rhizobium sp. GV031 Isolate Unclassified
248 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
249 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
250 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
251 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
252 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
253 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
254 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
255 2791355264 Rhizobium sp. S9 Isolate Nodule
256 2791355267 Rhizobium sp. L18 Isolate Nodule
257 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
258 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
259 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
260 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
261 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
262 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
263 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
264 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
265 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
266 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
267 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
268 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
269 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
270 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
271 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
272 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
273 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
274 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
275 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
276 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
277 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
278 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
279 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
280 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
281 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
282 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
283 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
284 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
285 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
286 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
287 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
288 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
289 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
290 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
291 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
292 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
293 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
294 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
295 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
296 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
297 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
298 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
299 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
300 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
301 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
302 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
303 3004167301 Mesorhizobium loti 582 Isolate Unclassified
304 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
305 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
306 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
307 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
308 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
309 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
310 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
311 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
312 8056375014 Rhizobium redzepovicii 18T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.66
Metatranscriptomes 0.43
Isolates 17.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.41
Nodule 12.58
Rhizoplane 1.92
Rhizosphere 73.77
Stem 0
Stem Tuber 0
Unclassified 10.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209758_1025771 3300025297 Unclassified 2568
2 JGI24740J21852_10006904 3300001979 Bacteria 4661
3 JGI24739J22299_10002997 3300001989 Bacteria 6462
4 JGI24739J22299_10045722 3300001989 Bacteria 1435
5 JGI24735J21928_10024815 3300002067 Bacteria 1811
6 rootL2_10111805 3300003322 Bacteria 2050
7 Ga0055540_1000126 3300003792 Bacteria 78462
8 Ga0055531_10039839 3300003794 Bacteria 1387
9 Ga0070670_100000326 3300005331 Bacteria 40332
10 Ga0070660_100121718 3300005339 Bacteria 2083
11 Ga0070667_101087230 3300005367 Bacteria 747
12 Ga0070714_100056191 3300005435 Bacteria 3366
13 Ga0070713_100068388 3300005436 Bacteria 2993
14 Ga0070713_100553760 3300005436 Bacteria 1089
15 Ga0070681_10108863 3300005458 Bacteria 2711
16 Ga0070681_10423727 3300005458 Unclassified 1243
17 Ga0070698_100167947 3300005471 Bacteria 2135
18 Ga0070698_100203782 3300005471 Unclassified 1913
19 Ga0070698_100258225 3300005471 Unclassified 1675
20 Ga0070699_100026293 3300005518 Bacteria 5020
21 Ga0070679_100062372 3300005530 Bacteria 3716
22 Ga0070672_100342015 3300005543 Bacteria 1274
23 Ga0070686_100387017 3300005544 Bacteria 1060
24 Ga0070665_101125044 3300005548 Unclassified 797
25 Ga0068855_100634209 3300005563 Unclassified 1149
26 Ga0068860_100793443 3300005843 Bacteria 960
27 Ga0068860_100938653 3300005843 Bacteria 882
28 Ga0081538_10025688 3300005981 Bacteria 4144
29 Ga0070712_100613153 3300006175 Bacteria 922
30 Ga0075369_10075119 3300006186 Bacteria 1492
31 Ga0075428_100172066 3300006844 Bacteria 2347
32 Ga0075428_100179848 3300006844 Bacteria 2290
33 Ga0075428_100698433 3300006844 Bacteria 1081
34 Ga0075430_100111378 3300006846 Bacteria 2282
35 Ga0075433_10069840 3300006852 Bacteria 3086
36 Ga0075434_100092700 3300006871 Bacteria 3023
37 Ga0075434_100673767 3300006871 Bacteria 1052
38 Ga0111539_10091189 3300009094 Bacteria 3581
39 Ga0111539_10733965 3300009094 Bacteria 1150
40 Ga0114129_10002667 3300009147 Bacteria 24838
41 Ga0114129_11095908 3300009147 Bacteria 997
42 Ga0105248_10384681 3300009177 Bacteria 1580
43 Ga0105238_10585919 3300009551 Bacteria 1122
44 Ga0157369_10137389 3300013105 Bacteria 2587
45 Ga0157378_10059250 3300013297 Bacteria 3416
46 Ga0157372_10645301 3300013307 Bacteria 1233
47 Ga0157379_10243746 3300014968 Bacteria 1630
48 Ga0157376_10564215 3300014969 Bacteria 1128
49 Ga0213872_10095652 3300021361 Bacteria 1327
50 Ga0213876_10091033 3300021384 Bacteria 1615
51 Ga0209673_1058600 3300025273 Bacteria 974
52 Ga0209050_1010218 3300025298 Bacteria 4656
53 Ga0209256_1017325 3300025299 Bacteria 2399
54 Ga0209051_1000201 3300025303 Bacteria 106123
55 Ga0209257_1005375 3300025304 Bacteria 9042
56 Ga0207692_10202372 3300025898 Bacteria 1168
57 Ga0207707_10271668 3300025912 Bacteria 1469
58 Ga0207707_10364927 3300025912 Unclassified 1243
59 Ga0207693_10060596 3300025915 Bacteria 2965
60 Ga0207660_10200119 3300025917 Bacteria 1560
61 Ga0207657_10048647 3300025919 Bacteria 3701
62 Ga0207650_10000206 3300025925 Bacteria 67660
63 Ga0207664_10158379 3300025929 Bacteria 1929
64 Ga0207665_10072642 3300025939 Bacteria 2350
65 Ga0207665_10137127 3300025939 Bacteria 1742
66 Ga0207667_10557313 3300025949 Unclassified 1159
67 Ga0207667_10614943 3300025949 Bacteria 1095
68 Ga0268266_10626012 3300028379 Unclassified 1035
69 Ga0268264_10840557 3300028381 Bacteria 919
70 Ga0265338_10275282 3300028800 Bacteria 1232
71 Ga0265325_10093648 3300031241 Bacteria 1478
72 Ga0265339_10029634 3300031249 Bacteria 3104
73 Ga0265331_10003111 3300031250 Bacteria 10860
74 Ga0307513_10008385 3300031456 Bacteria 13232
75 Ga0265313_10000832 3300031595 Bacteria 31227
76 Ga0265314_10035140 3300031711 Bacteria 3655
77 Ga0307412_10000095 3300031911 Bacteria 75002
78 Ga0316587_1031239 3300033529 Bacteria 941
79 Ga0373926_0012489 3300035083 Bacteria 2872
80 Ga0373934_0071627 3300035086 Bacteria 1387
81 Ga0373944_0035422 3300035089 Unclassified 1521
82 Ga0373944_0160231 3300035089 Bacteria 798
83 Ga0373923_0074019 3300035111 Unclassified 1467
84 Ga0373923_0106925 3300035111 Bacteria 1239
85 Ga0373945_0017670 3300035116 Bacteria 2417
86 Ga0373945_0167441 3300035116 Bacteria 899
87 Ga0373954_0043566 3300035118 Unclassified 2093
88 Ga0373954_0043743 3300035118 Bacteria 2089
89 Ga0373954_0050486 3300035118 Bacteria 1952
90 Ga0373943_0119423 3300035170 Bacteria 1399
91 Ga0373943_0195708 3300035170 Bacteria 1117
92 Ga0373946_0081043 3300035171 Bacteria 1421
93 Ga0373946_0099459 3300035171 Bacteria 1302
94 Ga0373946_0147470 3300035171 Bacteria 1095
95 Ga0373955_0026014 3300035172 Unclassified 3010
96 Ga0373931_0007997 3300035691 Bacteria 5003
97 Ga0373931_0086107 3300035691 Bacteria 1743
98 Ga0373935_0040988 3300035692 Bacteria 2907
99 Ga0373935_0179139 3300035692 Bacteria 1454
100 Ga0373935_0188964 3300035692 Bacteria 1418
101 Ga0373927_0182136 3300035695 Bacteria 1378
102 Ga0373927_0190732 3300035695 Unclassified 1345
103 Ga0373933_0218753 3300035724 Bacteria 1221
104 Ga0373947_0039396 3300035725 Bacteria 2811
105 Ga0373947_0040457 3300035725 Unclassified 2777
106 Ga0373937_0029689 3300036401 Bacteria 4953
107 Ga0373937_0057854 3300036401 Bacteria 3562
108 Ga0373937_0121025 3300036401 Unclassified 2439
109 Ga0373925_0072015 3300037068 Bacteria 2614
110 Ga0373925_0275861 3300037068 Bacteria 1353
111 Ga0373925_0285147 3300037068 Bacteria 1331
112 Ga0373925_0618415 3300037068 Unclassified 892
113 Ga0395899_0128856 3300037312 Bacteria 1808
114 Ga0395900_0157101 3300037418 Bacteria 2322
115 Ga0436364_0817580 3300037853 Bacteria 2366
116 Ga0395901_0753611 3300038443 Bacteria 966
117 Ga0436365_1535498 3300039437 Bacteria 6321
118 Ga0436360_1018108 3300039438 Bacteria 5151
119 Ga0436360_1228930 3300039438 Bacteria 1016
120 Ga0436360_1238321 3300039438 Bacteria 1738
121 Ga0436361_0003422 3300039447 Unclassified 947
122 Ga0436361_0136861 3300039447 Bacteria 1706
123 Ga0436361_0322884 3300039447 Bacteria 7329
124 Ga0436361_1161468 3300039447 Bacteria 922
125 Ga0436362_0431549 3300039453 Unclassified 1592
126 Ga0451833_0237958 3300041491 Bacteria 1100
127 Ga0451839_0476402 3300041496 Bacteria 4534
128 Ga0451841_0285453 3300041498 Bacteria 7441
129 Ga0451847_0943666 3300041503 Bacteria 5502
130 Ga0451849_0692893 3300041505 Bacteria 954
131 Ga0451850_47952 3300041506 Bacteria 1011
132 Ga0451851_0271909 3300041507 Bacteria 4824
133 Ga0451855_0215471 3300041511 Bacteria 2241
134 Ga0451853_1709556 3300041512 Bacteria 4614
135 Ga0495617_001063 3300046452 Bacteria 12533
136 Ga0495617_111562 3300046452 Bacteria 884
137 Ga0495603_0062121 3300046455 Bacteria 2205
138 Ga0495603_0092608 3300046455 Unclassified 1766
139 Ga0495603_0165413 3300046455 Unclassified 1282
140 Ga0495629_0003713 3300046459 Bacteria 11506
141 Ga0495629_0047335 3300046459 Bacteria 3016
142 Ga0495629_0095802 3300046459 Bacteria 2070
143 Ga0495638_0001187 3300046460 Bacteria 24921
144 Ga0495641_0010013 3300046461 Bacteria 5560
145 Ga0495651_0073288 3300046462 Bacteria 2600
146 Ga0495651_0090760 3300046462 Bacteria 2291
147 Ga0495651_0315492 3300046462 Bacteria 1044
148 Ga0495653_0004128 3300046463 Bacteria 11750
149 Ga0495653_0578226 3300046463 Unclassified 693
150 Ga0495580_0028271 3300046472 Bacteria 4077
151 Ga0495582_0209249 3300046473 Bacteria 1115
152 Ga0495582_0499994 3300046473 Bacteria 703
153 Ga0495605_0027562 3300046474 Bacteria 2943
154 Ga0495639_0039290 3300046475 Bacteria 2128
155 Ga0495639_0111122 3300046475 Bacteria 1301
156 Ga0495639_0169007 3300046475 Unclassified 1061
157 Ga0495662_0001485 3300046476 Bacteria 11615
158 Ga0495662_0077097 3300046476 Bacteria 1619
159 Ga0495664_0060862 3300046477 Unclassified 2248
160 Ga0495664_0277807 3300046477 Unclassified 1012
161 Ga0495664_0380785 3300046477 Bacteria 848
162 Ga0495584_0000048 3300046491 Bacteria 88621
163 Ga0495584_0018481 3300046491 Bacteria 3543
164 Ga0495585_0004231 3300046492 Bacteria 9363
165 Ga0495585_0004625 3300046492 Bacteria 8885
166 Ga0495585_0068308 3300046492 Unclassified 1942
167 Ga0495585_0122544 3300046492 Bacteria 1374
168 Ga0495594_0036904 3300046499 Unclassified 2666
169 Ga0495596_0082804 3300046500 Bacteria 1245
170 Ga0495607_0031873 3300046501 Bacteria 3223
171 Ga0495607_0036751 3300046501 Bacteria 2948
172 Ga0495607_0105434 3300046501 Bacteria 1502
173 Ga0495583_0000108 3300046506 Bacteria 139791
174 Ga0495583_0000323 3300046506 Bacteria 75419
175 Ga0495583_0001447 3300046506 Bacteria 24084
176 Ga0495583_0013521 3300046506 Bacteria 4549
177 Ga0495606_0195798 3300046507 Bacteria 1155
178 Ga0495608_0039944 3300046511 Bacteria 3144
179 Ga0495608_0213636 3300046511 Unclassified 1212
180 Ga0495610_0000447 3300046512 Bacteria 42590
181 Ga0495610_0016553 3300046512 Bacteria 4238
182 Ga0495610_0159568 3300046512 Bacteria 954
183 Ga0495616_0000564 3300046513 Bacteria 28013
184 Ga0495616_0003327 3300046513 Bacteria 10328
185 Ga0495616_0020473 3300046513 Bacteria 3597
186 Ga0495616_0113708 3300046513 Bacteria 1255
187 Ga0495618_0106257 3300046514 Bacteria 1797
188 Ga0495618_0263623 3300046514 Unclassified 1078
189 Ga0495620_0015347 3300046515 Bacteria 3870
190 Ga0495628_0176506 3300046516 Unclassified 1618
191 Ga0495628_0349632 3300046516 Bacteria 1087
192 Ga0495630_0055858 3300046517 Bacteria 2958
193 Ga0495643_0002177 3300046522 Bacteria 16032
194 Ga0495644_0000294 3300046523 Bacteria 23082
195 Ga0495644_0001391 3300046523 Bacteria 9888
196 Ga0495648_0000233 3300046524 Bacteria 63677
197 Ga0495648_0029858 3300046524 Bacteria 3613
198 Ga0495648_0064352 3300046524 Bacteria 2161
199 Ga0495666_0147830 3300046526 Bacteria 1093
200 Ga0495652_0049569 3300046529 Bacteria 3594
201 Ga0495665_0036335 3300046531 Bacteria 2630
202 Ga0495640_0004052 3300046533 Bacteria 11725
203 Ga0495640_0086304 3300046533 Bacteria 2078
204 Ga0495640_0144792 3300046533 Bacteria 1529
205 Ga0495640_0230765 3300046533 Unclassified 1164
206 Ga0495640_0281772 3300046533 Bacteria 1035
207 Ga0495609_0001334 3300046538 Bacteria 16761
208 Ga0495609_0002325 3300046538 Bacteria 11743
209 Ga0495621_0075122 3300046539 Bacteria 1251
210 Ga0495645_0106981 3300046543 Bacteria 1983
211 Ga0495645_0127219 3300046543 Bacteria 1789
212 Ga0495622_0011692 3300046557 Bacteria 4058
213 Ga0495633_0000358 3300046558 Bacteria 49277
214 Ga0495633_0014290 3300046558 Bacteria 4157
215 Ga0495633_0220313 3300046558 Unclassified 869
216 Ga0495667_0013568 3300046559 Bacteria 5512
217 Ga0495667_0042994 3300046559 Bacteria 2995
218 Ga0495656_0012590 3300046615 Bacteria 3126
219 Ga0495656_0023987 3300046615 Bacteria 2404
220 Ga0495656_0030555 3300046615 Bacteria 2178
221 Ga0495634_0016797 3300046642 Bacteria 5228
222 Ga0495634_0041125 3300046642 Bacteria 3140
223 Ga0495634_0060184 3300046642 Unclassified 2527
224 Ga0495611_0001899 3300046648 Bacteria 9944
225 Ga0495625_0004227 3300046660 Bacteria 13682
226 Ga0495625_0004379 3300046660 Bacteria 13393
227 Ga0495625_0005626 3300046660 Bacteria 11364
228 Ga0495625_0014501 3300046660 Bacteria 6283
229 Ga0495625_0080132 3300046660 Bacteria 2274
230 Ga0495625_0313298 3300046660 Bacteria 1001
231 Ga0495625_0436145 3300046660 Bacteria 812
232 Ga0495635_0026007 3300046663 Bacteria 4076
233 Ga0495635_0354109 3300046663 Unclassified 979
234 Ga0495659_0000926 3300046664 Bacteria 10409
235 Ga0495661_0016666 3300046665 Bacteria 4864
236 Ga0495661_0022227 3300046665 Bacteria 4127
237 Ga0495661_0098235 3300046665 Bacteria 1653
238 Ga0495588_0036138 3300046674 Bacteria 2505
239 Ga0495657_0052456 3300046675 Bacteria 2734
240 Ga0495657_0069554 3300046675 Bacteria 2303
241 Ga0495599_0373190 3300046678 Unclassified 852
242 Ga0495623_0233132 3300046679 Unclassified 1043
243 Ga0495646_0007062 3300046680 Bacteria 7133
244 Ga0495647_0001811 3300046681 Bacteria 6610
245 Ga0495613_0058184 3300046689 Unclassified 2837
246 Ga0495613_0569509 3300046689 Bacteria 756
247 Ga0495613_0742818 3300046689 Unclassified 643
248 Ga0495624_0066638 3300046690 Unclassified 2247
249 Ga0495624_0091142 3300046690 Bacteria 1881
250 Ga0495670_0000501 3300046691 Bacteria 18590
251 Ga0495670_0005798 3300046691 Bacteria 6051
252 Ga0495670_0021110 3300046691 Bacteria 3211
253 Ga0495670_0168129 3300046691 Bacteria 1154
254 Ga0495671_0031260 3300046692 Bacteria 2722
255 Ga0495671_0395458 3300046692 Bacteria 662
256 Ga0495649_0272684 3300046694 Bacteria 865
257 Ga0495589_0022389 3300046794 Bacteria 3225
258 Ga0495589_0163978 3300046794 Bacteria 1058
259 Ga0495589_0208335 3300046794 Bacteria 921
260 Ga0495581_0039716 3300047315 Bacteria 2724
261 Ga0495604_0003851 3300047317 Bacteria 11951
262 Ga0495604_0045643 3300047317 Bacteria 3419
263 Ga0495604_0049304 3300047317 Bacteria 3273
264 Ga0495604_0364382 3300047317 Bacteria 958
265 Ga0495636_0001261 3300047318 Bacteria 9589
266 Ga0495674_0054501 3300047319 Bacteria 3511
267 Ga0495672_0001033 3300047320 Bacteria 28619
268 Ga0495672_0005567 3300047320 Bacteria 9960
269 Ga0495672_0315036 3300047320 Unclassified 737
270 Ga0495676_0017952 3300047321 Bacteria 6243
271 Ga0495676_0065638 3300047321 Bacteria 2816
272 Ga0495680_0020450 3300047322 Bacteria 5569
273 Ga0495680_0089195 3300047322 Bacteria 2315
274 Ga0495680_0385733 3300047322 Bacteria 970
275 Ga0495683_0018637 3300047323 Bacteria 3586
276 Ga0495687_001119 3300047443 Bacteria 26043
277 Ga0495687_003924 3300047443 Bacteria 10417
278 Ga0495687_018538 3300047443 Bacteria 3439
279 Ga0495675_0059992 3300047444 Bacteria 2411
280 Ga0495675_0194228 3300047444 Bacteria 1238
281 Ga0495685_000215 3300047447 Bacteria 19545
282 Ga0495673_0010216 3300047469 Bacteria 5122
283 Ga0495684_0001317 3300047471 Bacteria 19978
284 Ga0495684_0430514 3300047471 Bacteria 921
285 Ga0495686_0000576 3300047472 Bacteria 52136
286 Ga0495593_0112736 3300047673 Unclassified 1388
287 Ga0495614_0032832 3300048089 Bacteria 2233
288 Ga0495614_0114657 3300048089 Bacteria 1185
289 Ga0495615_0017431 3300048090 Bacteria 1564
290 Ga0495626_0038860 3300048091 Bacteria 2254
291 Ga0496102_0017683 3300048905 Bacteria 6249
292 Ga0496105_0274799 3300048908 Unclassified 1360
293 Ga0496105_0866954 3300048908 Bacteria 682
294 Ga0496108_0081507 3300048911 Bacteria 2742
295 Ga0496109_0239794 3300048912 Bacteria 1706
296 Ga0496110_0210269 3300048913 Bacteria 1768
297 Ga0496111_0116879 3300048914 Bacteria 1967
298 Ga0496113_0539834 3300048916 Bacteria 936
299 Ga0496116_0001337 3300048919 Bacteria 28054
300 Ga0496117_0021143 3300048920 Bacteria 5280
301 Ga0496117_0032739 3300048920 Bacteria 3945
302 Ga0496121_0002710 3300048924 Bacteria 26470
303 Ga0496122_0021734 3300048925 Bacteria 5729
304 Ga0496123_0001934 3300048926 Bacteria 27003
305 Ga0496124_0001937 3300048927 Bacteria 28380
306 Ga0496124_0025275 3300048927 Bacteria 5381
307 Ga0496125_0220365 3300048928 Bacteria 1223
308 Ga0495678_013464 3300049459 Bacteria 3839
309 Ga0495682_0000013 3300049460 Bacteria 259670
310 Ga0495682_0000360 3300049460 Bacteria 33234
311 Ga0501031_0069415 3300049568 Bacteria 2295
312 Ga0501032_0155342 3300049569 Bacteria 1503
313 Ga0501033_0064146 3300049570 Bacteria 2703
314 Ga0501034_0228608 3300049571 Bacteria 1810
315 Ga0501036_0000858 3300049572 Bacteria 22614
316 Ga0501037_0022914 3300049573 Bacteria 4618
317 Ga0501038_0067551 3300049574 Bacteria 3041
318 Ga0501038_0373180 3300049574 Bacteria 1108
319 Ga0501039_0005465 3300049575 Bacteria 9610
320 Ga0501039_0151160 3300049575 Bacteria 1824
321 Ga0501040_0006438 3300049576 Bacteria 7623
322 Ga0501041_0020762 3300049577 Bacteria 3929
323 Ga0501041_0206037 3300049577 Bacteria 1233
324 Ga0501042_0002982 3300049578 Bacteria 10526
325 Ga0501043_0030908 3300049579 Bacteria 4212
326 Ga0501046_0002074 3300049580 Bacteria 19022
327 Ga0501048_0078596 3300049582 Bacteria 2328
328 Ga0501070_0147576 3300049586 Bacteria 1941
329 Ga0501071_0203426 3300049587 Bacteria 1488
330 Ga0501071_0259930 3300049587 Unclassified 1311
331 Ga0501072_0006307 3300049588 Bacteria 9030
332 Ga0501072_0164310 3300049588 Bacteria 1771
333 Ga0501074_0068912 3300049590 Bacteria 2543
334 Ga0501074_0087696 3300049590 Bacteria 2228
335 Ga0501075_0010322 3300049591 Bacteria 6563
336 Ga0501075_0027617 3300049591 Bacteria 4183
337 Ga0501075_0071623 3300049591 Bacteria 2620
338 Ga0501075_0529367 3300049591 Unclassified 899
339 Ga0501076_0064333 3300049592 Bacteria 2923
340 Ga0501076_0136332 3300049592 Bacteria 1992
341 Ga0501077_0012328 3300049593 Bacteria 5354
342 Ga0501077_0042913 3300049593 Bacteria 2874
343 Ga0501077_0380391 3300049593 Bacteria 902
344 Ga0501079_0005946 3300049741 Bacteria 9129
345 Ga0501079_0043031 3300049741 Bacteria 3486
346 Ga0501079_0053969 3300049741 Bacteria 3100
347 Ga0501081_0006478 3300049743 Bacteria 7600
348 Ga0501081_0008811 3300049743 Bacteria 6556
349 Ga0501081_0036808 3300049743 Bacteria 3337
350 Ga0501081_0075176 3300049743 Bacteria 2358
351 Ga0501081_0497767 3300049743 Bacteria 908
352 Ga0501035_0045568 3300049822 Bacteria 3946
353 Ga0501035_0069621 3300049822 Bacteria 3118
354 Ga0501044_0056543 3300049823 Bacteria 4029
355 Ga0501044_0314525 3300049823 Bacteria 1492
356 Ga0501045_0058548 3300049824 Bacteria 2821
357 nmdc:mga05p37_3516_c1 3300050507 Bacteria 18305
358 nmdc:mga05p37_842176_c1 3300050507 Bacteria 997
359 nmdc:mga0qj67_290414_c1 3300050509 Bacteria 1325
360 nmdc:mga0n895_256523_c1 3300050512 Bacteria 1774
361 nmdc:mga0a205_92575_c2 3300050515 Bacteria 2572
362 nmdc:mga0sz30_52460_c1 3300050516 Bacteria 1731
363 Ga0495601_0002753 3300053077 Bacteria 9988
364 Ga0495601_0465064 3300053077 Bacteria 817
365 Ga0495612_0050842 3300053078 Unclassified 1702
366 Ga0495612_0058933 3300053078 Bacteria 1587
367 Ga0495619_0002119 3300053085 Bacteria 13146
368 Ga0495619_0003071 3300053085 Bacteria 10843
369 Ga0495619_0061788 3300053085 Bacteria 2493
370 Ga0495619_0074387 3300053085 Bacteria 2278
371 Ga0500607_170660 3300053121 Unclassified 980
372 Ga0500559_0263848 3300053136 Unclassified 811
373 Ga0500568_0000549 3300053139 Bacteria 27581
374 Ga0500568_0014246 3300053139 Bacteria 3596
375 Ga0500590_000211 3300053148 Bacteria 17788
376 Ga0500616_0000956 3300053153 Bacteria 31287
377 Ga0501084_0004761 3300054114 Bacteria 11093
378 Ga0501084_0005019 3300054114 Bacteria 10823
379 Ga0501084_0019794 3300054114 Bacteria 5609
380 Ga0501084_0080155 3300054114 Bacteria 2737
381 Ga0501082_0008345 3300060353 Bacteria 8934
382 Ga0501082_0052459 3300060353 Bacteria 3515
383 Ga0501082_0112375 3300060353 Bacteria 2358
384 Ga0501082_0154291 3300060353 Bacteria 1995
385 Ga0530510_0004079 3300061734 Bacteria 10082
386 2509373344 2509276018 Bacteria 6910194
387 2510899606 2510461076 Bacteria 8618824
388 2513632817 2513237093 Bacteria 7545552
389 2513913622 2513237144 Bacteria 7530820
390 2514034804 2513237164 Bacteria 7563725
391 2515655980 2515154116 Bacteria 7552979
392 2517081027 2516653085 Bacteria 7346596
393 2517407989 2517287029 Bacteria 6905599
394 2585231384 2582581299 Bacteria 6518058
395 2585232287 2582581299 Bacteria 6518058
396 2585540146 2585427528 Bacteria 6842387
397 2585838344 2585427593 Bacteria 7141551
398 2599101287 2597490356 Bacteria 7030811
399 2599103637 2597490356 Bacteria 7030811
400 2644004990 2643221599 Bacteria 6292121
401 2644190866 2643221634 Bacteria 6705461
402 2738805742 2738541293 Bacteria 7065685
403 2738824162 2738541296 Bacteria 7285013
404 2738836963 2738541298 Bacteria 7286732
405 2738878494 2738541306 Bacteria 7284992
406 2739190132 2738543002 Bacteria 7284546
407 2739225087 2738543008 Bacteria 7282815
408 2756678114 2756170246 Bacteria 7451806
409 2766069190 2765235942 Bacteria 7445910
410 2793350183 2791355264 Bacteria 6429314
411 2793366192 2791355267 Bacteria 7222458
412 2838666960 2838661181 Bacteria 7385261
413 2838693545 2838686498 Bacteria 7807632
414 2838735438 2838729681 Bacteria 7400765
415 2838748340 2838742623 Bacteria 7396178
416 2841858404 2841851746 Bacteria 7532261
417 2842111460 2842110456 Bacteria 7656360
418 2842162652 2842156927 Bacteria 6894975
419 2842186156 2842180545 Bacteria 6888678
420 2842236031 2842229732 Bacteria 7475766
421 2842249962 2842243621 Bacteria 7421798
422 2842263258 2842257432 Bacteria 7401195
423 2842278014 2842271015 Bacteria 7807131
424 2844006575 2844002411 Bacteria 7168230
425 2844012130 2844009547 Bacteria 6728125
426 2844461123 2844454524 Bacteria 7952546
427 2846953991 2846952575 Bacteria 6587527
428 2846957321 2846952575 Bacteria 6587527
429 2848859835 2848858292 Bacteria 7391279
430 2848863338 2848858292 Bacteria 7391279
431 2856330798 2856328259 Bacteria 6528202
432 2869255025 2869249662 Bacteria 6868783
433 2869264507 2869264136 Bacteria 6880765
434 2869275318 2869271264 Bacteria 6908218
435 2871454666 2871451962 Bacteria 7336357
436 2871463268 2871459585 Bacteria 6866887
437 2871472529 2871466892 Bacteria 6923287
438 2874137363 2874131515 Bacteria 6820270
439 2876406290 2876399893 Bacteria 6927900
440 2906366979 2906363423 Bacteria 6856682
441 2906376744 2906370794 Bacteria 6881062
442 2906379498 2906378014 Bacteria 6911440
443 2906395936 2906393657 Bacteria 6790866
444 2924739776 2924733363 Bacteria 7574837
445 2933017430 2933016740 Bacteria 6355406
446 2933588014 2933586486 Bacteria 7667493
447 2937844000 2937843397 Bacteria 5256375
448 2945939256 2945934425 Bacteria 7444609
449 2961142195 2961136820 Bacteria 6775228
450 2965028322 2965025482 Bacteria 6532201
451 2965044769 2965040258 Bacteria 6855979
452 2965096288 2965089291 Bacteria 6866420
453 2965109797 2965102966 Bacteria 6800987
454 2968146572 2968138860 Bacteria 6605449
455 2970551000 2970547951 Bacteria 6931819
456 2970625558 2970619444 Bacteria 6986144
457 2977918648 2977915119 Bacteria 6829656
458 2977951705 2977950692 Bacteria 6893264
459 2990706595 2990703756 Bacteria 7715990
460 3004170636 3004167301 Bacteria 8330599
461 3004201635 3004195979 Bacteria 6776956
462 3004274228 3004268573 Bacteria 7043476
463 3005414095 3005409236 Bacteria 7188837
464 3005455236 3005452660 Bacteria 5889319
465 642426471 641736151 Bacteria 7477263
466 649865066 649633066 Bacteria 6690028
467 8004367247 8004361976 Bacteria 6858373
468 8018127924 8018127388 Bacteria 7351159
469 8056379880 8056375014 Bacteria 7006639
470 Ga0209758_1025771
471 JGI24740J21852_10006904
472 JGI24739J22299_10002997
473 JGI24739J22299_10045722
474 JGI24735J21928_10024815
475 rootL2_10111805
476 Ga0055540_1000126
477 Ga0055531_10039839
478 Ga0070670_100000326
479 Ga0070660_100121718
480 Ga0070667_101087230
481 Ga0070714_100056191
482 Ga0070713_100068388
483 Ga0070713_100553760
484 Ga0070681_10108863
485 Ga0070681_10423727
486 Ga0070698_100167947
487 Ga0070698_100203782
488 Ga0070698_100258225
489 Ga0070699_100026293
490 Ga0070679_100062372
491 Ga0070672_100342015
492 Ga0070686_100387017
493 Ga0070665_101125044
494 Ga0068855_100634209
495 Ga0068860_100793443
496 Ga0068860_100938653
497 Ga0081538_10025688
498 Ga0070712_100613153
499 Ga0075369_10075119
500 Ga0075428_100172066
501 Ga0075428_100179848
502 Ga0075428_100698433
503 Ga0075430_100111378
504 Ga0075433_10069840
505 Ga0075434_100092700
506 Ga0075434_100673767
507 Ga0111539_10091189
508 Ga0111539_10733965
509 Ga0114129_10002667
510 Ga0114129_11095908
511 Ga0105248_10384681
512 Ga0105238_10585919
513 Ga0157369_10137389
514 Ga0157378_10059250
515 Ga0157372_10645301
516 Ga0157379_10243746
517 Ga0157376_10564215
518 Ga0213872_10095652
519 Ga0213876_10091033
520 Ga0209673_1058600
521 Ga0209050_1010218
522 Ga0209256_1017325
523 Ga0209051_1000201
524 Ga0209257_1005375
525 Ga0207692_10202372
526 Ga0207707_10271668
527 Ga0207707_10364927
528 Ga0207693_10060596
529 Ga0207660_10200119
530 Ga0207657_10048647
531 Ga0207650_10000206
532 Ga0207664_10158379
533 Ga0207665_10072642
534 Ga0207665_10137127
535 Ga0207667_10557313
536 Ga0207667_10614943
537 Ga0268266_10626012
538 Ga0268264_10840557
539 Ga0265338_10275282
540 Ga0265325_10093648
541 Ga0265339_10029634
542 Ga0265331_10003111
543 Ga0307513_10008385
544 Ga0265313_10000832
545 Ga0265314_10035140
546 Ga0307412_10000095
547 Ga0316587_1031239
548 Ga0373926_0012489
549 Ga0373934_0071627
550 Ga0373944_0035422
551 Ga0373944_0160231
552 Ga0373923_0074019
553 Ga0373923_0106925
554 Ga0373945_0017670
555 Ga0373945_0167441
556 Ga0373954_0043566
557 Ga0373954_0043743
558 Ga0373954_0050486
559 Ga0373943_0119423
560 Ga0373943_0195708
561 Ga0373946_0081043
562 Ga0373946_0099459
563 Ga0373946_0147470
564 Ga0373955_0026014
565 Ga0373931_0007997
566 Ga0373931_0086107
567 Ga0373935_0040988
568 Ga0373935_0179139
569 Ga0373935_0188964
570 Ga0373927_0182136
571 Ga0373927_0190732
572 Ga0373933_0218753
573 Ga0373947_0039396
574 Ga0373947_0040457
575 Ga0373937_0029689
576 Ga0373937_0057854
577 Ga0373937_0121025
578 Ga0373925_0072015
579 Ga0373925_0275861
580 Ga0373925_0285147
581 Ga0373925_0618415
582 Ga0395899_0128856
583 Ga0395900_0157101
584 Ga0436364_0817580
585 Ga0395901_0753611
586 Ga0436365_1535498
587 Ga0436360_1018108
588 Ga0436360_1228930
589 Ga0436360_1238321
590 Ga0436361_0003422
591 Ga0436361_0136861
592 Ga0436361_0322884
593 Ga0436361_1161468
594 Ga0436362_0431549
595 Ga0451833_0237958
596 Ga0451839_0476402
597 Ga0451841_0285453
598 Ga0451847_0943666
599 Ga0451849_0692893
600 Ga0451850_47952
601 Ga0451851_0271909
602 Ga0451855_0215471
603 Ga0451853_1709556
604 Ga0495617_001063
605 Ga0495617_111562
606 Ga0495603_0062121
607 Ga0495603_0092608
608 Ga0495603_0165413
609 Ga0495629_0003713
610 Ga0495629_0047335
611 Ga0495629_0095802
612 Ga0495638_0001187
613 Ga0495641_0010013
614 Ga0495651_0073288
615 Ga0495651_0090760
616 Ga0495651_0315492
617 Ga0495653_0004128
618 Ga0495653_0578226
619 Ga0495580_0028271
620 Ga0495582_0209249
621 Ga0495582_0499994
622 Ga0495605_0027562
623 Ga0495639_0039290
624 Ga0495639_0111122
625 Ga0495639_0169007
626 Ga0495662_0001485
627 Ga0495662_0077097
628 Ga0495664_0060862
629 Ga0495664_0277807
630 Ga0495664_0380785
631 Ga0495584_0000048
632 Ga0495584_0018481
633 Ga0495585_0004231
634 Ga0495585_0004625
635 Ga0495585_0068308
636 Ga0495585_0122544
637 Ga0495594_0036904
638 Ga0495596_0082804
639 Ga0495607_0031873
640 Ga0495607_0036751
641 Ga0495607_0105434
642 Ga0495583_0000108
643 Ga0495583_0000323
644 Ga0495583_0001447
645 Ga0495583_0013521
646 Ga0495606_0195798
647 Ga0495608_0039944
648 Ga0495608_0213636
649 Ga0495610_0000447
650 Ga0495610_0016553
651 Ga0495610_0159568
652 Ga0495616_0000564
653 Ga0495616_0003327
654 Ga0495616_0020473
655 Ga0495616_0113708
656 Ga0495618_0106257
657 Ga0495618_0263623
658 Ga0495620_0015347
659 Ga0495628_0176506
660 Ga0495628_0349632
661 Ga0495630_0055858
662 Ga0495643_0002177
663 Ga0495644_0000294
664 Ga0495644_0001391
665 Ga0495648_0000233
666 Ga0495648_0029858
667 Ga0495648_0064352
668 Ga0495666_0147830
669 Ga0495652_0049569
670 Ga0495665_0036335
671 Ga0495640_0004052
672 Ga0495640_0086304
673 Ga0495640_0144792
674 Ga0495640_0230765
675 Ga0495640_0281772
676 Ga0495609_0001334
677 Ga0495609_0002325
678 Ga0495621_0075122
679 Ga0495645_0106981
680 Ga0495645_0127219
681 Ga0495622_0011692
682 Ga0495633_0000358
683 Ga0495633_0014290
684 Ga0495633_0220313
685 Ga0495667_0013568
686 Ga0495667_0042994
687 Ga0495656_0012590
688 Ga0495656_0023987
689 Ga0495656_0030555
690 Ga0495634_0016797
691 Ga0495634_0041125
692 Ga0495634_0060184
693 Ga0495611_0001899
694 Ga0495625_0004227
695 Ga0495625_0004379
696 Ga0495625_0005626
697 Ga0495625_0014501
698 Ga0495625_0080132
699 Ga0495625_0313298
700 Ga0495625_0436145
701 Ga0495635_0026007
702 Ga0495635_0354109
703 Ga0495659_0000926
704 Ga0495661_0016666
705 Ga0495661_0022227
706 Ga0495661_0098235
707 Ga0495588_0036138
708 Ga0495657_0052456
709 Ga0495657_0069554
710 Ga0495599_0373190
711 Ga0495623_0233132
712 Ga0495646_0007062
713 Ga0495647_0001811
714 Ga0495613_0058184
715 Ga0495613_0569509
716 Ga0495613_0742818
717 Ga0495624_0066638
718 Ga0495624_0091142
719 Ga0495670_0000501
720 Ga0495670_0005798
721 Ga0495670_0021110
722 Ga0495670_0168129
723 Ga0495671_0031260
724 Ga0495671_0395458
725 Ga0495649_0272684
726 Ga0495589_0022389
727 Ga0495589_0163978
728 Ga0495589_0208335
729 Ga0495581_0039716
730 Ga0495604_0003851
731 Ga0495604_0045643
732 Ga0495604_0049304
733 Ga0495604_0364382
734 Ga0495636_0001261
735 Ga0495674_0054501
736 Ga0495672_0001033
737 Ga0495672_0005567
738 Ga0495672_0315036
739 Ga0495676_0017952
740 Ga0495676_0065638
741 Ga0495680_0020450
742 Ga0495680_0089195
743 Ga0495680_0385733
744 Ga0495683_0018637
745 Ga0495687_001119
746 Ga0495687_003924
747 Ga0495687_018538
748 Ga0495675_0059992
749 Ga0495675_0194228
750 Ga0495685_000215
751 Ga0495673_0010216
752 Ga0495684_0001317
753 Ga0495684_0430514
754 Ga0495686_0000576
755 Ga0495593_0112736
756 Ga0495614_0032832
757 Ga0495614_0114657
758 Ga0495615_0017431
759 Ga0495626_0038860
760 Ga0496102_0017683
761 Ga0496105_0274799
762 Ga0496105_0866954
763 Ga0496108_0081507
764 Ga0496109_0239794
765 Ga0496110_0210269
766 Ga0496111_0116879
767 Ga0496113_0539834
768 Ga0496116_0001337
769 Ga0496117_0021143
770 Ga0496117_0032739
771 Ga0496121_0002710
772 Ga0496122_0021734
773 Ga0496123_0001934
774 Ga0496124_0001937
775 Ga0496124_0025275
776 Ga0496125_0220365
777 Ga0495678_013464
778 Ga0495682_0000013
779 Ga0495682_0000360
780 Ga0501031_0069415
781 Ga0501032_0155342
782 Ga0501033_0064146
783 Ga0501034_0228608
784 Ga0501036_0000858
785 Ga0501037_0022914
786 Ga0501038_0067551
787 Ga0501038_0373180
788 Ga0501039_0005465
789 Ga0501039_0151160
790 Ga0501040_0006438
791 Ga0501041_0020762
792 Ga0501041_0206037
793 Ga0501042_0002982
794 Ga0501043_0030908
795 Ga0501046_0002074
796 Ga0501048_0078596
797 Ga0501070_0147576
798 Ga0501071_0203426
799 Ga0501071_0259930
800 Ga0501072_0006307
801 Ga0501072_0164310
802 Ga0501074_0068912
803 Ga0501074_0087696
804 Ga0501075_0010322
805 Ga0501075_0027617
806 Ga0501075_0071623
807 Ga0501075_0529367
808 Ga0501076_0064333
809 Ga0501076_0136332
810 Ga0501077_0012328
811 Ga0501077_0042913
812 Ga0501077_0380391
813 Ga0501079_0005946
814 Ga0501079_0043031
815 Ga0501079_0053969
816 Ga0501081_0006478
817 Ga0501081_0008811
818 Ga0501081_0036808
819 Ga0501081_0075176
820 Ga0501081_0497767
821 Ga0501035_0045568
822 Ga0501035_0069621
823 Ga0501044_0056543
824 Ga0501044_0314525
825 Ga0501045_0058548
826 nmdc:mga05p37_3516_c1
827 nmdc:mga05p37_842176_c1
828 nmdc:mga0qj67_290414_c1
829 nmdc:mga0n895_256523_c1
830 nmdc:mga0a205_92575_c2
831 nmdc:mga0sz30_52460_c1
832 Ga0495601_0002753
833 Ga0495601_0465064
834 Ga0495612_0050842
835 Ga0495612_0058933
836 Ga0495619_0002119
837 Ga0495619_0003071
838 Ga0495619_0061788
839 Ga0495619_0074387
840 Ga0500607_170660
841 Ga0500559_0263848
842 Ga0500568_0000549
843 Ga0500568_0014246
844 Ga0500590_000211
845 Ga0500616_0000956
846 Ga0501084_0004761
847 Ga0501084_0005019
848 Ga0501084_0019794
849 Ga0501084_0080155
850 Ga0501082_0008345
851 Ga0501082_0052459
852 Ga0501082_0112375
853 Ga0501082_0154291
854 Ga0530510_0004079
855 2509373344
856 2510899606
857 2513632817
858 2513913622
859 2514034804
860 2515655980
861 2517081027
862 2517407989
863 2585231384
864 2585232287
865 2585540146
866 2585838344
867 2599101287
868 2599103637
869 2644004990
870 2644190866
871 2738805742
872 2738824162
873 2738836963
874 2738878494
875 2739190132
876 2739225087
877 2756678114
878 2766069190
879 2793350183
880 2793366192
881 2838666960
882 2838693545
883 2838735438
884 2838748340
885 2841858404
886 2842111460
887 2842162652
888 2842186156
889 2842236031
890 2842249962
891 2842263258
892 2842278014
893 2844006575
894 2844012130
895 2844461123
896 2846953991
897 2846957321
898 2848859835
899 2848863338
900 2856330798
901 2869255025
902 2869264507
903 2869275318
904 2871454666
905 2871463268
906 2871472529
907 2874137363
908 2876406290
909 2906366979
910 2906376744
911 2906379498
912 2906395936
913 2924739776
914 2933017430
915 2933588014
916 2937844000
917 2945939256
918 2961142195
919 2965028322
920 2965044769
921 2965096288
922 2965109797
923 2968146572
924 2970551000
925 2970625558
926 2977918648
927 2977951705
928 2990706595
929 3004170636
930 3004201635
931 3004274228
932 3005414095
933 3005455236
934 642426471
935 649865066
936 8004367247
937 8018127924
938 8056379880

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04972

BON

BON domain

166

234

0.97

PF00571

CBS

CBS domain

13

69

0.96

PF00571

CBS

CBS domain

100

155

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lhh-assembly1.cif.gz_A the crystal structure of cbs domain protein from shewanella oneidensis mr-1. 0.8626 5 57
3kpc-assembly1.cif.gz_A crystal structure of the cbs domain pair of protein mj0100 in complex with 5 -methylthioadenosine and s-adenosyl-l-methionine 0.862 1 118
3kpd-assembly2.cif.gz_C crystal structure of the cbs domain pair of protein mj0100 in complex with 5 -methylthioadenosine and s-adenosyl-l-methionine. 0.8612 1 118
7r50-assembly2.cif.gz_K crystal structure of gmp reductase from mycobacterium smegmatis in complex with gmp. 0.8548 10 116
7r50-assembly2.cif.gz_J crystal structure of gmp reductase from mycobacterium smegmatis in complex with gmp. 0.8517 11 51
ID Description Score Start End Superfamily
af_Q54J25_40_183_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9078 10 55 3.10.580.10
af_Q9XI37_196_349_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9057 8 55 3.10.580.10
af_P0AFH8_57_122_3.30.1340.30 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;; 0.8846 147 208 3.30.1340.30
af_P0AE45_193_346_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.882 6 53 3.10.580.10
af_P9WFP3_200_346_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8629 1 53 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A345ZH19-F1-model_v4 BON domain-containing protein 0.9183 141 211
AF-A0A847LX49-F1-model_v4 CBS domain-containing protein 0.8912 1 103
AF-A0A7J4FVD2-F1-model_v4 CBS domain-containing protein 0.8881 1 116
AF-A0A6M1PS40-F1-model_v4 deleted 0.8861 138 214
AF-W8X4Z4-F1-model_v4 RNA-binding region RNP-1 0.8809 139 213

Map